LIM/homeobox protein

Overview
NameLIM/homeobox protein
Smed IDSMED30007640
Length (bp)964
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM/homeobox protein (SMED30007640) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM/homeobox protein (SMED30007640) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM/homeobox protein (SMED30007640) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM/homeobox protein (SMED30007640) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007640

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007640SMESG000071273.1 SmedASXL_010428SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30007640SMESG000071273.1 dd_Smed_v6_20755_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
central nervous systemSMED30007640SMESG000071273.1 KJ934804smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30007640SMESG000071273.1 SMESG000028975.1 OX_Smed_1.0.10523ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LIM/homeobox protein vs. Ensembl Human
Match: LHX3 (LIM homeobox 3 [Source:HGNC Symbol;Acc:HGNC:6595])

HSP 1 Score: 269.626 bits (688), Expect = 8.831e-88
Identity = 128/235 (54.47%), Postives = 166/235 (70.64%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQG---ENGGSKVTSNKGDSDELSDDQTNEP 878
            EI  C  C   ILDR +LK     WH +CL C+DC  PL ++C+S+ + ++CK+DFF+R+GT+CAAC   IP ++V+R+AQ+ +YHL CFAC+ C RQL TG+EF+L+   +L+C+ D+E AK +E E     KRPRTTITAKQLE LK  Y+ S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   YF+      GGSK   +     + SD + + P
Sbjct:   16 EIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATA--KRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQ-YFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFP 247          
BLAST of LIM/homeobox protein vs. Ensembl Human
Match: LHX3 (LIM homeobox 3 [Source:HGNC Symbol;Acc:HGNC:6595])

HSP 1 Score: 269.24 bits (687), Expect = 1.625e-87
Identity = 128/235 (54.47%), Postives = 166/235 (70.64%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQG---ENGGSKVTSNKGDSDELSDDQTNEP 878
            EI  C  C   ILDR +LK     WH +CL C+DC  PL ++C+S+ + ++CK+DFF+R+GT+CAAC   IP ++V+R+AQ+ +YHL CFAC+ C RQL TG+EF+L+   +L+C+ D+E AK +E E     KRPRTTITAKQLE LK  Y+ S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   YF+      GGSK   +     + SD + + P
Sbjct:   27 EIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATA--KRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQ-YFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFP 258          
BLAST of LIM/homeobox protein vs. Ensembl Human
Match: LHX3 (LIM homeobox 3 [Source:HGNC Symbol;Acc:HGNC:6595])

HSP 1 Score: 269.24 bits (687), Expect = 1.672e-87
Identity = 128/235 (54.47%), Postives = 166/235 (70.64%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQG---ENGGSKVTSNKGDSDELSDDQTNEP 878
            EI  C  C   ILDR +LK     WH +CL C+DC  PL ++C+S+ + ++CK+DFF+R+GT+CAAC   IP ++V+R+AQ+ +YHL CFAC+ C RQL TG+EF+L+   +L+C+ D+E AK +E E     KRPRTTITAKQLE LK  Y+ S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   YF+      GGSK   +     + SD + + P
Sbjct:   32 EIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATA--KRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQ-YFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFP 263          
BLAST of LIM/homeobox protein vs. Ensembl Human
Match: LHX4 (LIM homeobox 4 [Source:HGNC Symbol;Acc:HGNC:21734])

HSP 1 Score: 265.388 bits (677), Expect = 4.749e-86
Identity = 120/204 (58.82%), Postives = 153/204 (75.00%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPY 794
            +I  C  C   ILD+ +LKV    WH  CL C DC + L D+C+S++  ++CKEDFF+R+GT+C AC + IP ++V+RKAQ+ +YHL CFACI C+RQL TG+EF+L+   +L+C+ D+E AK  + + + G KRPRTTITAKQLE LK  Y  S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   Y
Sbjct:   26 QIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDYETAKQND-DSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFY 228          
BLAST of LIM/homeobox protein vs. Ensembl Human
Match: LHX5 (LIM homeobox 5 [Source:HGNC Symbol;Acc:HGNC:14216])

HSP 1 Score: 207.994 bits (528), Expect = 1.061e-63
Identity = 97/252 (38.49%), Postives = 148/252 (58.73%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF---------------------------------------------EIAKTKEQELDQGNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQ 800
            + +C  C+ PILDR +L V    WH++C+ C +C   L +KC+S+  +++CK DFFRR+GT+CA C + I  S+++RKA++ ++HL CF C+ C++QL+TGEE +++   K +C+ D+                                             E A  + +E + G KR  PRTTI AKQLE LK  ++ + KP RH+REQL+ +TGL+MRV+QVWFQNRR+KE+RMK+ +  G     +F+
Sbjct:    2 MVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLSSSSLKEGSLNSVSSCTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFR 253          
BLAST of LIM/homeobox protein vs. Ensembl Celegans
Match: ceh-14 (Homeobox protein ceh-14 [Source:UniProtKB/Swiss-Prot;Acc:P20271])

HSP 1 Score: 228.409 bits (581), Expect = 1.140e-72
Identity = 115/227 (50.66%), Postives = 152/227 (66.96%), Query Frame = 3
Query:  177 DNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSS-RKLMCRPDFEIAKTK---EQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDS 845
            +NE + C  C   I DR V KV    +H  CL C+ C   L   C+ + D ++C+  F++++GT+C++C+E I    V+RKA N++YH+ECF C  C R L TGEEF+L++   +L+C+ D+E A+ K   E E D  NKRPRTTI+AK LE LK+ Y  SSKPARHVREQL+++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W S      +  S + S  G S
Sbjct:   42 NNEEAICSLCDKKIRDRFVSKVNGRCYHSSCLRCSTCKDELGATCFLREDSMYCRAHFYKKFGTKCSSCNEGIVPDHVVRKASNHVYHVECFQCFICKRSLETGEEFYLIADDARLVCKDDYEQARDKHCNELEGDGSNKRPRTTISAKSLETLKQAYQTSSKPARHVREQLASETGLDMRVVQVWFQNRRAKEKRLKKDAGRR-WKSSNRAESDSNSPIESINGQS 267          
BLAST of LIM/homeobox protein vs. Ensembl Celegans
Match: lin-11 (pep chromosome:WBcel235:I:10248256:10255327:1 gene:WBGene00003000.1 transcript:ZC247.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-11)

HSP 1 Score: 187.578 bits (475), Expect = 3.676e-56
Identity = 94/234 (40.17%), Postives = 129/234 (55.13%), Query Frame = 3
Query:  195 CIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIA-KTK----------------------------EQELDQGN----------------KRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKK 761
            C AC  PILDR V  V    WH  CL C DC  P+   C+S+   I CK DF RRY  RCA CD  +   +++R+A++ ++H+ CF C  C R L+TG++ +++   + +C+ DF+ A KT                             E  LD G                 + PRTTI AKQLE LK  ++ + KP RH+REQL+A+TGL+MRV+QVWFQNRR+KE+RMK+
Sbjct:   68 CAACAQPILDRYVFTVLGKCWHQSCLRCCDCRAPMSMTCFSRDGLILCKTDFSRRYSQRCAGCDGKLEKEDLVRRARDKVFHIRCFQCSVCQRLLDTGDQLYIMEGNRFVCQSDFQTATKTSTPTSIHRPVSNGSECNSDVEEDNVDACDEVGLDDGEGDCGKDNSDDSNSAKRRGPRTTIKAKQLETLKNAFAATPKPTRHIREQLAAETGLNMRVIQVWFQNRRSKERRMKQ 301          
BLAST of LIM/homeobox protein vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 152.525 bits (384), Expect = 2.233e-43
Identity = 83/224 (37.05%), Postives = 123/224 (54.91%), Query Frame = 3
Query:  168 IKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF-EIAKTKEQELDQ--GNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTS 830
            IK D  I  C  C+  I D+  L +    +H  CL C+ C  PL +KC+ K    +CK  +FR  G +CA+CD  I A++ +R+A+N +YHL CF+C  C RQL+TGEE + L    L+C+  F E+ +       Q    KR RTT    QL  L+  ++  S P     E++++ TGL  RV QVWFQN RA++K+  + +          +G+NG S+ +S
Sbjct:   89 IKPDAVIVICTQCQHQIQDKFFLSIDGRNYHENCLQCSTCENPLSNKCFYKDKTFYCKGCYFRELGPKCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEE-YALQEGNLLCKQHFLELVEGDSGVSSQKAKTKRVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQKKWHQKS----------EGDNGDSQRSS 301          
BLAST of LIM/homeobox protein vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 147.132 bits (370), Expect = 2.235e-41
Identity = 83/226 (36.73%), Postives = 123/226 (54.42%), Query Frame = 3
Query:  168 IKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFR--RYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF-EIAKTKEQELDQ--GNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTS 830
            IK D  I  C  C+  I D+  L +    +H  CL C+ C  PL +KC+ K    +CK  +FR    G +CA+CD  I A++ +R+A+N +YHL CF+C  C RQL+TGEE + L    L+C+  F E+ +       Q    KR RTT    QL  L+  ++  S P     E++++ TGL  RV QVWFQN RA++K+  + +          +G+NG S+ +S
Sbjct:   89 IKPDAVIVICTQCQHQIQDKFFLSIDGRNYHENCLQCSTCENPLSNKCFYKDKTFYCKGCYFRCRELGPKCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEE-YALQEGNLLCKQHFLELVEGDSGVSSQKAKTKRVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQKKWHQKS----------EGDNGDSQRSS 303          
BLAST of LIM/homeobox protein vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 144.821 bits (364), Expect = 2.463e-40
Identity = 83/235 (35.32%), Postives = 124/235 (52.77%), Query Frame = 3
Query:  168 IKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRY-----------GTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF-EIAKTKEQELDQ--GNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTS 830
            IK D  I  C  C+  I D+  L +    +H  CL C+ C  PL +KC+ K    +CK  +FR +           G +CA+CD  I A++ +R+A+N +YHL CF+C  C RQL+TGEE + L    L+C+  F E+ +       Q    KR RTT    QL  L+  ++  S P     E++++ TGL  RV QVWFQN RA++K+  + +          +G+NG S+ +S
Sbjct:   89 IKPDAVIVICTQCQHQIQDKFFLSIDGRNYHENCLQCSTCENPLSNKCFYKDKTFYCKGCYFRTHVTSTASSCRELGPKCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEE-YALQEGNLLCKQHFLELVEGDSGVSSQKAKTKRVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQKKWHQKS----------EGDNGDSQRSS 312          
BLAST of LIM/homeobox protein vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0309834)

HSP 1 Score: 277.715 bits (709), Expect = 5.559e-91
Identity = 137/233 (58.80%), Postives = 168/233 (72.10%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQEL------DQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKG-DSDELSDD 863
            I  C  C   ILDR +LKV   TWH +CL C++C   L DKC++++ ++FCKEDFF+RYGT+C+ACD  IP ++V+R+AQ+N+YHL+CF C  C R LNTG+EF+L+  RKL+C+ D+E AK K   L      DQ NKRPRTTITAKQLE LK  Y+ S KPARHVREQLS  TGLDMRVVQVWFQNRRAKEKR+KKDAGR  WS  YF+   G     ++K  D DEL  D
Sbjct:    4 IPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKRYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEEAKAKGLYLDGSLDGDQPNKRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQ-YFRSMKGNCSPRTDKFLDKDELKVD 235          
BLAST of LIM/homeobox protein vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0081170)

HSP 1 Score: 277.715 bits (709), Expect = 1.424e-90
Identity = 137/233 (58.80%), Postives = 168/233 (72.10%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQEL------DQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKG-DSDELSDD 863
            I  C  C   ILDR +LKV   TWH +CL C++C   L DKC++++ ++FCKEDFF+RYGT+C+ACD  IP ++V+R+AQ+N+YHL+CF C  C R LNTG+EF+L+  RKL+C+ D+E AK K   L      DQ NKRPRTTITAKQLE LK  Y+ S KPARHVREQLS  TGLDMRVVQVWFQNRRAKEKR+KKDAGR  WS  YF+   G     ++K  D DEL  D
Sbjct:   39 IPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKRYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEEAKAKGLYLDGSLDGDQPNKRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQ-YFRSMKGNCSPRTDKFLDKDELKVD 270          
BLAST of LIM/homeobox protein vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0081169)

HSP 1 Score: 278.485 bits (711), Expect = 5.903e-90
Identity = 137/233 (58.80%), Postives = 168/233 (72.10%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQEL------DQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNK-GDSDELSDD 863
            I  C  C   ILDR +LKV   TWH +CL C++C   L DKC++++ ++FCKEDFF+RYGT+C+ACD  IP ++V+R+AQ+N+YHL+CF C  C R LNTG+EF+L+  RKL+C+ D+E AK K   L      DQ NKRPRTTITAKQLE LK  Y+ S KPARHVREQLS  TGLDMRVVQVWFQNRRAKEKR+KKDAGR  WS  YF+   G     ++K  D DEL  D
Sbjct:  119 IPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKRYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEEAKAKGLYLDGSLDGDQPNKRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQ-YFRSMKGNCSPRTDKFLDKDELKVD 350          
BLAST of LIM/homeobox protein vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0309832)

HSP 1 Score: 278.485 bits (711), Expect = 5.903e-90
Identity = 137/233 (58.80%), Postives = 168/233 (72.10%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQEL------DQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNK-GDSDELSDD 863
            I  C  C   ILDR +LKV   TWH +CL C++C   L DKC++++ ++FCKEDFF+RYGT+C+ACD  IP ++V+R+AQ+N+YHL+CF C  C R LNTG+EF+L+  RKL+C+ D+E AK K   L      DQ NKRPRTTITAKQLE LK  Y+ S KPARHVREQLS  TGLDMRVVQVWFQNRRAKEKR+KKDAGR  WS  YF+   G     ++K  D DEL  D
Sbjct:  119 IPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKRYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEEAKAKGLYLDGSLDGDQPNKRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQ-YFRSMKGNCSPRTDKFLDKDELKVD 350          
BLAST of LIM/homeobox protein vs. Ensembl Fly
Match: Lim3 (gene:FBgn0002023 transcript:FBtr0309833)

HSP 1 Score: 278.485 bits (711), Expect = 5.903e-90
Identity = 137/233 (58.80%), Postives = 168/233 (72.10%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQEL------DQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNK-GDSDELSDD 863
            I  C  C   ILDR +LKV   TWH +CL C++C   L DKC++++ ++FCKEDFF+RYGT+C+ACD  IP ++V+R+AQ+N+YHL+CF C  C R LNTG+EF+L+  RKL+C+ D+E AK K   L      DQ NKRPRTTITAKQLE LK  Y+ S KPARHVREQLS  TGLDMRVVQVWFQNRRAKEKR+KKDAGR  WS  YF+   G     ++K  D DEL  D
Sbjct:  119 IPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKRYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICKRDYEEAKAKGLYLDGSLDGDQPNKRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQ-YFRSMKGNCSPRTDKFLDKDELKVD 350          
BLAST of LIM/homeobox protein vs. Ensembl Zebrafish
Match: lhx4 (LIM homeobox 4 [Source:ZFIN;Acc:ZDB-GENE-060728-1])

HSP 1 Score: 266.929 bits (681), Expect = 5.876e-87
Identity = 128/231 (55.41%), Postives = 165/231 (71.43%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQ-GENGGSKVTSNKGDSDE--LSDDQ 866
            +I  C  C   ILD+ +LKV    WH +CL C DC   L DKC+S++  ++CKEDFF+R+GT+CA+C + IP ++V+RKAQ+ +YHL CFAC+ C RQL TG+EF+L+   +L+C+ D+E AK  + + + G KRPRTTITAKQLE LK  Y  S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   Y     N GS  T  +  +D+  LSD +
Sbjct:   29 QIPQCAGCSQHILDKFILKVLDRHWHSKCLKCADCHALLADKCFSRAGNVYCKEDFFKRFGTKCASCQQGIPPTQVVRKAQDFVYHLHCFACVMCSRQLATGDEFYLMEDGRLVCKEDYETAKQND-DSETGAKRPRTTITAKQLETLKSAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRNRGSSKTEKESSADDAGLSDSE 258          
BLAST of LIM/homeobox protein vs. Ensembl Zebrafish
Match: LHX3 (LIM homeobox 3 [Source:HGNC Symbol;Acc:HGNC:6595])

HSP 1 Score: 234.187 bits (596), Expect = 4.389e-74
Identity = 106/197 (53.81%), Postives = 139/197 (70.56%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGR 773
            +I  C  C   I+DR +LKV    WH +CL C+DC   L DKC+S+ D ++CK+DFF+R+GT+CAAC + IP ++V+R+AQ+ +YHL CFACI C RQL TG+E++L+   +L+C+ D+E A  K++E D   KRPRTTITAKQLE LK  Y+ S KPARHVREQLS +TGLDMRVVQ W    RA     + D  R
Sbjct:   24 DIPVCAGCNQHIVDRFILKVLDRHWHSKCLKCSDCQSQLADKCFSRGDSVYCKDDFFKRFGTKCAACQQGIPPTQVVRRAQDFVYHLHCFACIVCKRQLATGDEYYLMEDSRLVCKADYETA--KQREADSTAKRPRTTITAKQLETLKNAYNNSPKPARHVREQLSTETGLDMRVVQYWVAAGRASAVLYQPDLTR 218          
BLAST of LIM/homeobox protein vs. Ensembl Zebrafish
Match: LHX3 (LIM homeobox 3 [Source:HGNC Symbol;Acc:HGNC:6595])

HSP 1 Score: 232.261 bits (591), Expect = 3.149e-73
Identity = 104/186 (55.91%), Postives = 138/186 (74.19%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRA 740
            +I  C  C   I+DR +LKV    WH +CL C+DC   L DKC+S+ D ++CK+DFF+R+GT+CAAC + IP ++V+R+AQ+ +YHL CFACI C RQL TG+E++L+   +L+C+ D+E A  K++E D   KRPRTTITAKQLE LK  Y+ S KPARHVREQLS +TGLDMRVVQV +  RR+
Sbjct:   24 DIPVCAGCNQHIVDRFILKVLDRHWHSKCLKCSDCQSQLADKCFSRGDSVYCKDDFFKRFGTKCAACQQGIPPTQVVRRAQDFVYHLHCFACIVCKRQLATGDEYYLMEDSRLVCKADYETA--KQREADSTAKRPRTTITAKQLETLKNAYNNSPKPARHVREQLSTETGLDMRVVQVRYTARRS 207          
BLAST of LIM/homeobox protein vs. Ensembl Zebrafish
Match: lhx1b (LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-116])

HSP 1 Score: 207.994 bits (528), Expect = 7.350e-64
Identity = 99/251 (39.44%), Postives = 143/251 (56.97%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF--------------------------------------------EIAKTKEQELDQGNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQ 800
            + +C  C+ PILDR +L V    WH +C+ C DC   L D+C+S+   ++CK DFFRRYGT+C  C + I  S+++RKA++ ++HL CF CI C++QL+TGEE ++L   K +C+ D+                                            E    +  E + G KR  PRTTI AKQLE LK  ++ + KP RH+REQL+ +TGL+MRV+QVWFQNRR+KE+RMK+ +  G     +F+
Sbjct:    1 MVHCAGCERPILDRFLLSVLDRAWHAKCVQCCDCKCSLTDRCFSREGRLYCKNDFFRRYGTKCGGCAQGISPSDLVRKARSKVFHLNCFTCIMCNKQLSTGEELYILDEYKFVCKEDYLNNSNGKDTNLLSITTCSDPSLSPESQDPQDDYKDSESGPMSDKETCNNENDEQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHMFFR 251          
BLAST of LIM/homeobox protein vs. Ensembl Zebrafish
Match: lhx1b (LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-116])

HSP 1 Score: 207.994 bits (528), Expect = 7.350e-64
Identity = 99/251 (39.44%), Postives = 143/251 (56.97%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF--------------------------------------------EIAKTKEQELDQGNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQ 800
            + +C  C+ PILDR +L V    WH +C+ C DC   L D+C+S+   ++CK DFFRRYGT+C  C + I  S+++RKA++ ++HL CF CI C++QL+TGEE ++L   K +C+ D+                                            E    +  E + G KR  PRTTI AKQLE LK  ++ + KP RH+REQL+ +TGL+MRV+QVWFQNRR+KE+RMK+ +  G     +F+
Sbjct:    1 MVHCAGCERPILDRFLLSVLDRAWHAKCVQCCDCKCSLTDRCFSREGRLYCKNDFFRRYGTKCGGCAQGISPSDLVRKARSKVFHLNCFTCIMCNKQLSTGEELYILDEYKFVCKEDYLNNSNGKDTNLLSITTCSDPSLSPESQDPQDDYKDSESGPMSDKETCNNENDEQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHMFFR 251          
BLAST of LIM/homeobox protein vs. Ensembl Xenopus
Match: clpb (ClpB homolog, mitochondrial AAA ATPase chaperonin [Source:Xenbase;Acc:XB-GENE-994913])

HSP 1 Score: 254.988 bits (650), Expect = 2.934e-82
Identity = 125/233 (53.65%), Postives = 163/233 (69.96%), Query Frame = 3
Query:  180 NEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQ------GENGGSKVTSNKGDSD-ELS 857
             +I  C  C   ILD+ +LKV    WH  CL C +C +PL ++C+ ++  ++CKEDFF+ +GT+C AC + IP ++V+RKAQ+ +YHL CF+CI C RQL TG+EF+L+   +L+C+ D+E AK  + + + G KRPRTTITAKQLE LK  Y  S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   Y        G++G    T + G SD ELS
Sbjct:   25 QQIPRCSGCNEHILDKFILKVLDRHWHSACLKCCECQVPLAERCFYRAGNVYCKEDFFKCFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFSCIICSRQLATGDEFYLMEDGRLVCKEDYETAKQND-DSEGGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQFYKSVRKSRLGKSGKESSTEDCGVSDSELS 256          
BLAST of LIM/homeobox protein vs. Ensembl Xenopus
Match: clpb (ClpB homolog, mitochondrial AAA ATPase chaperonin [Source:Xenbase;Acc:XB-GENE-994913])

HSP 1 Score: 256.144 bits (653), Expect = 6.946e-81
Identity = 126/232 (54.31%), Postives = 162/232 (69.83%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQ------GENGGSKVTSNKGDSD-ELS 857
            EI  C  C   ILD+ +LKV    WH  CL C +C +PL ++C+ ++  ++CKEDFF+ +GT+C AC + IP ++V+RKAQ+ +YHL CF+CI C RQL TG+EF+L+   +L+C+ D+E AK  +   + G KRPRTTITAKQLE LK  Y  S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   Y        G++G    T + G SD ELS
Sbjct:  186 EIPRCSGCNEHILDKFILKVLDRHWHSACLKCCECQVPLAERCFYRAGNVYCKEDFFKCFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFSCIICSRQLATGDEFYLMEDGRLVCKEDYETAKQNDDS-EGGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQFYKSVRKSRLGKSGKESSTEDCGVSDSELS 416          
BLAST of LIM/homeobox protein vs. Ensembl Xenopus
Match: klf2 (Kruppel-like factor 2 [Source:Xenbase;Acc:XB-GENE-485035])

HSP 1 Score: 210.69 bits (535), Expect = 1.129e-64
Identity = 103/269 (38.29%), Postives = 152/269 (56.51%), Query Frame = 3
Query:  192 YCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF---------------------------------------------EIAKTKEQELDQGNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELS 857
            +C  C+ PILDR +L V    WHV+C+ C +C   L +KC+S+  +++CK DFFRR+GT+CA C   I  S+++RKA+N ++HL CF C+ C++QL+TGEE +++   K +C+ D+                                             E A  + +E + G KR  PRTTI AKQLE LK  ++ + KP RH+REQL+ +TGL+MRV+QVWFQNRR+KE+RMK+ +  G     +F+       +     +SD LS
Sbjct:    4 HCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKTDFFRRFGTKCAGCSLGISPSDLVRKARNKVFHLNCFTCMVCNKQLSTGEELYIIDENKFVCKEDYASASSLKESSLNSVSSCTDRSLSPDLQDPIQDESKETDHSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESDILS 272          
BLAST of LIM/homeobox protein vs. Ensembl Xenopus
Match: gfm2 (G elongation factor, mitochondrial 2 [Source:Xenbase;Acc:XB-GENE-1002407])

HSP 1 Score: 201.445 bits (511), Expect = 4.069e-61
Identity = 93/256 (36.33%), Postives = 145/256 (56.64%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF---------------------------------------------------EIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQ 800
            + +C  C+ PILDR +L V    WHV+C+ C +C   L +KC+S+  +++CK DFFRR+GT+CA C + I  S+++R+A++ ++HL CF C+ C++QL+TGEE +++   K +C+ D+                                                    + +  +Q L    + PRTTI AKQLE LK  ++ + KP RH+REQL+ +TGL+MRV+QVWFQNRR+KE+RMK+ +  G     +F+
Sbjct:    1 MVHCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLNNNNNNNNAAKENSFISVTGSDPSLSPESQDPLQDDAKDSESANISDKEAGVNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFR 256          
BLAST of LIM/homeobox protein vs. Ensembl Xenopus
Match: gfm2 (G elongation factor, mitochondrial 2 [Source:Xenbase;Acc:XB-GENE-1002407])

HSP 1 Score: 196.438 bits (498), Expect = 2.995e-59
Identity = 99/249 (39.76%), Postives = 148/249 (59.44%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLM-CR---------------------------------PDFEIAKTKEQEL------DQ--GNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQ 800
            + +C  C+ PILDR +L V    WHV+C+ C +C   L +KC+S+  +++CK DFFRR+GT+CA C + I  S+++R+A++ ++HL CF C+ C++QL+TGEE +++   K + C+                                  D E A   ++E       DQ  G KR  PRTTI AKQLE LK  ++ + KP RH+REQL+ +TGL+MRV+QVWFQNRR+KE+RMK+ +  G     +F+
Sbjct:    1 MVHCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVYCKLFWAGPSSPLVSVIDCSDPSLSPESQDPLQDDAKDSESANISDKEAGVNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFR 249          
BLAST of LIM/homeobox protein vs. Ensembl Mouse
Match: Lhx3 (LIM homeobox protein 3 [Source:MGI Symbol;Acc:MGI:102673])

HSP 1 Score: 271.166 bits (692), Expect = 2.099e-88
Identity = 131/257 (50.97%), Postives = 179/257 (69.65%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISY-----QSDVESDSEIFSCYG 938
            EI  C  C   ILDR +LK     WH +CL C+DC +PL ++C+S+ + ++CK+DFF+R+GT+CAAC   IP ++V+R+AQ+ +YHL CFAC+ C RQL TG+EF+L+   +L+C+ D+E AK +E E     KRPRTTITAKQLE LK  Y+ S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   YF+  N      S+K D D + + Q ++  ++S+      +D+   + ++S  G
Sbjct:   32 EIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATA--KRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQ-YFR--NMKRSRGSSKSDKDSIQEGQDSD-AEVSFTDEPSMADMGPANGLYSSLG 282          
BLAST of LIM/homeobox protein vs. Ensembl Mouse
Match: Lhx3 (LIM homeobox protein 3 [Source:MGI Symbol;Acc:MGI:102673])

HSP 1 Score: 271.166 bits (692), Expect = 2.352e-88
Identity = 131/257 (50.97%), Postives = 179/257 (69.65%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISY-----QSDVESDSEIFSCYG 938
            EI  C  C   ILDR +LK     WH +CL C+DC +PL ++C+S+ + ++CK+DFF+R+GT+CAAC   IP ++V+R+AQ+ +YHL CFAC+ C RQL TG+EF+L+   +L+C+ D+E AK +E E     KRPRTTITAKQLE LK  Y+ S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   YF+  N      S+K D D + + Q ++  ++S+      +D+   + ++S  G
Sbjct:   30 EIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATA--KRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQ-YFR--NMKRSRGSSKSDKDSIQEGQDSD-AEVSFTDEPSMADMGPANGLYSSLG 280          
BLAST of LIM/homeobox protein vs. Ensembl Mouse
Match: Lhx4 (LIM homeobox protein 4 [Source:MGI Symbol;Acc:MGI:101776])

HSP 1 Score: 266.544 bits (680), Expect = 1.166e-86
Identity = 124/216 (57.41%), Postives = 158/216 (73.15%), Query Frame = 3
Query:  180 NEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPY--FQGENGGSK 821
             +I  C  C   ILD+ +LKV    WH  CL C DC + L D+C+S++  ++CKEDFF+R+GT+C AC + IP ++V+RKAQ+ +YHL CFACI C+RQL TG+EF+L+   +L+C+ D+E AK  + + + G KRPRTTITAKQLE LK  Y  S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   Y   +   GGSK
Sbjct:   25 QQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDYETAKQND-DSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGGSK 239          
BLAST of LIM/homeobox protein vs. Ensembl Mouse
Match: Lhx4 (LIM homeobox protein 4 [Source:MGI Symbol;Acc:MGI:101776])

HSP 1 Score: 231.491 bits (589), Expect = 2.566e-75
Identity = 113/216 (52.31%), Postives = 152/216 (70.37%), Query Frame = 3
Query:  291 IPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPY--FQGENGGSKVTSNKGDSD-ELSDDQTNEPCDISYQSDVESDSEIFS 929
            + L D+C+S++  ++CKEDFF+R+GT+C AC + IP ++V+RKAQ+ +YHL CFACI C+RQL TG+EF+L+   +L+C+ D+E AK  + + + G KRPRTTITAKQLE LK  Y  S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   Y   +   GGSK        D  +SD + +   +  ++ + E+  E   
Sbjct:    1 MQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDYETAKQND-DSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGGSKQEKESSAEDCGVSDSELSFRGEQGWRGEAEALGETLG 215          
BLAST of LIM/homeobox protein vs. Ensembl Mouse
Match: Lhx5 (LIM homeobox protein 5 [Source:MGI Symbol;Acc:MGI:107792])

HSP 1 Score: 207.608 bits (527), Expect = 1.082e-63
Identity = 97/252 (38.49%), Postives = 148/252 (58.73%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF---------------------------------------------EIAKTKEQELDQGNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQ 800
            + +C  C+ PILDR +L V    WH++C+ C +C   L +KC+S+  +++CK DFFRR+GT+CA C + I  S+++RKA++ ++HL CF C+ C++QL+TGEE +++   K +C+ D+                                             E A  + +E + G KR  PRTTI AKQLE LK  ++ + KP RH+REQL+ +TGL+MRV+QVWFQNRR+KE+RMK+ +  G     +F+
Sbjct:    2 MVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLSSSSLKEGSLNSVSSCTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFR 253          
BLAST of LIM/homeobox protein vs. UniProt/SwissProt
Match: sp|P53412|LHX3_CHICK (LIM/homeobox protein Lhx3 OS=Gallus gallus OX=9031 GN=LHX3 PE=2 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 6.403e-89
Identity = 134/252 (53.17%), Postives = 177/252 (70.24%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISYQSDVESDSEIFSCYG 938
            EI  C  C   I+DR +LKV    WH +CL C+DC   L +KC+S+ D ++CKEDFF+R+GT+CAAC + IP ++V+R+AQ+ +YHL CFACI C RQL TG+EF+L+   +L+C+ D+E AK +E E     KRPRTTITAKQLE LK  Y+ S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   YF+  N      ++K D D + ++  +   ++S+ +D  S SE+    G
Sbjct:   24 EIPLCAGCNQHIVDRFILKVLDRHWHSKCLKCSDCQTQLAEKCFSRGDGVYCKEDFFKRFGTKCAACQQGIPPTQVVRRAQDFVYHLHCFACIVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAE--STAKRPRTTITAKQLETLKNAYNNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQ-YFR--NMKRSRGTSKSDKDSIQEEGPDSDAEVSF-TDEPSMSEMSHSNG 269          
BLAST of LIM/homeobox protein vs. UniProt/SwissProt
Match: sp|P36200|LHX3_XENLA (LIM/homeobox protein Lhx3 OS=Xenopus laevis OX=8355 GN=lhx3 PE=1 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 8.862e-89
Identity = 134/253 (52.96%), Postives = 176/253 (69.57%), Query Frame = 3
Query:  165 GIKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISYQSDVESDSEI 923
            G     EI  C  C   I+DR +LKV    WH +CL C DC I L +KC+S+ D ++CK+DFF+R+GT+CAAC + IP ++V+R+AQ  +YHL CFACI C RQL TG+EF+L+   +L+C+ D+E AK +E E     KRPRTTITAKQLE LK  Y+ S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   YF+  N      ++K D D + ++  +   ++S+ +D  S SE+
Sbjct:   18 GYTGSPEIPQCAGCNQHIVDRFILKVLDRHWHSKCLKCNDCQIQLAEKCFSRGDSVYCKDDFFKRFGTKCAACQQGIPPTQVVRRAQEFVYHLHCFACIVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAE--STAKRPRTTITAKQLETLKNAYNNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQ-YFR--NMKRSRGNSKSDKDSIQEEGPDSDAEVSF-TDEPSMSEM 264          
BLAST of LIM/homeobox protein vs. UniProt/SwissProt
Match: sp|Q90421|LHX3_DANRE (LIM/homeobox protein Lhx3 OS=Danio rerio OX=7955 GN=lhx3 PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 3.122e-88
Identity = 132/255 (51.76%), Postives = 176/255 (69.02%), Query Frame = 3
Query:  180 NEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISY-----QSDVESDSEIFS 929
             +I  C  C   I+DR +LKV    WH +CL C+DC   L DKC+S+ D ++CK+DFF+R+GT+CAAC + IP ++V+R+AQ+ +YHL CFACI C RQL TG+E++L+   +L+C+ D+E A  K++E D   KRPRTTITAKQLE LK  Y+ S KPARHVREQLS +TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   YF+  N      ++K D D   +D  +   ++S+      SD+   + I+S
Sbjct:   23 QDIPVCAGCNQHIVDRFILKVLDRHWHSKCLKCSDCQSQLADKCFSRGDSVYCKDDFFKRFGTKCAACQQGIPPTQVVRRAQDFVYHLHCFACIVCKRQLATGDEYYLMEDSRLVCKADYETA--KQREADSTAKRPRTTITAKQLETLKNAYNNSPKPARHVREQLSTETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQ-YFR--NMKRSRGTSKSDKDSTQEDGMDSDAEVSFTDEPPMSDLGHSNGIYS 272          
BLAST of LIM/homeobox protein vs. UniProt/SwissProt
Match: sp|P50481|LHX3_MOUSE (LIM/homeobox protein Lhx3 OS=Mus musculus OX=10090 GN=Lhx3 PE=1 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 1.645e-87
Identity = 131/257 (50.97%), Postives = 179/257 (69.65%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISY-----QSDVESDSEIFSCYG 938
            EI  C  C   ILDR +LK     WH +CL C+DC +PL ++C+S+ + ++CK+DFF+R+GT+CAAC   IP ++V+R+AQ+ +YHL CFAC+ C RQL TG+EF+L+   +L+C+ D+E AK +E E     KRPRTTITAKQLE LK  Y+ S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   YF+  N      S+K D D + + Q ++  ++S+      +D+   + ++S  G
Sbjct:   30 EIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATA--KRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQ-YFR--NMKRSRGSSKSDKDSIQEGQDSD-AEVSFTDEPSMADMGPANGLYSSLG 280          
BLAST of LIM/homeobox protein vs. UniProt/SwissProt
Match: sp|O97581|LHX3_PIG (LIM/homeobox protein Lhx3 (Fragment) OS=Sus scrofa OX=9823 GN=LHX3 PE=2 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 3.295e-87
Identity = 130/253 (51.38%), Postives = 175/253 (69.17%), Query Frame = 3
Query:  180 NEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISYQSDVESDSEIFSCYG 938
             EI  C  C   ILDR +LK     WH +CL C+DC  PL ++C+S+ + ++CK+DFF+R+GT+CAAC   IP ++V+R+AQ+ +YHL CFAC+ C RQL TG+EF+L+   +L+C+ D+E AK +E E     KRPRTTITAKQLE LK  Y+ S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   YF+  N       +K D D + ++  +   ++S+ +D  S +E+    G
Sbjct:   11 KEIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFSRGESLYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEAT--AKRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQ-YFR--NMKRARGGSKSDKDSVQEEGQDSDAEVSF-TDEPSMAEMGPANG 257          
BLAST of LIM/homeobox protein vs. TrEMBL
Match: A0A1S3H8A2 (LIM/homeobox protein Lhx3 OS=Lingula unguis OX=7574 GN=LOC106153011 PE=4 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 6.398e-103
Identity = 155/265 (58.49%), Postives = 201/265 (75.85%), Query Frame = 3
Query:  129 QTNNSLSNTKDSGIKF-DNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSD-ELSDDQT--NEPCDISYQSDVES 911
             T+ +L+     G +F +  I  C  C  PILDR +LKV   +WH +CL C DC   L DKC+SK D+++CK+DFFRR+GT+CAACD+ IP ++V+R+AQ+ +YHLECF+C+ C++QLNTG+EF+LL  RKL+C+ D+E AK++E E+D  NKRPRTTITAKQLEALK+ Y+ES KPARHVREQLSA+TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W +PYF+      K   + G+SD  LS D T  +   DISYQ+D++S
Sbjct:    4 HTDLALTEILGRGSRFLEAAIPKCAGCSDPILDRFILKVLERSWHAKCLKCADCKTQLNDKCFSKGDKVYCKDDFFRRFGTKCAACDKGIPPTQVVRRAQDYVYHLECFSCLICNQQLNTGDEFYLLDDRKLVCKADYETAKSREFEIDSSNKRPRTTITAKQLEALKRAYNESPKPARHVREQLSAETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRW-NPYFR----QMKQRHHAGESDGALSADDTLSDGAVDISYQNDIDS 263          
BLAST of LIM/homeobox protein vs. TrEMBL
Match: A0A210R176 (LIM/homeobox protein Lhx3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04362 PE=4 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 3.057e-101
Identity = 143/230 (62.17%), Postives = 180/230 (78.26%), Query Frame = 3
Query:  174 FDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDD 863
             +  I  C  C  PILDR +LKV   +WH +CL C+DC   L DKC+SK ++++CK+DFFRR+GT+CA C++ IP +EV+R+AQ+N+YHLECFAC+ C RQLNTG+EF+L+  RKL+C+PD+E AK +E +LD  NKRPRTTITAKQLEALK  Y+ES KPARHVREQLSA+TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W SPYF+         S++  +D +SDD
Sbjct:   37 LEAAIPKCAGCGEPILDRFILKVLDRSWHSKCLQCSDCHSQLSDKCFSKGEKVYCKDDFFRRFGTKCAGCEKGIPPTEVVRRAQDNVYHLECFACLMCSRQLNTGDEFYLMEDRKLVCKPDYEAAKAREIDLDAANKRPRTTITAKQLEALKTAYNESPKPARHVREQLSAETGLDMRVVQVWFQNRRAKEKRLKKDAGRNRW-SPYFRQLKRSGDADSSQS-ADNMSDD 264          
BLAST of LIM/homeobox protein vs. TrEMBL
Match: A0A0L8I3P3 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22036419mg PE=4 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 6.280e-101
Identity = 151/242 (62.40%), Postives = 187/242 (77.27%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYF-QGENGGSKVTSNKGDSDELSDDQTNEPCDISYQSDVE 908
            I  C  C   ILDR +LKV   +WH +CL CTDC   L DKC+SK+DE+FCK+DFFRRYGT+CA CD+ IP ++V+R+AQ+ +YHLECFAC+ C+RQLNTG+EF+L+  RKL+C+ D+E AK +E +LD GNKRPRTTITAKQLEALK+ Y+ES KPARHVREQLS +TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W SPYF Q +  G   +S    +D+ SDD   E    SY +D++
Sbjct:    2 IPKCAGCSEQILDRFILKVLDRSWHSKCLKCTDCRAQLTDKCFSKNDEVFCKDDFFRRYGTKCAGCDKGIPPTQVVRRAQDYVYHLECFACLMCNRQLNTGDEFYLMEDRKLVCKGDYEAAKAREYDLDGGNKRPRTTITAKQLEALKRAYNESPKPARHVREQLSVETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRW-SPYFRQMKRNGDPDSSLS--ADDRSDDGLTE---GSYANDID 237          
BLAST of LIM/homeobox protein vs. TrEMBL
Match: A0A2C9KAY3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106066660 PE=4 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 9.094e-98
Identity = 141/228 (61.84%), Postives = 178/228 (78.07%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQT 869
            I  C  C   I DR +LKV   +WH +CL CTDC   L DKC+SK D+++CK+DFF+R+GT+CA+CD+ IP +EV+R+AQ N+YHL+CFAC+ C RQLNTG+EF+L+  RKL+C+ D+E AK +E E+D  NKRPRTTITAKQLEALK+ Y+ES+KPARHVREQLSA+TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W+  Y Q +  G   +S    +DE SDD +
Sbjct:    2 IPKCAGCGDHIYDRFILKVLDRSWHSKCLKCTDCMAQLSDKCFSKGDKVYCKDDFFKRFGTKCASCDKGIPPTEVVRRAQENVYHLDCFACLMCARQLNTGDEFYLMEDRKLVCKTDYEAAKAREYEMDSSNKRPRTTITAKQLEALKRAYNESNKPARHVREQLSAETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWNPYYRQMKREGEHDSSLS--ADERSDDGS 227          
BLAST of LIM/homeobox protein vs. TrEMBL
Match: A0A5N4AJ85 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_08406 PE=4 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 6.015e-97
Identity = 144/230 (62.61%), Postives = 174/230 (75.65%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQEL---DQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNK-GDSDELSDD 863
            I  C  C   ILDR +LKV   TWH +CL CTDC I L DKC++++ ++FCKEDFF+R+GT+CA CD  IP ++V+R+AQ+N+YHL+CFACI C RQLNTG+EF+L+  RKL+C+PD+E AK+K  E    DQ NKRPRTTITAKQLE LK  Y+ S KPARHVREQLS  TGLDMRVVQVWFQNRRAKEKR+KKDAGR  WS  YF+   GGS    +K  D DE+  D
Sbjct:   35 IPKCGGCHEMILDRFILKVADRTWHAKCLQCTDCRIQLTDKCFARNGQLFCKEDFFKRFGTKCAGCDLGIPPTQVVRRAQDNVYHLQCFACIMCARQLNTGDEFYLMEDRKLVCKPDYEAAKSKAAECLDGDQPNKRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQ-YFRSMKGGSSPRHDKLLDKDEMKVD 263          
BLAST of LIM/homeobox protein vs. Ensembl Cavefish
Match: LHX3 (LIM homeobox 3 [Source:NCBI gene;Acc:103029891])

HSP 1 Score: 275.018 bits (702), Expect = 4.465e-90
Identity = 132/255 (51.76%), Postives = 179/255 (70.20%), Query Frame = 3
Query:  180 NEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISY-----QSDVESDSEIFS 929
             +I  C  C  PI+DR +LKV    WH +CL C+DC   L +KC+++ D ++CKEDFF+R+GT+CAAC + IP ++V+R+AQ+ +YHL CFACI C RQL TG+E++L+   +L+C+ D+E A  K++E D   KRPRTTITAKQLE LK  Y+ S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   YF+  N      S+K D D + ++  +   ++S+      SD+   + I+S
Sbjct:   23 QDIPVCAGCSQPIVDRFILKVLDRHWHSKCLKCSDCQSQLSEKCFTRGDSVYCKEDFFKRFGTKCAACQQGIPPTQVVRRAQDFVYHLHCFACIVCKRQLATGDEYYLMEDSRLVCKADYETA--KQREADSTAKRPRTTITAKQLETLKNAYNNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQ-YFR--NMKRSRGSSKSDKDSIQEEGMDSDAEVSFTDEPPMSDLGHSNGIYS 272          
BLAST of LIM/homeobox protein vs. Ensembl Cavefish
Match: lhx4 (LIM homeobox 4 [Source:NCBI gene;Acc:103029973])

HSP 1 Score: 263.462 bits (672), Expect = 5.065e-86
Identity = 118/204 (57.84%), Postives = 154/204 (75.49%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPY 794
            ++  C  C   ILD+ +LKV    WH +CL C+DC   L D+C+S++  ++CKEDFF+R+GT+CA+C + IP S+V+RKAQ+ +YHL CF+C+ C RQL TG+EF+L+   +L+C+ D+E AK  + + + G KRPRTTITAKQLE LK  Y  S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   Y
Sbjct:    2 KLPECAGCSQTILDKFILKVLDRHWHAQCLKCSDCHTLLADRCFSRAGSVYCKEDFFKRFGTKCASCQQGIPPSQVVRKAQDFVYHLHCFSCVMCSRQLATGDEFYLMEDGRLVCKSDYETAKQND-DSETGAKRPRTTITAKQLETLKSAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFY 204          
BLAST of LIM/homeobox protein vs. Ensembl Cavefish
Match: lhx4 (LIM homeobox 4 [Source:NCBI gene;Acc:103029973])

HSP 1 Score: 266.159 bits (679), Expect = 6.819e-86
Identity = 118/205 (57.56%), Postives = 155/205 (75.61%), Query Frame = 3
Query:  180 NEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPY 794
            +++  C  C   ILD+ +LKV    WH +CL C+DC   L D+C+S++  ++CKEDFF+R+GT+CA+C + IP S+V+RKAQ+ +YHL CF+C+ C RQL TG+EF+L+   +L+C+ D+E AK  + + + G KRPRTTITAKQLE LK  Y  S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W   Y
Sbjct:   93 HQLPECAGCSQTILDKFILKVLDRHWHAQCLKCSDCHTLLADRCFSRAGSVYCKEDFFKRFGTKCASCQQGIPPSQVVRKAQDFVYHLHCFSCVMCSRQLATGDEFYLMEDGRLVCKSDYETAKQND-DSETGAKRPRTTITAKQLETLKSAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFY 296          
BLAST of LIM/homeobox protein vs. Ensembl Cavefish
Match: lhx1b (LIM/homeobox protein Lhx1-like [Source:NCBI gene;Acc:103026395])

HSP 1 Score: 209.92 bits (533), Expect = 1.234e-64
Identity = 98/242 (40.50%), Postives = 140/242 (57.85%), Query Frame = 3
Query:  195 CIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF----------------------------------------------EIAKTKEQELDQGNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRG 776
            C  C+ PILDR +L V    WH +C+ C DC   L +KC+S+   ++C+ DFFRR+GT+CA C +VI  ++++R+A+N ++HL CF CI C++QL+TGEE ++L   K +C+ D+                                              E   T+  E   G KR  PRTTI AKQLE LK  ++ + KP RH+REQL+ +TGL+MRV+QVWFQNRR+KE+RMK+ +  G
Sbjct:    4 CAGCERPILDRFLLNVLDRAWHTKCVQCCDCKCNLTEKCFSREGRLYCRTDFFRRFGTKCAGCSQVISPTDLVRRARNKVFHLNCFTCIMCNKQLSTGEELYILEESKFLCKEDYFSNNSPLKDSTQLSAVTACSEPSLSPDPQDVHEDGKDSEAGQLSDKETGSTENDEQTSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALG 245          
BLAST of LIM/homeobox protein vs. Ensembl Cavefish
Match: lhx1a (LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:103025442])

HSP 1 Score: 203.371 bits (516), Expect = 4.600e-62
Identity = 98/252 (38.89%), Postives = 150/252 (59.52%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF-------------------------------------EIAKTKEQEL------DQ--GNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQ 800
            + +C  C+ PILDR +L V    WH++C+ C +C   L +KC+S+  +++CK DFFRR+GT+CA C + I  ++++R+A++ ++HL CF C+ C++QL+TGEE +++   K +C+ D+                                     EIA   ++E       DQ  G KR  PRTTI AKQLE LK  ++ + KP RH+REQL+ +TGL+MRV+QVWFQNRR+KE+RMK+ +  G     +F+
Sbjct:    1 MVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPNDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKDDYLSNSNGKDTNLLSVTACSDPSLSPDSQDPLQDDVKDSEIAALSDKEAPSNEADDQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFR 252          
BLAST of LIM/homeobox protein vs. Ensembl Sea Lamprey
Match: lmo4b (LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-030131-3570])

HSP 1 Score: 93.5893 bits (231), Expect = 1.885e-23
Identity = 48/119 (40.34%), Postives = 67/119 (56.30%), Query Frame = 3
Query:  195 CIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLID---KCYSKSDEIFCKEDFFRRYGTR--CAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPD 536
            C  C G I DR +L      WH RCL C+ C   L D    CY++   I C++D+ R +G+   C AC + IPASE++ K Q N+YHL+CFAC +C  +L  G+ F  ++   L C  D
Sbjct:   18 CAGCGGKIADRFLLYSMDCYWHSRCLKCSCCQAQLGDLGTSCYTRQGMILCRDDYIRMFGSSGACNACGQSIPASELVMKTQGNVYHLKCFACATCRTRLVPGDRFHYVNG-SLFCEHD 135          
BLAST of LIM/homeobox protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009847.1 (pep scaffold:Pmarinus_7.0:GL481168:3356:14379:1 gene:ENSPMAG00000008904.1 transcript:ENSPMAT00000009847.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 1.815e-22
Identity = 39/58 (67.24%), Postives = 51/58 (87.93%), Query Frame = 3
Query:  588 PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKK 761
            PRTTI AKQLE L+  ++ + KP+RHVREQL+ +TGL+MRV+QVWFQNRR+KE+RMK+
Sbjct:   30 PRTTIKAKQLETLRAAFAATPKPSRHVREQLAQETGLNMRVIQVWFQNRRSKERRMKQ 87          
BLAST of LIM/homeobox protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002189.1 (pep scaffold:Pmarinus_7.0:GL483992:1961:4872:1 gene:ENSPMAG00000001979.1 transcript:ENSPMAT00000002189.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 6.839e-22
Identity = 52/174 (29.89%), Postives = 82/174 (47.13%), Query Frame = 3
Query:  354 RRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMC----------------------------------RPDFEIAKTKEQELDQG-------NKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKR 752
            R +G +CA C+     ++ + +A+++IYH+ECF C +C RQL  G+EF L     L+C                                  RP   +  ++   L  G         R RT +  KQL+ L+  Y+ + +P   ++EQL   TGL  RV++VWFQN+R K+K+
Sbjct:    1 RLFGIKCAKCNASFSKTDFVMRARSHIYHMECFRCETCSRQLLPGDEFALRDGGGLLCRADQHHGGGGGGGAGGAGGGAGGGGGGLLGTALTRPGSPVHSSRSLHLSGGIPSGPEKATRVRTVLNEKQLQTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKK 174          
BLAST of LIM/homeobox protein vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 78.5666 bits (192), Expect = 4.634e-18
Identity = 43/142 (30.28%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  129 QTNNSLSNTKDSGIKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLID---KCYSKSDEIFCKEDFFRRYGT--RCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF 539
            +T        D  ++    +  C  C+ PI DR +LK     WH  CL C  CG  L +   + Y K     C+ D+ R +G    CA+C + I A E+  + ++ +YHLECF C +C +    G+ + L++S  ++C  D 
Sbjct:    8 KTTEPAEEPVDEVLRMPPMMLMCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLVNS-DIICEQDI 148          
BLAST of LIM/homeobox protein vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 76.6406 bits (187), Expect = 2.458e-17
Identity = 43/144 (29.86%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  123 DYQTNNSLSNTKDSGIKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLID---KCYSKSDEIFCKEDFFRRYGT--RCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF 539
            D   + +     D  ++    +  C  C+ PI DR +LK     WH  CL C  CG  L +   + Y K     C+ D+ R +G    CA+C + I A E+  + ++ +YHLECF C +C +    G+ + L++S  ++C  D 
Sbjct:    5 DVGCDRAHREPVDEVLRMPPMMLMCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLVNS-DIICEQDI 147          
BLAST of LIM/homeobox protein vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 45.8246 bits (107), Expect = 6.107e-6
Identity = 23/74 (31.08%), Postives = 42/74 (56.76%), Query Frame = 3
Query:  570 DQGNKRP-RTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSS 788
            D G +RP RT    + L+ LK+ +  +  P+   R+++S   G+  + V++WFQNRRAK ++ +  + +    S
Sbjct:   73 DSGPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQHGSNKDTIPS 146          
BLAST of LIM/homeobox protein vs. Ensembl Nematostella
Match: LHX1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9E9])

HSP 1 Score: 201.06 bits (510), Expect = 4.221e-64
Identity = 87/212 (41.04%), Postives = 143/212 (67.45%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF----------------EIAKTKEQELDQG----NKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKK 761
            +  C  C+ PI D+ +LKV    WH +C+ C+DC  PL ++C+S+  ++FCK DF+RRYGT+C+ CD+ I  ++++R+A++ ++H++CF C  C RQ+ TG+E + +     +CR D+                +++   +++LD       + PRTTI AKQLEALK T++ + KP+R++RE+L+ +TGL+MRV+QVWFQNRR+KE+R+K+
Sbjct:    2 VQQCAGCQLPIADKFLLKVLDGVWHAQCVQCSDCKCPLTERCFSREGKLFCKTDFYRRYGTKCSGCDQGISPNDMVRRAKHLVFHVDCFVCSYCKRQITTGDELYYIGDGSFICRDDYYHSHPTNLDDAIDEPKDLSYGLDEDLDAALASKRRGPRTTIKAKQLEALKSTFAATPKPSRNIREKLAQETGLNMRVIQVWFQNRRSKERRLKQ 213          
BLAST of LIM/homeobox protein vs. Ensembl Nematostella
Match: EDO34370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK5])

HSP 1 Score: 146.747 bits (369), Expect = 7.485e-42
Identity = 87/237 (36.71%), Postives = 121/237 (51.05%), Query Frame = 3
Query:  195 CIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDK--CYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELD----------------------QGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSP-YFQGENGGSKVTS 830
            C+ C+  I+DR ++KV    WH +CL C  C   L  +  CY+K  +I+CK D+ R++GT+CA C   I A++ +R+A+N +YHL CFAC +C RQL+TGEEF L     L      E   T   E D                         KR RTT T  QL+ L+  ++  S P     E+++  TGL  RV QVWFQN RA++K+         + +P Y  G N  S V S
Sbjct:   28 CVGCEAKIVDRYLVKVSGRAWHTKCLKCCLCSDELGREATCYTKDGKIYCKADYARQFGTKCARCGRSIHANDWVRRAKNCVYHLACFACDNCKRQLSTGEEFALKDGHVLCKLHYLEALDTSPAERDYQEVFSPDVDGDDSPNSLKSGRHKAKRVRTTFTEDQLQILQANFNIDSNPDGQDLERIAQLTGLSKRVTQVWFQNSRARQKK---------YGTPLYSPGLNSSSAVQS 255          
BLAST of LIM/homeobox protein vs. Ensembl Nematostella
Match: EDO46073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR95])

HSP 1 Score: 135.576 bits (340), Expect = 2.349e-37
Identity = 75/225 (33.33%), Postives = 113/225 (50.22%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLST-WHVRCLHCTDCGIPLIDKC--YSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEI----------------AKTKEQELDQGN-----------------KRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKR 752
            +S C+ C   I D+ +L+V     WH  CL C DC + L +KC  + +  + +CK D+ R +GT+CA C      ++ + +A+N IYH++CF C++C RQL  G+EF L     L C+ D EI                 +   Q   Q N                  R RT +  KQL  L+  Y+ + +P   ++EQL   TGL  RV++VWFQN+R K+K+
Sbjct:   14 VSMCVGCGSQIHDQYILRVAPDLEWHASCLKCADCHMYLDEKCTCFVREGKTYCKRDYVRLFGTKCAKCSLNFSKNDFVMRARNKIYHIDCFRCVACSRQLVPGDEFALRED-GLFCKADHEIVEKATATAQATHVRNNGQRSSQSGGQTNGQTTPDSTPSKRKTDRPTRVRTVLNEKQLHTLRTCYNANPRPDAMMKEQLVEMTGLSPRVIRVWFQNKRCKDKK 237          
BLAST of LIM/homeobox protein vs. Ensembl Nematostella
Match: EDO43354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYP5])

HSP 1 Score: 128.642 bits (322), Expect = 1.626e-35
Identity = 79/237 (33.33%), Postives = 117/237 (49.37%), Query Frame = 3
Query:  177 DNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDK--CYSKSDEIFCKEDFFRRYGTR-CAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFE-------------------------IAKTKEQ-------------ELDQGN----KRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKR 752
            D + + C  C   IL+R  L      WH  CL C+DC + L ++  C+SK   I C+ED++RR+  + C++C + I + E++ +A++ +YH+ CFAC  C R L TG E+F +   ++ C+ D+E                         IA   E              EL  G     KR RT+    QL A+K  ++ +  P     +QLS KTGL  RV+QVWFQN RAK +R
Sbjct:    3 DKQQAVCAGCGSRILERFYLMAVDQEWHADCLKCSDCELRLDNELTCFSKDGVILCREDYYRRFSVKKCSSCSQAISSKELVMRARDQVYHVNCFACDRCKRMLATG-EYFGMRGIRIYCKEDYEELLREESRNPTKINSLSKGRPRKRRIATAIESITNLGYDLSDRPGELTTGADGRPKRVRTSFKHHQLRAMKTYFAMNHNPDAKDLKQLSQKTGLTKRVLQVWFQNARAKFRR 238          
BLAST of LIM/homeobox protein vs. Ensembl Nematostella
Match: EDO44223 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW85])

HSP 1 Score: 97.4413 bits (241), Expect = 1.725e-24
Identity = 66/204 (32.35%), Postives = 91/204 (44.61%), Query Frame = 3
Query:  195 CIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLS-------SRKLMCRPDFEIAKTKEQELDQGN--------------KRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAK 743
            C  C  PI DR ++KV    WH  CL C  C   L   C+SK  +++C+ D+ + +G R                    I+HL    C       N  E+   LS       +  +    D +     E   D  +              KRPRT +T++Q +  K  +  SSKP R VRE+LS +TGL +RVVQVWFQN+RAK
Sbjct:    1 CTGCNEPIEDRFLMKVVDEAWHESCLQCCICRSQLSRSCFSKDRKLYCRTDYEKTFGHR------------------TTIWHLSFAVCTD-----NVFEKSLCLSLPCCDVSNNTMPTERDIKEEIKTEANSDSDDSSVHGDDDDDKKGPKRPRTILTSQQRKVFKSAFEISSKPCRKVREELSRETGLSVRVVQVWFQNQRAK 181          
BLAST of LIM/homeobox protein vs. Ensembl Medaka
Match: lhx4 (LIM homeobox 4 [Source:NCBI gene;Acc:101165225])

HSP 1 Score: 274.633 bits (701), Expect = 5.651e-90
Identity = 136/258 (52.71%), Postives = 178/258 (68.99%), Query Frame = 3
Query:  180 NEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPY--FQGENGGSKVTSNKGDSDELSDDQTNEPCDISYQSD-VESD-SEIFSCYGS 941
             +I  C  C   ILD+ +LKV    WH +CL C DC  PL DKC+S++  ++CKEDFF+R+GT+CA+C + IP ++V+RKAQ+ +YHL CFACI C RQL TG+EF+L+   +L+C+ D+E AK  + + + G KRPRTTITAKQLE LK  Y  S KPARHVREQLS++TGLDMRVVQVWFQNRRAKEKR+KKDAGR  W+  Y   +   GG+KV     + +  +DD      ++S++ D V SD       YGS
Sbjct:   26 QQIPQCAGCSQHILDKFILKVLDRHWHSKCLKCADCQTPLADKCFSRAGSVYCKEDFFKRFGTKCASCQQGIPPTQVVRKAQDFVYHLHCFACIMCSRQLATGDEFYLMEDGRLVCKVDYETAKQND-DSEAGTKRPRTTITAKQLETLKSAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWTQFYKSVKRSRGGAKV-----EKESSADDAGLSDSELSFRDDQVLSDLGHTNGLYGS 277          
BLAST of LIM/homeobox protein vs. Ensembl Medaka
Match: lhx3 (LIM homeobox 3 [Source:NCBI gene;Acc:100144365])

HSP 1 Score: 258.455 bits (659), Expect = 1.407e-83
Identity = 131/253 (51.78%), Postives = 176/253 (69.57%), Query Frame = 3
Query:  183 EISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFF-RRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISYQSDVESDSEIFSCYG 938
            EI  C  C   I+DR +LKV    WH +CL C+DC   L +KC+S+ D ++CK+DFF RR+GT+CAAC + IP ++V+R+AQ+ +YHL CFACI C RQL TG+E++L+   +L+C+ D+E A  K++E D   KRPRTTITAKQLE LK  Y+ S KPARHVREQLS++TGLDMRVVQ  FQNRRAKEKR+KKDAGR  W   YF+  N      S+K D D + ++  +   ++S+ +D    SE+ +  G
Sbjct:   26 EIPVCAGCNQHIVDRFILKVLDRHWHGKCLKCSDCQAQLAEKCFSRGDSVYCKDDFFKRRFGTKCAACQQGIPPTQVVRRAQDFVYHLHCFACIVCKRQLATGDEYYLMEDSRLVCKTDYETA--KQREADSTAKRPRTTITAKQLETLKNAYNNSPKPARHVREQLSSETGLDMRVVQ--FQNRRAKEKRLKKDAGRQRWGQ-YFR--NMKRSRGSSKSDKDSIQEEGMDSDAEVSF-TDEPPVSELGNANG 270          
BLAST of LIM/homeobox protein vs. Ensembl Medaka
Match: lhx5 (LIM homeobox 5 [Source:NCBI gene;Acc:101166400])

HSP 1 Score: 203.371 bits (516), Expect = 3.598e-62
Identity = 97/250 (38.80%), Postives = 144/250 (57.60%), Query Frame = 3
Query:  195 CIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF---------------------------------------------EIAKTKEQELDQGNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQG 803
            C  C+ PILDR +L V    WH +C+ C DC   L +KC+S+  +++CK DFFRR+GT+CA C + I  ++++RKA++ ++HL CF C+ C++QL+TGEE +++   K +C+ D+                                             E    + +E + G KR  PRTTI AKQLE LK  +  + KP RH+REQL+ +TGL+MRV+QVWFQNRR+KE+RMK+ +  G     +F+G
Sbjct:    5 CAGCERPILDRFLLNVLDRAWHAKCVQCCDCNCNLTEKCFSRDGKLYCKMDFFRRFGTKCAGCLQGISPNDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKEDYLSPGSIKEVSLNSVSSCTDRSLSPDLPDPTQDDIKETDNSTSSDKETNNIENEEQNSGAKRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRG 254          
BLAST of LIM/homeobox protein vs. Ensembl Medaka
Match: lhx1b (LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:101155626])

HSP 1 Score: 202.601 bits (514), Expect = 7.629e-62
Identity = 94/235 (40.00%), Postives = 139/235 (59.15%), Query Frame = 3
Query:  192 YCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTK---------------------------------------------EQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKK 761
            +C +C+ PILDR +LKV    WHV+C+ C +C   L +KC+S+   ++CK DFFRR+GT+C  C + I  S+++R+A++ ++HL CF C+ C++QL+TGEE ++L   K +C+ D++ +  K                                             EQ      + PRTTI AKQLE LK  ++ + KP RH+REQLS +TGL+MRV+QVWFQNRR+KE+RMK+
Sbjct:    3 HCTSCEKPILDRFLLKVLDRPWHVKCVQCCECKCSLTEKCFSRDGRLYCKNDFFRRFGTKCGGCSQGILPSDLVRRAKSKVFHLNCFTCVMCNKQLSTGEELYILDEFKFVCKEDYQNSNGKDTILLSVTTCSEPSLSPDSQDPQDDGKDSESGHLSDKDACGNDNDEQSAVGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLSRETGLNMRVIQVWFQNRRSKERRMKQ 237          
BLAST of LIM/homeobox protein vs. Ensembl Medaka
Match: lhx1a (LIM homeobox 1 [Source:NCBI gene;Acc:100049230])

HSP 1 Score: 201.83 bits (512), Expect = 1.487e-61
Identity = 98/254 (38.58%), Postives = 148/254 (58.27%), Query Frame = 3
Query:  186 ISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDF---------------------------------------EIAKTKEQEL------DQ--GNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQ 800
            + +C  C+ PILDR +L V    WHV+C+ C +C   L +KC+S+   ++CK DFFRR+GT+C  C + I  ++++R+A++ ++HL CF C+ C++QL+TGEE +++   K +C+ D+                                       EIA   ++E       DQ  G KR  PRTTI AKQLE LK  ++ + KP RH+REQL+ +TGL+MRV+QVWFQNRR+KE+RMK+ +  G     +F+
Sbjct:    1 MVHCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGRLYCKNDFFRRFGTKCGGCSQGISPNDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLSNSSVKDTNLLSVTACSDPSLSPDSQDPLQDDVVLKDTEIAALSDKETVNNENDDQNLGGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFR 254          
BLAST of LIM/homeobox protein vs. Planmine SMEST
Match: SMESG000071273.1 (SMESG000071273.1)

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 295/295 (100.00%), Postives = 295/295 (100.00%), Query Frame = 3
Query:   60 MIRSNSPIVDSNFQSELISPIDYQTNNSLSNTKDSGIKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISYQSDVESDSEIFSCYGSS 944
            MIRSNSPIVDSNFQSELISPIDYQTNNSLSNTKDSGIKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISYQSDVESDSEIFSCYGSS
Sbjct:    1 MIRSNSPIVDSNFQSELISPIDYQTNNSLSNTKDSGIKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISYQSDVESDSEIFSCYGSS 295          
BLAST of LIM/homeobox protein vs. Planmine SMEST
Match: SMESG000053732.1 (SMESG000053732.1)

HSP 1 Score: 133.265 bits (334), Expect = 1.560e-36
Identity = 77/217 (35.48%), Postives = 115/217 (53.00%), Query Frame = 3
Query:  174 FDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQEL-----------------------DQGNKRPRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRM 755
             +NEI  CI C   I D+  LKV   + H  C  C  C  PL D+C+ K  +IFCK D++  +  RC  C EV+     + K  + IYH++C +C  C + L +G+  F  +   + C+ D+EI+  +  EL                       ++  KRPRT +T  Q    K  +  +SKP R +RE L+++TGL++RVVQVWFQN+RAK K++
Sbjct:   12 LNNEI--CIICNQMIYDQYYLKVSKDSIHEHCSVCCVCHCPLNDRCFLKHGQIFCKLDYYNCFSIRCYQCMEVVWPGSAVMKIFHRIYHVKCLSCTICQKHLTSGDMVF-TTDVGVFCQNDYEISMQQCMELGCTSNSDCDLDDNDSFEDSDSDSNKNCKRPRTILTTSQRRRFKTAFELNSKPTRKIRETLASETGLNVRVVQVWFQNQRAKVKKL 225          
BLAST of LIM/homeobox protein vs. Planmine SMEST
Match: SMESG000016568.1 (SMESG000016568.1)

HSP 1 Score: 124.79 bits (312), Expect = 1.432e-31
Identity = 60/181 (33.15%), Postives = 110/181 (60.77%), Query Frame = 3
Query:   87 DSNFQSELI-SPIDYQTNNSLSNTKDSGIKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQN-NIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFE-IAKTKEQELDQGNKRPRTTITAKQLE 620
            ++N ++ L+ SPI  +  +S++N       F N +  C +C  PI+DR +  +    WHV+CL C DC IPL ++C+ +  ++FC +D+ +R   +C+ C  +I  ++++R +++ +++HL+CF C+ CH+QL+TG+E+ LL + + +CR DF+ I K     L Q  K     IT + ++
Sbjct:    5 NNNIKNHLLNSPIPVKLTSSINNFNK---PFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKITNETIK 182          

HSP 2 Score: 96.2857 bits (238), Expect = 8.890e-22
Identity = 47/83 (56.63%), Postives = 59/83 (71.08%), Query Frame = 3
Query:  561 QELDQGNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQG 803
            Q  + G KR  PRTTI AKQL+ LK  +S + KP RHVREQL+  TGL MRV+QVWFQNRR+KE+RMK+ +  G    P+F+ 
Sbjct:  393 QSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGA-RRPFFRN 474          
BLAST of LIM/homeobox protein vs. Planmine SMEST
Match: SMESG000016568.1 (SMESG000016568.1)

HSP 1 Score: 124.79 bits (312), Expect = 1.931e-31
Identity = 60/181 (33.15%), Postives = 110/181 (60.77%), Query Frame = 3
Query:   87 DSNFQSELI-SPIDYQTNNSLSNTKDSGIKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQN-NIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFE-IAKTKEQELDQGNKRPRTTITAKQLE 620
            ++N ++ L+ SPI  +  +S++N       F N +  C +C  PI+DR +  +    WHV+CL C DC IPL ++C+ +  ++FC +D+ +R   +C+ C  +I  ++++R +++ +++HL+CF C+ CH+QL+TG+E+ LL + + +CR DF+ I K     L Q  K     IT + ++
Sbjct:    5 NNNIKNHLLNSPIPVKLTSSINNFNKP---FINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKITNETIK 182          

HSP 2 Score: 96.6709 bits (239), Expect = 6.888e-22
Identity = 47/83 (56.63%), Postives = 59/83 (71.08%), Query Frame = 3
Query:  561 QELDQGNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQG 803
            Q  + G KR  PRTTI AKQL+ LK  +S + KP RHVREQL+  TGL MRV+QVWFQNRR+KE+RMK+ +  G    P+F+ 
Sbjct:  393 QSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGAR-RPFFRN 474          
BLAST of LIM/homeobox protein vs. Planmine SMEST
Match: SMESG000043039.1 (SMESG000043039.1)

HSP 1 Score: 124.405 bits (311), Expect = 1.985e-31
Identity = 60/181 (33.15%), Postives = 109/181 (60.22%), Query Frame = 3
Query:   87 DSNFQSELI-SPIDYQTNNSLSNTKDSGIKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLIDKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQN-NIYHLECFACISCHRQLNTGEEFFLLSSRKLMCRPDFE-IAKTKEQELDQGNKRPRTTITAKQLE 620
            ++N ++ L+ SPI  +  +S+ N       F N +  C +C  PI+DR +  +    WHV+CL C DC IPL ++C+ +  ++FC +D+ +R   +C+ C  +I  ++++R +++ +++HL+CF C+ CH+QL+TG+E+ LL + + +CR DF+ I K     L Q  K     IT + ++
Sbjct:    5 NNNIKNHLLNSPIPVKLTSSIHNFNK---PFINPVPTCTSCSRPIIDRYLHNIADKFWHVQCLRCADCDIPLSERCFERDGKLFCSKDYRKRVSAKCSLCLNIILPTDLVRHSRDSSVFHLKCFFCVVCHKQLSTGDEYCLLENFRPVCREDFQHIFKEMSNILPQNCKHDSNKITNETIK 182          

HSP 2 Score: 96.2857 bits (238), Expect = 8.807e-22
Identity = 47/83 (56.63%), Postives = 59/83 (71.08%), Query Frame = 3
Query:  561 QELDQGNKR--PRTTITAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKRMKKDAGRGCWSSPYFQG 803
            Q  + G KR  PRTTI AKQL+ LK  +S + KP RHVREQL+  TGL MRV+QVWFQNRR+KE+RMK+ +  G    P+F+ 
Sbjct:  393 QSGNSGTKRRGPRTTIKAKQLDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGA-RRPFFRN 474          
The following BLAST results are available for this feature:
BLAST of LIM/homeobox protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LHX38.831e-8854.47LIM homeobox 3 [Source:HGNC Symbol;Acc:HGNC:6595][more]
LHX31.625e-8754.47LIM homeobox 3 [Source:HGNC Symbol;Acc:HGNC:6595][more]
LHX31.672e-8754.47LIM homeobox 3 [Source:HGNC Symbol;Acc:HGNC:6595][more]
LHX44.749e-8658.82LIM homeobox 4 [Source:HGNC Symbol;Acc:HGNC:21734][more]
LHX51.061e-6338.49LIM homeobox 5 [Source:HGNC Symbol;Acc:HGNC:14216][more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-141.140e-7250.66Homeobox protein ceh-14 [Source:UniProtKB/Swiss-P... [more]
lin-113.676e-5640.17pep chromosome:WBcel235:I:10248256:10255327:1 gene... [more]
lim-42.233e-4337.05LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
lim-42.235e-4136.73LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
lim-42.463e-4035.32LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lim35.559e-9158.80gene:FBgn0002023 transcript:FBtr0309834[more]
Lim31.424e-9058.80gene:FBgn0002023 transcript:FBtr0081170[more]
Lim35.903e-9058.80gene:FBgn0002023 transcript:FBtr0081169[more]
Lim35.903e-9058.80gene:FBgn0002023 transcript:FBtr0309832[more]
Lim35.903e-9058.80gene:FBgn0002023 transcript:FBtr0309833[more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx45.876e-8755.41LIM homeobox 4 [Source:ZFIN;Acc:ZDB-GENE-060728-1][more]
LHX34.389e-7453.81LIM homeobox 3 [Source:HGNC Symbol;Acc:HGNC:6595][more]
LHX33.149e-7355.91LIM homeobox 3 [Source:HGNC Symbol;Acc:HGNC:6595][more]
lhx1b7.350e-6439.44LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
lhx1b7.350e-6439.44LIM homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clpb2.934e-8253.65ClpB homolog, mitochondrial AAA ATPase chaperonin ... [more]
clpb6.946e-8154.31ClpB homolog, mitochondrial AAA ATPase chaperonin ... [more]
klf21.129e-6438.29Kruppel-like factor 2 [Source:Xenbase;Acc:XB-GENE-... [more]
gfm24.069e-6136.33G elongation factor, mitochondrial 2 [Source:Xenba... [more]
gfm22.995e-5939.76G elongation factor, mitochondrial 2 [Source:Xenba... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lhx32.099e-8850.97LIM homeobox protein 3 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx32.352e-8850.97LIM homeobox protein 3 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx41.166e-8657.41LIM homeobox protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx42.566e-7552.31LIM homeobox protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx51.082e-6338.49LIM homeobox protein 5 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of LIM/homeobox protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53412|LHX3_CHICK6.403e-8953.17LIM/homeobox protein Lhx3 OS=Gallus gallus OX=9031... [more]
sp|P36200|LHX3_XENLA8.862e-8952.96LIM/homeobox protein Lhx3 OS=Xenopus laevis OX=835... [more]
sp|Q90421|LHX3_DANRE3.122e-8851.76LIM/homeobox protein Lhx3 OS=Danio rerio OX=7955 G... [more]
sp|P50481|LHX3_MOUSE1.645e-8750.97LIM/homeobox protein Lhx3 OS=Mus musculus OX=10090... [more]
sp|O97581|LHX3_PIG3.295e-8751.38LIM/homeobox protein Lhx3 (Fragment) OS=Sus scrofa... [more]
back to top
BLAST of LIM/homeobox protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H8A26.398e-10358.49LIM/homeobox protein Lhx3 OS=Lingula unguis OX=757... [more]
A0A210R1763.057e-10162.17LIM/homeobox protein Lhx3 OS=Mizuhopecten yessoens... [more]
A0A0L8I3P36.280e-10162.40Uncharacterized protein (Fragment) OS=Octopus bima... [more]
A0A2C9KAY39.094e-9861.84Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A5N4AJ856.015e-9762.61Uncharacterized protein OS=Photinus pyralis OX=705... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LHX34.465e-9051.76LIM homeobox 3 [Source:NCBI gene;Acc:103029891][more]
lhx45.065e-8657.84LIM homeobox 4 [Source:NCBI gene;Acc:103029973][more]
lhx46.819e-8657.56LIM homeobox 4 [Source:NCBI gene;Acc:103029973][more]
lhx1b1.234e-6440.50LIM/homeobox protein Lhx1-like [Source:NCBI gene;A... [more]
lhx1a4.600e-6238.89LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmo4b1.885e-2340.34LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
ENSPMAT00000009847.11.815e-2267.24pep scaffold:Pmarinus_7.0:GL481168:3356:14379:1 ge... [more]
ENSPMAT00000002189.16.839e-2229.89pep scaffold:Pmarinus_7.0:GL483992:1961:4872:1 gen... [more]
lmo24.634e-1830.28LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
lmo22.458e-1729.86LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO26.107e-631.08Homeobox transcription factor; regulatory targets ... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
LHX14.221e-6441.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343707.485e-4236.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460732.349e-3733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433541.626e-3533.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442231.725e-2432.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM/homeobox protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx45.651e-9052.71LIM homeobox 4 [Source:NCBI gene;Acc:101165225][more]
lhx31.407e-8351.78LIM homeobox 3 [Source:NCBI gene;Acc:100144365][more]
lhx53.598e-6238.80LIM homeobox 5 [Source:NCBI gene;Acc:101166400][more]
lhx1b7.629e-6240.00LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:10... [more]
lhx1a1.487e-6138.58LIM homeobox 1 [Source:NCBI gene;Acc:100049230][more]
back to top
BLAST of LIM/homeobox protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071273.10.000e+0100.00SMESG000071273.1[more]
SMESG000053732.11.560e-3635.48SMESG000053732.1[more]
SMESG000016568.11.432e-3133.15SMESG000016568.1[more]
SMESG000016568.11.931e-3133.15SMESG000016568.1[more]
SMESG000043039.11.985e-3133.15SMESG000043039.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007640 ID=SMED30007640|Name=LIM/homeobox protein|organism=Schmidtea mediterranea sexual|type=transcript|length=964bp
AAACATTCGATTTTGTATTTGTTTTTTTTATACGAAAAGAAGAAATAATA
TTTATCCCAATGATCAGATCAAATAGTCCGATTGTCGATTCTAATTTCCA
ATCCGAACTCATTTCTCCAATAGATTATCAGACAAACAATTCTCTCTCCA
ACACAAAAGATTCCGGCATTAAATTCGACAATGAAATTTCATATTGTATC
GCTTGTAAAGGTCCCATTCTCGACAGAGTTGTACTAAAGGTTGGATTAAG
TACGTGGCACGTCAGATGCTTGCACTGCACTGATTGTGGAATACCTCTTA
TTGATAAATGCTATTCAAAAAGCGATGAAATTTTTTGCAAAGAAGACTTT
TTCAGGCGTTATGGAACAAGATGTGCTGCCTGTGATGAGGTTATTCCAGC
ATCAGAAGTCATTAGGAAAGCACAAAACAATATCTACCATCTTGAATGTT
TTGCCTGCATCAGCTGTCATCGTCAGTTAAACACTGGAGAAGAATTCTTT
CTACTTTCTTCGAGAAAATTGATGTGTCGTCCGGATTTTGAAATCGCAAA
AACTAAAGAACAAGAGTTAGATCAAGGAAATAAACGACCAAGAACGACAA
TTACTGCAAAACAGCTTGAGGCGCTGAAAAAGACATACAGTGAAAGTTCT
AAGCCCGCTCGGCACGTCCGGGAACAACTCAGCGCCAAAACCGGACTTGA
TATGAGAGTCGTTCAAGTTTGGTTTCAAAACCGCAGGGCAAAAGAGAAAC
GAATGAAAAAGGATGCCGGCAGAGGTTGCTGGTCTTCCCCATATTTCCAA
GGAGAAAATGGTGGAAGTAAAGTTACCTCAAATAAAGGAGATAGCGATGA
ATTGTCCGATGATCAAACCAATGAACCATGTGATATATCTTATCAAAGCG
ATGTTGAAAGTGATTCGGAGATCTTCAGCTGTTATGGAAGCAGCAATAAC
AACAACAACAACAA
back to top

protein sequence of SMED30007640-orf-1

>SMED30007640-orf-1 ID=SMED30007640-orf-1|Name=SMED30007640-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
TFDFVFVFFIRKEEIIFIPMIRSNSPIVDSNFQSELISPIDYQTNNSLSN
TKDSGIKFDNEISYCIACKGPILDRVVLKVGLSTWHVRCLHCTDCGIPLI
DKCYSKSDEIFCKEDFFRRYGTRCAACDEVIPASEVIRKAQNNIYHLECF
ACISCHRQLNTGEEFFLLSSRKLMCRPDFEIAKTKEQELDQGNKRPRTTI
TAKQLEALKKTYSESSKPARHVREQLSAKTGLDMRVVQVWFQNRRAKEKR
MKKDAGRGCWSSPYFQGENGGSKVTSNKGDSDELSDDQTNEPCDISYQSD
VESDSEIFSCYGSSNNNNNN
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001781Znf_LIM
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 193..255
e-value: 1.8E-22
score: 90.7
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 194..250
e-value: 8.6E-21
score: 73.6
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 191..251
score: 18.22
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 194..252
e-value: 6.16515E-20
score: 79.98
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 123..178
e-value: 6.9E-12
score: 55.5
coord: 64..115
e-value: 2.9E-9
score: 46.8
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 65..119
e-value: 6.2E-11
score: 42.4
coord: 124..180
e-value: 6.4E-15
score: 55.1
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 124..159
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 122..185
score: 12.92
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 63..121
score: 10.009
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 65..119
e-value: 3.8E-42
score: 145.2
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 190..257
e-value: 1.4E-22
score: 81.0
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 120..185
e-value: 3.8E-42
score: 145.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 269..303
NoneNo IPR availablePANTHERPTHR24208:SF128HOMEOBOX PROTEIN CEH-14coord: 40..303
NoneNo IPR availablePANTHERPTHR24208FAMILY NOT NAMEDcoord: 40..303
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 92..155
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 226..249
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 188..253