Calcium-transporting ATPase

Overview
NameCalcium-transporting ATPase
Smed IDSMED30007620
Length (bp)1257
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-transporting ATPase (SMED30007620) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30007620) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-transporting ATPase (SMED30007620) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30007620) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007620

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007620SMESG000006504.1 SmedASXL_014350SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30007620SMESG000006504.1 dd_Smed_v4_12226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 316.62 bits (810), Expect = 2.521e-97
Identity = 219/411 (53.28%), Postives = 278/411 (67.64%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHEL--NL-----DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F  T  EL+ +M+ RG + +  I     +++GL   +  S   G++     L  RR+IYG+N IPPK  K+F+ LVWEA QD+TL+IL VAAI+SL LS Y    E  E   N+     DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F VIR+G L Q+PV  +VVGD+ Q+KYGDLLPADG++IQ+NDL++DESSLTGESDHV+K  + D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G E +     K        + E   ++   ++       +E K  +   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF VE + W    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKAKKQDGAVAME---MQPLKSAEGGEMEEREKKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 434          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 316.235 bits (809), Expect = 2.873e-97
Identity = 218/411 (53.04%), Postives = 276/411 (67.15%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHEL-------NLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F  T  EL+ +M+ RG + +  I     +++GL   +  S   G++     L  RR+IYG+N IPPK  K+F+ LVWEA QD+TL+IL VAAI+SL LS Y    E  E          DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F VIR+G L Q+PV  +VVGD+ Q+KYGDLLPADG++IQ+NDL++DESSLTGESDHV+K  + D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G E +     K        + E   ++   ++       +E K  +   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF VE + W    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKAKKQDGAVAME---MQPLKSAEGGEMEEREKKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 434          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B4 (ATPase plasma membrane Ca2+ transporting 4 [Source:HGNC Symbol;Acc:HGNC:817])

HSP 1 Score: 312.768 bits (800), Expect = 6.440e-96
Identity = 224/419 (53.46%), Postives = 279/419 (66.59%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELN-------LDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLL--NGGLENDTSSYNKNMSLP-----YKTSDENIFLXXXXXXXXXXXXXXXD-KIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F  T  EL+++M+ R  D +  I      +  L   +  S + G+S   A L  RR+++G N IPPK  K+F+ LVWEA QD+TL+IL +AAIISLVLS Y    E +EL         DE E +AGWIEG AIL +V++VV VTAFNDW KE+QFRGLQ +I+ E  F +IR+G L Q+PV EIVVGD+ Q+KYGDLLPADGI+IQ NDL++DESSLTGESDHVKK  + D MLLSGTHVMEGSG+MVV AVG  SQ+GII TLL  N   E +     K   +P      KT D         NS    +N ++D K V    KEKSVLQ KLT+LA+QIG  G ++S +TV ILIL FVI  F + R+PW    T  +++  +   IIG+TVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   22 FGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPAGEENELCGQVATTPEDENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEGEKKKKGKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKSVLQGKLTRLAVQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVAVPEGLPLAVTISLAYSVKKM 440          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B4 (ATPase plasma membrane Ca2+ transporting 4 [Source:HGNC Symbol;Acc:HGNC:817])

HSP 1 Score: 312.768 bits (800), Expect = 6.440e-96
Identity = 224/419 (53.46%), Postives = 279/419 (66.59%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELN-------LDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLL--NGGLENDTSSYNKNMSLP-----YKTSDENIFLXXXXXXXXXXXXXXXD-KIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F  T  EL+++M+ R  D +  I      +  L   +  S + G+S   A L  RR+++G N IPPK  K+F+ LVWEA QD+TL+IL +AAIISLVLS Y    E +EL         DE E +AGWIEG AIL +V++VV VTAFNDW KE+QFRGLQ +I+ E  F +IR+G L Q+PV EIVVGD+ Q+KYGDLLPADGI+IQ NDL++DESSLTGESDHVKK  + D MLLSGTHVMEGSG+MVV AVG  SQ+GII TLL  N   E +     K   +P      KT D         NS    +N ++D K V    KEKSVLQ KLT+LA+QIG  G ++S +TV ILIL FVI  F + R+PW    T  +++  +   IIG+TVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   22 FGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPAGEENELCGQVATTPEDENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEGEKKKKGKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKSVLQGKLTRLAVQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVAVPEGLPLAVTISLAYSVKKM 440          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B4 (ATPase plasma membrane Ca2+ transporting 4 [Source:HGNC Symbol;Acc:HGNC:817])

HSP 1 Score: 312.768 bits (800), Expect = 9.676e-96
Identity = 224/419 (53.46%), Postives = 279/419 (66.59%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELN-------LDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLL--NGGLENDTSSYNKNMSLP-----YKTSDENIFLXXXXXXXXXXXXXXXD-KIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F  T  EL+++M+ R  D +  I      +  L   +  S + G+S   A L  RR+++G N IPPK  K+F+ LVWEA QD+TL+IL +AAIISLVLS Y    E +EL         DE E +AGWIEG AIL +V++VV VTAFNDW KE+QFRGLQ +I+ E  F +IR+G L Q+PV EIVVGD+ Q+KYGDLLPADGI+IQ NDL++DESSLTGESDHVKK  + D MLLSGTHVMEGSG+MVV AVG  SQ+GII TLL  N   E +     K   +P      KT D         NS    +N ++D K V    KEKSVLQ KLT+LA+QIG  G ++S +TV ILIL FVI  F + R+PW    T  +++  +   IIG+TVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   22 FGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPAGEENELCGQVATTPEDENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEGEKKKKGKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKSVLQGKLTRLAVQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVAVPEGLPLAVTISLAYSVKKM 440          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-2 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9TYP9])

HSP 1 Score: 285.034 bits (728), Expect = 2.844e-86
Identity = 200/401 (49.88%), Postives = 265/401 (66.08%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGI--SSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            +  + +EL+ +M+ RG + +  + +    + GL   +    ING+   ++E   RR  +GKN IPP P+KSF  L WEA QD+TL+IL+VAA++SL LS Y    E H  N D +E EAGWIEGVAIL AVLVVV VTA NDW KE+QFRGLQ+KI+TE  F VIR G    I V E+VVGD+ ++KYGDLLPADG++IQSNDL++DESSLTGESD ++K E  D +LLSGTH MEGSG+ +V AVG  SQ+GII +LL           +     P   ++ N  +    N   +   +   +        KSVLQTKL+ LA+QIGYIG+I++  TVLILI++  I  +A+E + ++    +   +  +IIGVTVLV+AVPEGLPLA+TLAL YSVKKM
Sbjct:    7 YDCSISELKLLMELRGAEALEKVNSTYNGVEGLCRKLKTDPINGLPNDTKELEHRRTAFGKNEIPPAPSKSFFRLAWEALQDITLVILLVAALVSLGLSFYKPPAE-HASN-DSSESEAGWIEGVAILVAVLVVVLVTALNDWTKEKQFRGLQSKIETEHKFSVIRGGEPLDIVVNELVVGDIARVKYGDLLPADGLLIQSNDLKIDESSLTGESDLIRKSEEFDPVLLSGTHAMEGSGRFLVTAVGLNSQTGIIMSLLGAA----KEKKDDKKEEPTTLTNGN-HMNGLGNGVDKAAELPVPEEEEVGRMSKSVLQTKLSNLALQIGYIGSIVAAATVLILIIRHCISKYAIEGKSFEA-SDISHFVNFIIIGVTVLVIAVPEGLPLAITLALTYSVKKM 399          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 277.33 bits (708), Expect = 1.750e-83
Identity = 204/400 (51.00%), Postives = 263/400 (65.75%), Query Frame = 3
Query:   81 ELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG---LENDTSSYNKNMSLPYKTSDENI--FLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            EL+ +M++R  +    I        GL + + +  N G+ + E  L  RR ++G N IPP P K F+ LVWEA QD+TL+IL+V+AI+SL LS Y    E      D++E +AGWIEGVAIL +V+VVV VTA ND+ KERQFRGLQ KI+TE  F V+R G   Q+ V E+VVGD+ QIKYGDL+P+DGIIIQSNDL++DESSLTGESD ++K    D ++LSGTHVMEGSGKM+V AVG  SQ+GII TLL       E +  +  +        ++E     L  S       N        S+  KE+SVLQ KLT+LAIQIGY G+ ++  TVLILI++F I  +A++ + +      +  I  LIIGVTVLVVAVPEGLPLAVTL+LAYSVKKM
Sbjct:   10 ELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTA-GSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAEEGTAQALLDSKGDEAMANGKAVAAAESDGKKERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSL-ADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKM 407          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 277.33 bits (708), Expect = 1.750e-83
Identity = 204/400 (51.00%), Postives = 263/400 (65.75%), Query Frame = 3
Query:   81 ELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG---LENDTSSYNKNMSLPYKTSDENI--FLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            EL+ +M++R  +    I        GL + + +  N G+ + E  L  RR ++G N IPP P K F+ LVWEA QD+TL+IL+V+AI+SL LS Y    E      D++E +AGWIEGVAIL +V+VVV VTA ND+ KERQFRGLQ KI+TE  F V+R G   Q+ V E+VVGD+ QIKYGDL+P+DGIIIQSNDL++DESSLTGESD ++K    D ++LSGTHVMEGSGKM+V AVG  SQ+GII TLL       E +  +  +        ++E     L  S       N        S+  KE+SVLQ KLT+LAIQIGY G+ ++  TVLILI++F I  +A++ + +      +  I  LIIGVTVLVVAVPEGLPLAVTL+LAYSVKKM
Sbjct:   10 ELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTA-GSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAEEGTAQALLDSKGDEAMANGKAVAAAESDGKKERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSL-ADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKM 407          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 277.33 bits (708), Expect = 1.750e-83
Identity = 204/400 (51.00%), Postives = 263/400 (65.75%), Query Frame = 3
Query:   81 ELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG---LENDTSSYNKNMSLPYKTSDENI--FLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            EL+ +M++R  +    I        GL + + +  N G+ + E  L  RR ++G N IPP P K F+ LVWEA QD+TL+IL+V+AI+SL LS Y    E      D++E +AGWIEGVAIL +V+VVV VTA ND+ KERQFRGLQ KI+TE  F V+R G   Q+ V E+VVGD+ QIKYGDL+P+DGIIIQSNDL++DESSLTGESD ++K    D ++LSGTHVMEGSGKM+V AVG  SQ+GII TLL       E +  +  +        ++E     L  S       N        S+  KE+SVLQ KLT+LAIQIGY G+ ++  TVLILI++F I  +A++ + +      +  I  LIIGVTVLVVAVPEGLPLAVTL+LAYSVKKM
Sbjct:   10 ELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTA-GSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAEEGTAQALLDSKGDEAMANGKAVAAAESDGKKERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSL-ADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKM 407          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 277.33 bits (708), Expect = 1.750e-83
Identity = 204/400 (51.00%), Postives = 263/400 (65.75%), Query Frame = 3
Query:   81 ELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG---LENDTSSYNKNMSLPYKTSDENI--FLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            EL+ +M++R  +    I        GL + + +  N G+ + E  L  RR ++G N IPP P K F+ LVWEA QD+TL+IL+V+AI+SL LS Y    E      D++E +AGWIEGVAIL +V+VVV VTA ND+ KERQFRGLQ KI+TE  F V+R G   Q+ V E+VVGD+ QIKYGDL+P+DGIIIQSNDL++DESSLTGESD ++K    D ++LSGTHVMEGSGKM+V AVG  SQ+GII TLL       E +  +  +        ++E     L  S       N        S+  KE+SVLQ KLT+LAIQIGY G+ ++  TVLILI++F I  +A++ + +      +  I  LIIGVTVLVVAVPEGLPLAVTL+LAYSVKKM
Sbjct:   10 ELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTA-GSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAEEGTAQALLDSKGDEAMANGKAVAAAESDGKKERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSL-ADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKM 407          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0304047)

HSP 1 Score: 330.872 bits (847), Expect = 8.010e-103
Identity = 224/415 (53.98%), Postives = 284/415 (68.43%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GISSQEA--PLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGL-------------ENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIV-SNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            + ++  +L+E+M+HRG +G+ M I     I+ L   + +S N G+S  +A    RR+ +G N IPPKP K+F+TLVWEA QD+TL+IL VAA++SL LS Y    E   + L E E   GWIEG+AIL +V+VVV VTAFND+ KERQFRGLQN+I+ E  F VIR G + QI V +I+VGD+ Q+KYGDLLPADG +IQSNDL+VDESSLTGESDHVKKG ++D M+LSGTHVMEGSGKMVV AVG  SQ+GIIFTLL   +             END  S  K    P +       +  S +               +   KEKSVLQ KLTKLAIQIGY G+ I+++TV+ILI++F I TF ++ +PWK + +   ++  LIIGVTVLVVAVPEGLPLAVTL+LAYSVKKM
Sbjct:   11 YGISLKQLRELMEHRGREGV-MKIAENGGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPV-LQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKGENDGRSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSSSGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWK-NTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKM 422          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0300559)

HSP 1 Score: 325.865 bits (834), Expect = 2.357e-101
Identity = 224/427 (52.46%), Postives = 284/427 (66.51%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GISSQEA--PLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGL-------------------------ENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIV-SNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            + ++  +L+E+M+HRG +G+ M I     I+ L   + +S N G+S  +A    RR+ +G N IPPKP K+F+TLVWEA QD+TL+IL VAA++SL LS Y    E   + L E E   GWIEG+AIL +V+VVV VTAFND+ KERQFRGLQN+I+ E  F VIR G + QI V +I+VGD+ Q+KYGDLLPADG +IQSNDL+VDESSLTGESDHVKKG ++D M+LSGTHVMEGSGKMVV AVG  SQ+GIIFTLL   +                         END  S  K    P +       +  S +               +   KEKSVLQ KLTKLAIQIGY G+ I+++TV+ILI++F I TF ++ +PWK + +   ++  LIIGVTVLVVAVPEGLPLAVTL+LAYSVKKM
Sbjct:   11 YGISLKQLRELMEHRGREGV-MKIAENGGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPV-LQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSSSGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWK-NTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKM 434          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0304048)

HSP 1 Score: 326.25 bits (835), Expect = 4.437e-101
Identity = 224/427 (52.46%), Postives = 284/427 (66.51%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GISSQEA--PLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGL-------------------------ENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIV-SNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            + ++  +L+E+M+HRG +G+ M I     I+ L   + +S N G+S  +A    RR+ +G N IPPKP K+F+TLVWEA QD+TL+IL VAA++SL LS Y    E   + L E E   GWIEG+AIL +V+VVV VTAFND+ KERQFRGLQN+I+ E  F VIR G + QI V +I+VGD+ Q+KYGDLLPADG +IQSNDL+VDESSLTGESDHVKKG ++D M+LSGTHVMEGSGKMVV AVG  SQ+GIIFTLL   +                         END  S  K    P +       +  S +               +   KEKSVLQ KLTKLAIQIGY G+ I+++TV+ILI++F I TF ++ +PWK + +   ++  LIIGVTVLVVAVPEGLPLAVTL+LAYSVKKM
Sbjct:   11 YGISLKQLRELMEHRGREGV-MKIAENGGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPV-LQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSSSGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWK-NTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKM 434          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0300556)

HSP 1 Score: 326.25 bits (835), Expect = 4.590e-101
Identity = 224/427 (52.46%), Postives = 284/427 (66.51%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GISSQEA--PLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGL-------------------------ENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIV-SNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            + ++  +L+E+M+HRG +G+ M I     I+ L   + +S N G+S  +A    RR+ +G N IPPKP K+F+TLVWEA QD+TL+IL VAA++SL LS Y    E   + L E E   GWIEG+AIL +V+VVV VTAFND+ KERQFRGLQN+I+ E  F VIR G + QI V +I+VGD+ Q+KYGDLLPADG +IQSNDL+VDESSLTGESDHVKKG ++D M+LSGTHVMEGSGKMVV AVG  SQ+GIIFTLL   +                         END  S  K    P +       +  S +               +   KEKSVLQ KLTKLAIQIGY G+ I+++TV+ILI++F I TF ++ +PWK + +   ++  LIIGVTVLVVAVPEGLPLAVTL+LAYSVKKM
Sbjct:   11 YGISLKQLRELMEHRGREGV-MKIAENGGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPV-LQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSSSGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWK-NTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKM 434          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0300554)

HSP 1 Score: 326.25 bits (835), Expect = 5.840e-101
Identity = 224/427 (52.46%), Postives = 284/427 (66.51%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GISSQEA--PLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGL-------------------------ENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIV-SNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            + ++  +L+E+M+HRG +G+ M I     I+ L   + +S N G+S  +A    RR+ +G N IPPKP K+F+TLVWEA QD+TL+IL VAA++SL LS Y    E   + L E E   GWIEG+AIL +V+VVV VTAFND+ KERQFRGLQN+I+ E  F VIR G + QI V +I+VGD+ Q+KYGDLLPADG +IQSNDL+VDESSLTGESDHVKKG ++D M+LSGTHVMEGSGKMVV AVG  SQ+GIIFTLL   +                         END  S  K    P +       +  S +               +   KEKSVLQ KLTKLAIQIGY G+ I+++TV+ILI++F I TF ++ +PWK + +   ++  LIIGVTVLVVAVPEGLPLAVTL+LAYSVKKM
Sbjct:   11 YGISLKQLRELMEHRGREGV-MKIAENGGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPV-LQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSSSGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWK-NTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKM 434          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3a (ATPase plasma membrane Ca2+ transporting 3a [Source:ZFIN;Acc:ZDB-GENE-040718-174])

HSP 1 Score: 320.857 bits (821), Expect = 4.918e-99
Identity = 222/422 (52.61%), Postives = 282/422 (66.82%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYM-------KVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG-LENDTSSYNK--------NMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSV--KEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDK---HLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F ++ +EL  +M+ RG + +  I     N   L   +  S  +G+S   A L  RRK++G N IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y           E  E   DE E +A WIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R+ T+ QIPV E+VVGD+ Q+KYGDLLPADG++IQ NDL++DESSLTGESDHV+K  + D MLLSGTHVMEGSGKM+V AVG  SQ+GIIFTLL  G +E +     K        N     K  DE + ++     + E   ++E +    SV  KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF V +QPW T+    +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   27 FGVSVDELCSLMELRGAEALQKIQENYTNTETLCHRLKTSPADGLSDNPADLEKRRKVFGMNFIPPKQPKTFLELVWEALQDITLIILEIAAIISLGLSFYQPPGGDSEACVEVSEGAEDEGEADANWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFAVVRNSTVIQIPVAEMVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSIDKDPMLLSGTHVMEGSGKMLVTAVGVNSQTGIIFTLLGAGEMEEEKKDCKKGKQDGTLENNQNKAKKQDEAVAMEMQPLKSAEGGEVEEKEKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILMLYFVIKTFIVHKQPWLTECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 448          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3a (ATPase plasma membrane Ca2+ transporting 3a [Source:ZFIN;Acc:ZDB-GENE-040718-174])

HSP 1 Score: 320.472 bits (820), Expect = 1.685e-98
Identity = 222/422 (52.61%), Postives = 282/422 (66.82%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYM-------KVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG-LENDTSSYNK--------NMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSV--KEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDK---HLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F ++ +EL  +M+ RG + +  I     N   L   +  S  +G+S   A L  RRK++G N IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y           E  E   DE E +A WIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R+ T+ QIPV E+VVGD+ Q+KYGDLLPADG++IQ NDL++DESSLTGESDHV+K  + D MLLSGTHVMEGSGKM+V AVG  SQ+GIIFTLL  G +E +     K        N     K  DE + ++     + E   ++E +    SV  KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF V +QPW T+    +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   27 FGVSVDELCSLMELRGAEALQKIQENYTNTETLCHRLKTSPADGLSDNPADLEKRRKVFGMNFIPPKQPKTFLELVWEALQDITLIILEIAAIISLGLSFYQPPGGDSEACVEVSEGAEDEGEADANWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFAVVRNSTVIQIPVAEMVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSIDKDPMLLSGTHVMEGSGKMLVTAVGVNSQTGIIFTLLGAGEMEEEKKDCKKGKQDGTLENNQNKAKKQDEAVAMEMQPLKSAEGGEVEEKEKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILMLYFVIKTFIVHKQPWLTECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 448          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3b [Source:ZFIN;Acc:ZDB-GENE-080409-2])

HSP 1 Score: 308.145 bits (788), Expect = 2.767e-94
Identity = 216/423 (51.06%), Postives = 278/423 (65.72%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSI-NGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHEL-------NLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDEN------------IFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F ++ +EL+ +M+ RG + +  I     ++ GL   + SS  +G+S     L  RR+ +G+N IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y    E  E+         DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R+G + QIPV E+VVGD+ Q+KYGDLLPADG+++Q NDL++DESSLTGESDHV+K    D MLLSGTHVMEGSG+M+V AVG  SQSGIIFTLL G  E +     K    P    + N            + ++   ++       +E K  +   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF V    W    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   34 FGVSLDELRNLMELRGAEALQKIQESFTDVEGLCQRLKSSTTDGLSDNPTDLEKRRQTFGQNFIPPKKPKTFLQLVWEALQDVTLIILELAAIISLALSFYQPPGEDSEVCGKGAGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIELEQRFAVVRNGNVIQIPVAEMVVGDMAQVKYGDLLPADGVLVQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMLVTAVGVNSQSGIIFTLL-GAGEGEEEKKEKKGKQPEAAVETNQNKAKKQDGAVAMEMQPLKSAEGGEVEEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIDTFVVGNMTWLPECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 455          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3b [Source:ZFIN;Acc:ZDB-GENE-080409-2])

HSP 1 Score: 307.76 bits (787), Expect = 3.418e-94
Identity = 216/423 (51.06%), Postives = 278/423 (65.72%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSI-NGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHEL-------NLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDEN------------IFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F ++ +EL+ +M+ RG + +  I     ++ GL   + SS  +G+S     L  RR+ +G+N IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y    E  E+         DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R+G + QIPV E+VVGD+ Q+KYGDLLPADG+++Q NDL++DESSLTGESDHV+K    D MLLSGTHVMEGSG+M+V AVG  SQSGIIFTLL G  E +     K    P    + N            + ++   ++       +E K  +   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF V    W    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   28 FGVSLDELRNLMELRGAEALQKIQESFTDVEGLCQRLKSSTTDGLSDNPTDLEKRRQTFGQNFIPPKKPKTFLQLVWEALQDVTLIILELAAIISLALSFYQPPGEDSEVCGKGAGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIELEQRFAVVRNGNVIQIPVAEMVVGDMAQVKYGDLLPADGVLVQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMLVTAVGVNSQSGIIFTLL-GAGEGEEEKKEKKGKQPEAAVETNQNKAKKQDGAVAMEMQPLKSAEGGEVEEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIDTFVVGNMTWLPECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 449          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3b [Source:ZFIN;Acc:ZDB-GENE-080409-2])

HSP 1 Score: 307.76 bits (787), Expect = 3.870e-94
Identity = 216/423 (51.06%), Postives = 278/423 (65.72%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSI-NGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHEL-------NLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDEN------------IFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F ++ +EL+ +M+ RG + +  I     ++ GL   + SS  +G+S     L  RR+ +G+N IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y    E  E+         DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R+G + QIPV E+VVGD+ Q+KYGDLLPADG+++Q NDL++DESSLTGESDHV+K    D MLLSGTHVMEGSG+M+V AVG  SQSGIIFTLL G  E +     K    P    + N            + ++   ++       +E K  +   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF V    W    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   34 FGVSLDELRNLMELRGAEALQKIQESFTDVEGLCQRLKSSTTDGLSDNPTDLEKRRQTFGQNFIPPKKPKTFLQLVWEALQDVTLIILELAAIISLALSFYQPPGEDSEVCGKGAGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIELEQRFAVVRNGNVIQIPVAEMVVGDMAQVKYGDLLPADGVLVQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMLVTAVGVNSQSGIIFTLL-GAGEGEEEKKEKKGKQPEAAVETNQNKAKKQDGAVAMEMQPLKSAEGGEVEEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIDTFVVGNMTWLPECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 455          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: fam149a (family with sequence similarity 149 member A [Source:Xenbase;Acc:XB-GENE-6050471])

HSP 1 Score: 322.398 bits (825), Expect = 3.137e-99
Identity = 228/437 (52.17%), Postives = 290/437 (66.36%), Query Frame = 3
Query:    3 NFYIYIFTKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNL-----DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPY------KTSDENIFLXXXXXXXXXXXXXXXDKIVSNSV--KEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDK---HLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            N  +  + KN  +       F  T  EL+ +M+ RG + I  I +   ++NGL   +  S   G+S   A    RR+IYG N IPPK  K+F+ LVWEA QD+TL+IL +AAI+SL LS Y    E +  N+     DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F VIR+G + QIPV E++VGD+ QIKYGDLLPADG++IQ NDL++DESSLTGESDHV+K    D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G E +     K  SL +      K  D  + ++     + E   ++E +    SV  KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF V+ + W T+    +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:    5 NSSVDFYQKNQRREQNHAGGFGCTLQELRSLMELRGSEAIQKIQDSYGDVNGLCRRLKTSPTEGLSENIADFEKRRQIYGVNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYAPPGEQNCGNVSGGGHDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFSVIRNGQVVQIPVAELIVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGNSLEHEKVNKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIQTFVVDGKVWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 441          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: fam149a (family with sequence similarity 149 member A [Source:Xenbase;Acc:XB-GENE-6050471])

HSP 1 Score: 319.316 bits (817), Expect = 1.888e-98
Identity = 223/431 (51.74%), Postives = 282/431 (65.43%), Query Frame = 3
Query:    3 NFYIYIFTKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHE-------LNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDK---HLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            N  +  + KN  +       F  T  EL+ +M+ RG + I  I +   ++NGL   +  S   G+S   A    RR+IYG N IPPK  K+F+ LVWEA QD+TL+IL +AAI+SL LS Y    E  +          DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F VIR+G + QIPV E++VGD+ QIKYGDLLPADG++IQ NDL++DESSLTGESDHV+K    D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G E +     K        + E   ++   ++       +E K  S   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF V+ + W T+    +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:    5 NSSVDFYQKNQRREQNHAGGFGCTLQELRSLMELRGSEAIQKIQDSYGDVNGLCRRLKTSPTEGLSENIADFEKRRQIYGVNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYAPPGEQSDNCGNVSGGGHDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFSVIRNGQVVQIPVAELIVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKAKKQDGAVAME---MQPLKSAEGGEMEEREKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIQTFVVDGKVWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 432          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: fam149a (family with sequence similarity 149 member A [Source:Xenbase;Acc:XB-GENE-6050471])

HSP 1 Score: 318.161 bits (814), Expect = 7.910e-98
Identity = 232/466 (49.79%), Postives = 294/466 (63.09%), Query Frame = 3
Query:    3 NFYIYIFTKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNL-----DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNG-------------GLENDTSSYNKNMSLPY----------------------KTSDENIFLXXXXXXXXXXXXXXXDKIVSNSV--KEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDK---HLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            N  +  + KN  +       F  T  EL+ +M+ RG + I  I +   ++NGL   +  S   G+S   A    RR+IYG N IPPK  K+F+ LVWEA QD+TL+IL +AAI+SL LS Y    E +  N+     DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F VIR+G + QIPV E++VGD+ QIKYGDLLPADG++IQ NDL++DESSLTGESDHV+K    D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL                LE+D S YNK MS  +                      K  D  + ++     + E   ++E +    SV  KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF V+ + W T+    +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:    5 NSSVDFYQKNQRREQNHAGGFGCTLQELRSLMELRGSEAIQKIQDSYGDVNGLCRRLKTSPTEGLSENIADFEKRRQIYGVNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYAPPGEQNCGNVSGGGHDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFSVIRNGQVVQIPVAELIVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGNSLEHD-SFYNK-MSFFFNLFQSQLVPQQDGAVETNQNKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIQTFVVDGKVWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 468          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ugdh (UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB-GENE-950970])

HSP 1 Score: 315.079 bits (806), Expect = 4.934e-97
Identity = 231/431 (53.60%), Postives = 290/431 (67.29%), Query Frame = 3
Query:   24 TKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSIC-----SSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELN-------LDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLL--NGGLENDTSSYNKNMSLPYKTSDE-NIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            + NI     +   F  T  +L+E+M+ R  + +    NR+++  G + +IC     S + G+S   + L  RR+I+GKN IPPK AK+F+ LVWEA QD+TL+IL +AAIISL LS Y      +EL         DE E +AGWIEG AIL +V++VV VTAFNDW KE+QFRGLQ++I+ E  F VIR G + QIPV E+VVGD+ QIKYGDLLPADGI+IQ NDL++DESSLTGESD VKK    D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  N G E +  S   N  L  K  D   + ++   +        KE K+V    KEKSVLQ KLT+LA+QIG  G I+S ITV+IL+L FVI+TF V  +PW    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   10 SANIVNEGSYEGDFGCTIMDLRELMELRSAEAV----NRIRDTYGGVHNICRRLKTSPVEGLSGNPSDLERRRQIFGKNFIPPKKAKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGGDNELCGEAAAGVEDEGEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAELVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVKKSLEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGANEGGEEEKKSKKGNNPLHTKAQDGVALEIQPLKSEEGVECEEKEKKVVKVPKKEKSVLQGKLTRLAVQIGKAGLIMSAITVIILVLYFVIYTFGVLGRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 436          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ugdh (UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB-GENE-950970])

HSP 1 Score: 315.464 bits (807), Expect = 7.114e-97
Identity = 231/431 (53.60%), Postives = 290/431 (67.29%), Query Frame = 3
Query:   24 TKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSIC-----SSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELN-------LDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLL--NGGLENDTSSYNKNMSLPYKTSDE-NIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            + NI     +   F  T  +L+E+M+ R  + +    NR+++  G + +IC     S + G+S   + L  RR+I+GKN IPPK AK+F+ LVWEA QD+TL+IL +AAIISL LS Y      +EL         DE E +AGWIEG AIL +V++VV VTAFNDW KE+QFRGLQ++I+ E  F VIR G + QIPV E+VVGD+ QIKYGDLLPADGI+IQ NDL++DESSLTGESD VKK    D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  N G E +  S   N  L  K  D   + ++   +        KE K+V    KEKSVLQ KLT+LA+QIG  G I+S ITV+IL+L FVI+TF V  +PW    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   10 SANIVNEGSYEGDFGCTIMDLRELMELRSAEAV----NRIRDTYGGVHNICRRLKTSPVEGLSGNPSDLERRRQIFGKNFIPPKKAKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGGDNELCGEAAAGVEDEGEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAELVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVKKSLEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGANEGGEEEKKSKKGNNPLHTKAQDGVALEIQPLKSEEGVECEEKEKKVVKVPKKEKSVLQGKLTRLAVQIGKAGLIMSAITVIILVLYFVIYTFGVLGRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 436          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b2 (ATPase, Ca++ transporting, plasma membrane 2 [Source:MGI Symbol;Acc:MGI:105368])

HSP 1 Score: 315.464 bits (807), Expect = 4.172e-97
Identity = 218/430 (50.70%), Postives = 280/430 (65.12%), Query Frame = 3
Query:   18 IFTKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSIC-----SSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNL-------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDK---HLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
             ++KN    +     F  T  EL+ +M+ RG + +     ++K   G  ++IC     S + G+      L  R++I+G+N IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y    ES+E          DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R G + QIPV EIVVGD+ QIKYGDLLPADG+ IQ NDL++DESSLTGESD V+K  + D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G         +      K  D    ++     + E  +  + K  +   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L F + TF V ++PW T+    +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:    9 FYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVV----KIKETYGDTEAICRRLKTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESSLTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAG-----GEEEEKKDKKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 429          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b2 (ATPase, Ca++ transporting, plasma membrane 2 [Source:MGI Symbol;Acc:MGI:105368])

HSP 1 Score: 314.309 bits (804), Expect = 1.529e-96
Identity = 218/430 (50.70%), Postives = 280/430 (65.12%), Query Frame = 3
Query:   18 IFTKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSIC-----SSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNL-------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDK---HLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
             ++KN    +     F  T  EL+ +M+ RG + +     ++K   G  ++IC     S + G+      L  R++I+G+N IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y    ES+E          DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R G + QIPV EIVVGD+ QIKYGDLLPADG+ IQ NDL++DESSLTGESD V+K  + D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G         +      K  D    ++     + E  +  + K  +   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L F + TF V ++PW T+    +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:    9 FYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVV----KIKETYGDTEAICRRLKTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESSLTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAG-----GEEEEKKDKKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 429          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b2 (ATPase, Ca++ transporting, plasma membrane 2 [Source:MGI Symbol;Acc:MGI:105368])

HSP 1 Score: 314.309 bits (804), Expect = 1.532e-96
Identity = 218/430 (50.70%), Postives = 280/430 (65.12%), Query Frame = 3
Query:   18 IFTKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSIC-----SSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNL-------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDK---HLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
             ++KN    +     F  T  EL+ +M+ RG + +     ++K   G  ++IC     S + G+      L  R++I+G+N IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y    ES+E          DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R G + QIPV EIVVGD+ QIKYGDLLPADG+ IQ NDL++DESSLTGESD V+K  + D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G         +      K  D    ++     + E  +  + K  +   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L F + TF V ++PW T+    +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:    9 FYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVV----KIKETYGDTEAICRRLKTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESSLTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAG-----GEEEEKKDKKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 429          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b2 (ATPase, Ca++ transporting, plasma membrane 2 [Source:MGI Symbol;Acc:MGI:105368])

HSP 1 Score: 314.309 bits (804), Expect = 1.532e-96
Identity = 218/430 (50.70%), Postives = 280/430 (65.12%), Query Frame = 3
Query:   18 IFTKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSIC-----SSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNL-------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDK---HLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
             ++KN    +     F  T  EL+ +M+ RG + +     ++K   G  ++IC     S + G+      L  R++I+G+N IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y    ES+E          DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R G + QIPV EIVVGD+ QIKYGDLLPADG+ IQ NDL++DESSLTGESD V+K  + D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G         +      K  D    ++     + E  +  + K  +   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L F + TF V ++PW T+    +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:    9 FYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVV----KIKETYGDTEAICRRLKTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESSLTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAG-----GEEEEKKDKKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 429          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b3 (ATPase, Ca++ transporting, plasma membrane 3 [Source:MGI Symbol;Acc:MGI:1347353])

HSP 1 Score: 308.531 bits (789), Expect = 1.352e-94
Identity = 216/422 (51.18%), Postives = 275/422 (65.17%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHEL--NL-----DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNG----------GLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSN-SVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F  T  EL+ +M+ RG + +  I     +++GL   +  S   G++     L  RR+IYG+N IPPK  K+F+ LVWEA QD+TL+IL VAAI+SL LS Y    E  E   N+     DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F VIR+G L Q+PV  +VVGD+ Q+KYGDLLPADG++IQ NDL++DESSLTGESDHV+K  + D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL              +    + + + +   K             S       + +K  +N   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF V+ + W    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   27 FGCTLAELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMDSSQTRAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 448          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q9R0K7|AT2B2_MOUSE (Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp2b2 PE=1 SV=2)

HSP 1 Score: 314.309 bits (804), Expect = 1.072e-95
Identity = 218/430 (50.70%), Postives = 280/430 (65.12%), Query Frame = 3
Query:   18 IFTKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSIC-----SSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNL-------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDK---HLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
             ++KN    +     F  T  EL+ +M+ RG + +     ++K   G  ++IC     S + G+      L  R++I+G+N IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y    ES+E          DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R G + QIPV EIVVGD+ QIKYGDLLPADG+ IQ NDL++DESSLTGESD V+K  + D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G         +      K  D    ++     + E  +  + K  +   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L F + TF V ++PW T+    +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:    9 FYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVV----KIKETYGDTEAICRRLKTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESSLTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAG-----GEEEEKKDKKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 429          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P23634|AT2B4_HUMAN (Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens OX=9606 GN=ATP2B4 PE=1 SV=2)

HSP 1 Score: 312.768 bits (800), Expect = 8.037e-95
Identity = 224/419 (53.46%), Postives = 279/419 (66.59%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELN-------LDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLL--NGGLENDTSSYNKNMSLP-----YKTSDENIFLXXXXXXXXXXXXXXXD-KIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F  T  EL+++M+ R  D +  I      +  L   +  S + G+S   A L  RR+++G N IPPK  K+F+ LVWEA QD+TL+IL +AAIISLVLS Y    E +EL         DE E +AGWIEG AIL +V++VV VTAFNDW KE+QFRGLQ +I+ E  F +IR+G L Q+PV EIVVGD+ Q+KYGDLLPADGI+IQ NDL++DESSLTGESDHVKK  + D MLLSGTHVMEGSG+MVV AVG  SQ+GII TLL  N   E +     K   +P      KT D         NS    +N ++D K V    KEKSVLQ KLT+LA+QIG  G ++S +TV ILIL FVI  F + R+PW    T  +++  +   IIG+TVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   22 FGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPAGEENELCGQVATTPEDENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQCRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIILTLLGVNEDDEGEKKKKGKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKSVLQGKLTRLAVQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVAVPEGLPLAVTISLAYSVKKM 440          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q16720|AT2B3_HUMAN (Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens OX=9606 GN=ATP2B3 PE=1 SV=3)

HSP 1 Score: 311.612 bits (797), Expect = 1.618e-94
Identity = 220/434 (50.69%), Postives = 280/434 (64.52%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHEL--NL-----DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNG-----------------GLENDTSSYNKN-----MSL-PYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F  T  EL+ +M+ RG + +  I     +++GL   +  S   G++     L  RR+IYG+N IPPK  K+F+ LVWEA QD+TL+IL VAAI+SL LS Y    E  E   N+     DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F VIR+G L Q+PV  +VVGD+ Q+KYGDLLPADG++IQ+NDL++DESSLTGESDHV+K  + D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL                    +E+  +   K      M + P K+++                  +E K  +   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF VE + W    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGG------------EMEEREKKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 448          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q98SH2|AT2B1_CHICK (Plasma membrane calcium-transporting ATPase 1 OS=Gallus gallus OX=9031 GN=ATP2B1 PE=2 SV=2)

HSP 1 Score: 309.686 bits (792), Expect = 5.593e-94
Identity = 217/411 (52.80%), Postives = 279/411 (67.88%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GISSQEAPLRRK--IYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYM------KVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSN-SVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F +T  EL+ +M+ R  D +H I     ++ G+   + +S N G+S   A + R+  ++GKN IPPK  K+F+ LVWEA QD+TL+IL +AA++SL LS Y        +  S  +  +E E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F VIR G + QIPV +I+VGD+ Q+KYGDLLPADGI+IQ NDL++DESSLTGESDHVKK  + D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G  ++     +      K  D          S    +  ++DK  SN   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI T  V+++PW    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   26 FGVTLAELRSLMELRATDALHKIQECYGDVQGICTKLKTSPNEGLSGNPADIERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAVVSLGLSFYQPPGGNEALCGSVNVGEEEEESEAGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRGGQVIQIPVADIIVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDRDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAG-GDEEEKEKEKKDKKTKAQDGAAMEMQPLKSEDGVDGDEKDKKRSNLPKKEKSVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTSWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 435          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|D3K0R6|AT2B4_BOVIN (Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus OX=9913 GN=ATP2B4 PE=1 SV=2)

HSP 1 Score: 309.301 bits (791), Expect = 1.059e-93
Identity = 227/427 (53.16%), Postives = 287/427 (67.21%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNIN-GLLDSICS-----SINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVT-ESHELNL------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSY----------NKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSN-SVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F  T  +L+++M+ R  D I  I     N++ G + ++CS      + G+S   A L  R++++G+N IPPK  K+F+ LVWEA QD+TL+IL +AAIISLVLS Y     E+ +  L      DE E EAGWIEG AIL +V++VV VTAFNDW KE+QFRGLQN+I+ E  F VIR+G + Q+PV EIVVGD+ QIKYGDLLPADGI+IQ NDL++DESSLTGESDHVKK    D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL      +              N+N +   KT D         NS    ++ +++K  +    KEKSVLQ KLT+LA+QIG  G I+S ITVLILIL FVI  F ++R+PW    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   22 FGCTVMDLRKLMELRSSDAIDQI-----NVHYGGVMNLCSRLKTNPVEGLSGNPADLEKRKQVFGQNLIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPPGGENEQCGLAVTSPEDEGEAEAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQNRIEKEQKFSVIRNGHIIQLPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLERDPMLLSGTHVMEGSGRMVVTAVGINSQTGIIFTLLGASEGEEEEKKKKGKKQGVPENRNKA---KTQDGVALEIQPLNSQEGIDSEEKEKKAAKLPKKEKSVLQGKLTRLAVQIGKAGLIMSAITVLILILYFVIDNFVIQRRPWLAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 440          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A3R7CLD8 (Plasma membrane calcium-transporting ATPase 3 (Fragment) OS=Clonorchis sinensis OX=79923 GN=ATP2B3 PE=3 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.364e-108
Identity = 221/414 (53.38%), Postives = 290/414 (70.05%), Query Frame = 3
Query:   54 NSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVS------------NSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            ++ F +  ++L+ +M HR  D + ++ +R   ++GL  S+  S  +G++  +   R++ Y  N I  +  K+F  LV  A QDLTL++LIVAA+ISL LSLY+K  ++     DE+EG+AGWIEGVAIL AV+VVV V A ND+QKE+QFRGLQNKI++E  F VIR G  +QIPVQEI+VGDVCQ+KYGDLLPADGIIIQ NDL+VDESSLTGESD V+K E  D +LLSGTH+MEGSGKMVV AVGP SQ GIIF LL+    +D      +        D N    +  ++   + ++  DK +             +  KE+SVLQ KLTKLAIQIGY+GT +++ TVLIL++KF + TFA  ++PW+T KHLK+I+  +I GVTVLVVAVPEGLPLAVTL+LAYSVK+M
Sbjct:   14 STAFDVDVDDLRHLMAHRKEDVVKLLRDRFGGLSGLCRSLKTSPTDGLTEDDFSKRKEKYNVNVIAKQRPKTFCELVGAALQDLTLIVLIVAAVISLALSLYLKYGQA--TTFDESEGQAGWIEGVAILIAVVVVVLVVALNDYQKEKQFRGLQNKIESEHTFFVIRKGETKQIPVQEILVGDVCQVKYGDLLPADGIIIQCNDLKVDESSLTGESDQVRKSETKDPVLLSGTHIMEGSGKMVVTAVGPNSQVGIIFGLLSNPQGDDAQGGKGDKKGKKDKKDTNATKSNDKSAPTLDGSVPADKAIGANKGEKAAKPTKSRRKEQSVLQAKLTKLAIQIGYVGTCVAVATVLILVIKFAVITFAQNKEPWQTGKHLKQIVNYVITGVTVLVVAVPEGLPLAVTLSLAYSVKRM 425          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A5K3EPV4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 1.447e-108
Identity = 233/409 (56.97%), Postives = 289/409 (70.66%), Query Frame = 3
Query:   57 SPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSI-NGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTE--SHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXD------KIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            S F +T  ELQ +M+ RG  G+  +  R   I  L   + +S  +G+S  +   RR+ +G N IPPKP K F TLVWEA QD+TL+ILI AA +SL LSLY K  +  SH    DETEGEAGWIEGVAIL AV+VVV V AFNDW KERQFRGLQNKI+++  F VIR G L Q+P+ +I+VGDVCQIKYGDLLPADGI+IQSNDL+VDES+LTGESD VKKGE+ D+ L SGTHV+EGSG++V+ AVG  SQ+GIIF+LL    E          + P + S +   L+    +        E       K  S S KEKSVLQTKLTKLAIQIGY GT +++ITV+IL++KF + TF  +++PW T KHLK+++  +I GVTVLVVAVPEGLPLAVTL+LAYSV+KM
Sbjct:   17 SSFEITITELQRLMEMRGASGVKFLKERYGGIQELCKKLKTSTHDGLSGSDFQERRETFGTNVIPPKPPKRFCTLVWEAMQDVTLIILIAAAFVSLGLSLYTKYVDLASH----DETEGEAGWIEGVAILVAVIVVVLVVAFNDWSKERQFRGLQNKIESDHKFAVIRQGQLVQLPIADILVGDVCQIKYGDLLPADGILIQSNDLKVDESALTGESDQVKKGESKDICLFSGTHVVEGSGRIVITAVGVNSQAGIIFSLLGATDEEAERKKKDKKAEPARDSKKKRELEKIPEAVALKTTDSEQGGEEKKKKKSKSRKEKSVLQTKLTKLAIQIGYAGTAVAVITVIILVIKFTVTTFVYDKEPWNTGKHLKRLVGFIITGVTVLVVAVPEGLPLAVTLSLAYSVRKM 421          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A5K3END5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 2.928e-108
Identity = 233/409 (56.97%), Postives = 289/409 (70.66%), Query Frame = 3
Query:   57 SPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSI-NGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTE--SHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXD------KIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            S F +T  ELQ +M+ RG  G+  +  R   I  L   + +S  +G+S  +   RR+ +G N IPPKP K F TLVWEA QD+TL+ILI AA +SL LSLY K  +  SH    DETEGEAGWIEGVAIL AV+VVV V AFNDW KERQFRGLQNKI+++  F VIR G L Q+P+ +I+VGDVCQIKYGDLLPADGI+IQSNDL+VDES+LTGESD VKKGE+ D+ L SGTHV+EGSG++V+ AVG  SQ+GIIF+LL    E          + P + S +   L+    +        E       K  S S KEKSVLQTKLTKLAIQIGY GT +++ITV+IL++KF + TF  +++PW T KHLK+++  +I GVTVLVVAVPEGLPLAVTL+LAYSV+KM
Sbjct:   17 SSFEITITELQRLMEMRGASGVKFLKERYGGIQELCKKLKTSTHDGLSGSDFQERRETFGTNVIPPKPPKRFCTLVWEAMQDVTLIILIAAAFVSLGLSLYTKYVDLASH----DETEGEAGWIEGVAILVAVIVVVLVVAFNDWSKERQFRGLQNKIESDHKFAVIRQGQLVQLPIADILVGDVCQIKYGDLLPADGILIQSNDLKVDESALTGESDQVKKGESKDICLFSGTHVVEGSGRIVITAVGVNSQAGIIFSLLGATDEEAERKKKDKKAEPARDSKKKRELEKIPEAVALKTTDSEQGGEEKKKKKSKSRKEKSVLQTKLTKLAIQIGYAGTAVAVITVIILVIKFTVTTFVYDKEPWNTGKHLKRLVGFIITGVTVLVVAVPEGLPLAVTLSLAYSVRKM 421          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A5K4F6A7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 2.623e-106
Identity = 224/418 (53.59%), Postives = 287/418 (68.66%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSI-NGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNM-------------------SLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F ++  ELQ++M  R ++ +  +  +   + GL   + +S  +G+  ++   R   +G N IP + AK+F+ L+WEA QDLTL++LIVAA ISL LSLY+K  ++     DE+EG+AGWIEG+AIL AV VVVFV A NDWQKERQFRGLQNKI++E  F VIR G  +QIPV+EIVVGDVCQ+KYGDLLPADGI+IQ NDL++DESSLTGESD V+K E  D +LLSGTHVMEGSGKMVV AVGP SQ+GIIF LL+ G  ++     +                      +P   SD       +   +  +             KE+SVLQ KLTKLAIQIGY+GT +++ TVLILI+KF +HTFA  ++PW+T KHLK+I+  +I GVTVLVVAVPEGLPLAVTL+LAYSVK+M
Sbjct:   22 FEISPKELQKLMDCRKLEAVKYLNEKYGGVVGLCRLLKTSPQDGLHEEDFSKRINTFGANVIPQQRAKTFLRLMWEALQDLTLIVLIVAAFISLALSLYIKYGQAP--TFDESEGQAGWIEGLAILIAVFVVVFVVALNDWQKERQFRGLQNKIESEHTFFVIRKGDTKQIPVKEIVVGDVCQVKYGDLLPADGIVIQCNDLKIDESSLTGESDQVRKNETKDPILLSGTHVMEGSGKMVVTAVGPNSQAGIIFALLSSGSHDEHGGGGQEKKKEKSKTKKNGKKGNKNSDKVPSANSDAYQMKSKNKTKSESDAEQSSKPKKKPRRKEQSVLQAKLTKLAIQIGYVGTCVAIATVLILIIKFSVHTFAQNKEPWQTGKHLKQIVNYIITGVTVLVVAVPEGLPLAVTLSLAYSVKRM 437          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A5K4F7M1 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 5.018e-106
Identity = 224/418 (53.59%), Postives = 287/418 (68.66%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSI-NGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNM-------------------SLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F ++  ELQ++M  R ++ +  +  +   + GL   + +S  +G+  ++   R   +G N IP + AK+F+ L+WEA QDLTL++LIVAA ISL LSLY+K  ++     DE+EG+AGWIEG+AIL AV VVVFV A NDWQKERQFRGLQNKI++E  F VIR G  +QIPV+EIVVGDVCQ+KYGDLLPADGI+IQ NDL++DESSLTGESD V+K E  D +LLSGTHVMEGSGKMVV AVGP SQ+GIIF LL+ G  ++     +                      +P   SD       +   +  +             KE+SVLQ KLTKLAIQIGY+GT +++ TVLILI+KF +HTFA  ++PW+T KHLK+I+  +I GVTVLVVAVPEGLPLAVTL+LAYSVK+M
Sbjct:   22 FEISPKELQKLMDCRKLEAVKYLNEKYGGVVGLCRLLKTSPQDGLHEEDFSKRINTFGANVIPQQRAKTFLRLMWEALQDLTLIVLIVAAFISLALSLYIKYGQAP--TFDESEGQAGWIEGLAILIAVFVVVFVVALNDWQKERQFRGLQNKIESEHTFFVIRKGDTKQIPVKEIVVGDVCQVKYGDLLPADGIVIQCNDLKIDESSLTGESDQVRKNETKDPILLSGTHVMEGSGKMVVTAVGPNSQAGIIFALLSSGSHDEHGGGGQEKKKEKSKTKKNGKKGNKNSDKVPSANSDAYQMKSKNKTKSESDAEQSSKPKKKPRRKEQSVLQAKLTKLAIQIGYVGTCVAIATVLILIIKFSVHTFAQNKEPWQTGKHLKQIVNYIITGVTVLVVAVPEGLPLAVTLSLAYSVKRM 437          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b3a (ATPase plasma membrane Ca2+ transporting 3a [Source:ZFIN;Acc:ZDB-GENE-040718-174])

HSP 1 Score: 320.087 bits (819), Expect = 1.644e-98
Identity = 225/430 (52.33%), Postives = 291/430 (67.67%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHEL--NL-----DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLL-----------------NGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSV--KEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDK---HLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F ++  EL+ +M+ RG + +  I     +  GL   +  S  +G+S   A L  R++++G+N IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y       E   N+     DE E EAGWIEG AIL +VL VV VTAFNDW KE+QFRGLQ++I+ E  F V+R+GT+ QIPV E+VVGDV Q+KYGDLLPADG++IQ NDL++DESSLTGESDHV+K  + D MLLSGTHVMEGSGKMVV AVG  SQ+GIIFTLL                 +G LEN     N+N +L     DE + ++     + E   ++E +   ++V  KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF ++ +PW T+    +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   27 FGVSLEELRTLMEFRGAESLQKIQESYGDTEGLCQRLKTSPTDGLSDDPADLEKRKEVFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYQPPGGDTEACGNVSSGVEDEGEAEAGWIEGAAILLSVLCVVIVTAFNDWSKEKQFRGLQSRIEQEQRFAVVRNGTVLQIPVAEMVVGDVAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKAVDRDPMLLSGTHVMEGSGKMVVTAVGINSQTGIIFTLLGAGEMEEEKKENKKGKQDGALEN-----NQNKAL---KQDEAVAMEMQPLKSAEGGEVEEREKKKSNVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILMLYFVIETFVIQDRPWLTECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 448          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: ENSAMXT00000014864.2 (pep primary_assembly:Astyanax_mexicanus-2.0:7:35306831:35359735:-1 gene:ENSAMXG00000014383.2 transcript:ENSAMXT00000014864.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 312.768 bits (800), Expect = 5.949e-96
Identity = 220/419 (52.51%), Postives = 281/419 (67.06%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPLRRK--IYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNL--------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG------LENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSN-SVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWK---TDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F  +  EL+ +M+ RG +GI  I     ++NGL   +  S ++G+S Q A L ++  ++G+N IPPK  K+F+ LVWEA QD+TL+IL VAAI+SL LS Y +  E+   N         DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R G + QIPV EIVVGD+ QIKYGDLLPADG++IQ NDL++DESSLTGESDHVKK    D MLLSGTHVMEGSGKM+V A+G  SQ+GIIFTLL  G       E +     K      KT  ++           +     E+K  +N   KEKSVLQ KLTKLA+QIG  G ++S ITV+ILI+ F+++TF V+   W+   T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   25 FGCSLKELRGLMELRGTEGIRKIQETYADVNGLCSRLKTSPVDGLSGQPADLEKRTIVFGQNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFY-RPPEADSTNCGEGTGGVEDEGESEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQVIQIPVAEIVVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTLEKDPMLLSGTHVMEGSGKMLVTAIGVNSQTGIIFTLLGAGGEDDEDEEKEEKKKEKERKKEKKTKAQDGAAMEMQPLNSDEGADAEEKRKANLPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILIVLFIVNTFWVQGLAWEKSCTPIYIQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 442          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b1b (plasma membrane calcium-transporting ATPase 1-like [Source:NCBI gene;Acc:103045095])

HSP 1 Score: 308.916 bits (790), Expect = 1.973e-94
Identity = 218/428 (50.93%), Postives = 278/428 (64.95%), Query Frame = 3
Query:   54 NSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GIS--SQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNL--------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNS-------------VKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDK---HLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            ++ F  T  EL+ +M+ RG +G+  I     ++ GL   + SS   G+S  S +   R+ +YGKN IPPK  K+F+ LVWEA QD+TL+IL VAAIISL LS Y +  ++   N         DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R G + QIPV E+VVGD+ Q+KYGDLLPADG++IQ NDL++DESSLTGESDHVKK  + D MLLSGTHVMEGSGKM+V AVG  SQ+GIIFTLL  G E+  +   K      K   E    +       +   +  + + S                KEKSVLQ KLTKLA+QIG  G  +S ITV+IL++ F++ TF V+  PW  D    +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   21 DAEFGCTLKELRSLMELRGPEGLQRIQECYGDVQGLCSRLKSSCTEGLSGHSDDIANRKDVYGKNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIISLGLSFY-RPPDAERENCGKAAGGVEDEGEAEAGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQIIQIPVAELVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTMDKDPMLLSGTHVMEGSGKMLVTAVGVNSQTGIIFTLLGAGDEDGDNEDEKEEKDRKKREKEEKKKEKERKKKEKKGGVDTEPLSSEDGIDGDVKKKTNLPKKEKSVLQGKLTKLAVQIGKAGLFMSAITVIILVVLFLVDTFWVQGLPWIKDCTPVYIQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 447          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b4 (ATPase plasma membrane Ca2+ transporting 4 [Source:NCBI gene;Acc:103040534])

HSP 1 Score: 301.982 bits (772), Expect = 4.451e-92
Identity = 222/423 (52.48%), Postives = 281/423 (66.43%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSIC-----SSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYM-KVTESHELNL------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG-----LENDTSSYNKNMSL---PYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWK---TDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F  T  +L+E+M+ R  + +    N++++ +G +  IC     S I G+S   + L  R   +GKN IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y  +  +S+          DE E +AGWIEG AIL +V++VV VTAFNDW KE+QFRGLQ++I+ E  F VIR G + QI V EIVVGD+ QIKYGDLLPADGI+IQ NDL++DESSLTGESD V+K    D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G      +   +     ++L   P K+        +      E    KE K V+ + KEKSVLQ KLT+LA+QIG  G I+S +TV+ILIL FVI TF V +Q WK   T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   23 FGCTVMDLRELMELRSAEAV----NKIRDTHGDVQGICRRLKTSPIEGLSGNPSDLEKRHTAFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPQGGDSNACGQAVGGVEDEGESQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQISVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVRKSLEKDPMLLSGTHVMEGSGRMVVTAVGLNSQTGIIFTLLGAGGEEEEKKVKKAKTQDGIALEIQPLKSD-----EGAEAEEKEEKEPQKEVKKVNVTKKEKSVLQGKLTRLAVQIGKAGLIMSAVTVIILILYFVISTFGVNKQEWKAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 436          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b4 (ATPase plasma membrane Ca2+ transporting 4 [Source:NCBI gene;Acc:103040534])

HSP 1 Score: 298.13 bits (762), Expect = 9.024e-91
Identity = 225/434 (51.84%), Postives = 283/434 (65.21%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSIC-----SSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYM-KVTESHELNL------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNG----------GLENDTSSYNKNMSLPYKTSDENIFL---------XXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWK---TDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F  T  +L+E+M+ R  + +    N++++ +G +  IC     S I G+S   + L  R   +GKN IPPK  K+F+ LVWEA QD+TL+IL +AAIISL LS Y  +  +S+          DE E +AGWIEG AIL +V++VV VTAFNDW KE+QFRGLQ++I+ E  F VIR G + QI V EIVVGD+ QIKYGDLLPADGI+IQ NDL++DESSLTGESD V+K    D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL              +   +  N+N +   KT D  I L          +      E    KE K V+ + KEKSVLQ KLT+LA+QIG  G I+S +TV+ILIL FVI TF V +Q WK   T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   23 FGCTVMDLRELMELRSAEAV----NKIRDTHGDVQGICRRLKTSPIEGLSGNPSDLEKRHTAFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPQGGDSNACGQAVGGVEDEGESQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQISVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVRKSLEKDPMLLSGTHVMEGSGRMVVTAVGLNSQTGIIFTLLGAGGEEEEKKVKKGKKQGAPENRNKA---KTQD-GIALEIQPLKSDEGAEAEEKEEKEPQKEVKKVNVTKKEKSVLQGKLTRLAVQIGKAGLIMSAVTVIILILYFVISTFGVNKQEWKAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 448          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002775.1 (pep scaffold:Pmarinus_7.0:GL486089:3809:7949:1 gene:ENSPMAG00000002528.1 transcript:ENSPMAT00000002775.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 217.238 bits (552), Expect = 5.512e-69
Identity = 134/213 (62.91%), Postives = 161/213 (75.59%), Query Frame = 3
Query:  216 RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVT-ESHEL------NLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLN 833
            RRK +G+N IPPK  KSF+ LVW A QD+TL+IL VAA++SL LS Y     E+ EL      +++E   + GWIEG AIL  V+VVV VTAFNDW KERQFRGLQ++I+ E  F VIR G L ++ V E+VVGDV Q+KYGDLLPADG+++Q N+L VDESSLTGESDH+ K  + D MLLSGTHVMEGSG+MVV AVG  SQSGIIFTLL 
Sbjct:   12 RRKTFGRNHIPPKKPKSFVALVWHALQDVTLIILEVAAVVSLGLSFYRPPEGENTELCGQSSGSIEEAGSDTGWIEGTAILLTVVVVVLVTAFNDWSKERQFRGLQSRIEQEQKFSVIRGGQLVEVHVAELVVGDVAQVKYGDLLPADGVLLQGNELSVDESSLTGESDHLSKSPDCDPMLLSGTHVMEGSGRMVVTAVGINSQSGIIFTLLG 224          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001468.1 (pep scaffold:Pmarinus_7.0:GL477283:10882:33618:1 gene:ENSPMAG00000001326.1 transcript:ENSPMAT00000001468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.593 bits (501), Expect = 4.584e-61
Identity = 127/238 (53.36%), Postives = 165/238 (69.33%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHEL-------NLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSG 746
            F L+ +EL+ +M+ RG + I M+        G+   + +S N G+    A L  RR ++G+N IPPK  K+F+ LVWEA QD+TL+IL +AAI+SL LS Y    ++ ++         DE E  AGWIEG AIL +V  VV VTAFNDW KERQFRGLQ++I+ E  F VIR G L Q+PV +IVVGD+ Q+KYGDLLPADG++IQSNDL++DESSLTGESDHV+K  + D MLLSG
Sbjct:   26 FGLSVDELRALMELRGPEAIAMVQEAYGGKEGVCRRLHTSPNDGLPGTAADLEKRRLVFGQNFIPPKKPKTFLELVWEALQDVTLIILEIAAIVSLGLSFYQPPGQNSDMCGSVSGGAEDEGESAAGWIEGAAILLSVACVVLVTAFNDWSKERQFRGLQSRIEQEQRFSVIRGGQLLQLPVADIVVGDIAQVKYGDLLPADGMLIQSNDLKIDESSLTGESDHVRKSIDRDPMLLSG 263          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010087.1 (pep scaffold:Pmarinus_7.0:GL482626:10460:17067:1 gene:ENSPMAG00000009128.1 transcript:ENSPMAT00000010087.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 3.219e-59
Identity = 133/239 (55.65%), Postives = 168/239 (70.29%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHE--------LNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSG 746
            F  +  EL+ +M+ RG   +H I  +  ++ GL   +  S  +G+S   + L  RR+ +G+N IPP+ AKSF+ LVWEA QD+TL+IL +AAI+SL LS Y    ES +           D+ E EAGWIEGVAIL +V VVV VTAFNDW KERQFRGLQN+I+ E  F V+R+G + QIPV EI VGDV Q+KYGDLLPADG++IQSNDL++DESSLTGESDHVKK  + D MLLSG
Sbjct:   22 FGCSLMELRSLMELRGETALHDIQQKYTDVPGLCRRLKTSPTDGLSDSVSDLERRRQAFGRNVIPPQKAKSFLELVWEALQDVTLIILEIAAIVSLGLSFYRPPEESSDECGMLAGGGGGDDGEAEAGWIEGVAILFSVAVVVLVTAFNDWSKERQFRGLQNRIEQEQKFAVVRNGQVVQIPVAEISVGDVAQVKYGDLLPADGVLIQSNDLKIDESSLTGESDHVKKSADRDPMLLSG 260          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007912.1 (pep scaffold:Pmarinus_7.0:GL490738:3481:17315:-1 gene:ENSPMAG00000007146.1 transcript:ENSPMAT00000007912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 2.818e-20
Identity = 61/94 (64.89%), Postives = 73/94 (77.66%), Query Frame = 3
Query:  984 KEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI TF V+  PW    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   36 KEKSVLQGKLTKLAVQIGKAGLVMSAITVVILVLYFVIETFWVQGMPWLPECTPIYVQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 129          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009058.1 (pep scaffold:Pmarinus_7.0:GL480374:1:11062:-1 gene:ENSPMAG00000008154.1 transcript:ENSPMAT00000009058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 5.710e-11
Identity = 39/107 (36.45%), Postives = 61/107 (57.01%), Query Frame = 3
Query:  543 VIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESD---------HVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNG 836
            VIR+G   Q+  + +V+GD+ +IK GD +PAD  I+ S+  +VD SSLTGES+         H    E  ++   S T+ +EG+ + +V+  G  +  G I TL +G
Sbjct:  169 VIREGEKTQLNAELVVLGDLVEIKGGDRIPADLRIVSSHGCKVDNSSLTGESEPQSRSPDFTHDNPLETRNIAFFS-TNCVEGTARGIVINTGDHTVMGRIATLASG 274          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMC1 (Vacuolar Ca2+ ATPase involved in depleting cytosol of Ca2+ ions; prevents growth inhibition by activation of calcineurin in the presence of elevated concentrations of calcium; similar to mammalian PMCA1a [Source:SGD;Acc:S000002974])

HSP 1 Score: 112.464 bits (280), Expect = 4.134e-27
Identity = 128/396 (32.32%), Postives = 187/396 (47.22%), Query Frame = 3
Query:  180 SINGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETE-GEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKK---------------------------------GENI-DVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLK--KIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            S+  IS+     R K YG NS+P +  KSF+ LVW A  D T+ +L VAA++S VL LY    +  + + +  +  +  WIEGVAI+ AV VVV V+A ND+QKE QF  L NK +      VIR+     I +  ++VGDV  ++ GD++PAD ++I S     DESS+TGES+ ++K                                 G  I D ML+SG+ ++ G G+ V+ +VG  S  G   T LN                                                   E + LQ  L++LA  I   G + ++I  L+L  +++ +    + +    D   K  K +   I  +TV+VVAVPEGLPLAVTLALA++  +M
Sbjct:   75 SLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKL-NKKKENRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMI-SGKCEADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNAE------------------------------------------------PESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRM 420          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMA1 (Plasma membrane P2-type H+-ATPase; pumps protons out of cell; major regulator of cytoplasmic pH and plasma membrane potential; long-lived protein asymmetrically distributed at plasma membrane between mother cells and buds; accumulates at high levels in mother cells during aging, buds emerge with very low levels of Pma1p, newborn cells have low levels of Pma1p; Hsp30p plays a role in Pma1p regulation; interactions with Std1p appear to propagate [GAR+] [Source:SGD;Acc:S000002976])

HSP 1 Score: 63.1586 bits (152), Expect = 3.304e-11
Identity = 39/98 (39.80%), Postives = 57/98 (58.16%), Query Frame = 3
Query:  543 VIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADG-IIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLN 833
            VIRDG L +IP  E+V GD+ Q++ G ++P DG I+ +   L++D+S++TGES  V K  +      S + V  G G MVV A G  +  G    L+N
Sbjct:  182 VIRDGQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAVDK--HYGDQTFSSSTVKRGEGFMVVTATGDNTFVGRAAALVN 277          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMR1 (High affinity Ca2+/Mn2+ P-type ATPase; required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting, processing; D53A mutant (Mn2+ transporting) is rapamycin sensitive, Q783A mutant (Ca2+ transporting) is rapamycin resistant; Mn2+ transport into Golgi lumen required for rapamycin sensitivity; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease; human ATP2C1 can complement yeast null mutant [Source:SGD;Acc:S000003135])

HSP 1 Score: 61.6178 bits (148), Expect = 1.081e-10
Identity = 39/138 (28.26%), Postives = 63/138 (45.65%), Query Frame = 3
Query:  477 DWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENI-------------------DVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLN 833
            +++ E+    L   +  E    ++R G    +    +V GD+   + GD +PAD  II++ DL +DES+LTGE++ V K                         +   GT V EG GK +VV  G  +  G +F ++N
Sbjct:  135 EYRSEKSLEALNKLVPAEC--HLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMN 270          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA1 (P-type ATPase sodium pump; involved in Na+ and Li+ efflux to allow salt tolerance [Source:SGD;Acc:S000002447])

HSP 1 Score: 61.2326 bits (147), Expect = 1.526e-10
Identity = 46/154 (29.87%), Postives = 74/154 (48.05%), Query Frame = 3
Query:  414 WIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDV-------------MLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNG 836
            WI G  I   + V V +    +++  +    L+N   +  N  VIR+G  + I  +++V GD+C +K GD +PAD  +I++ +   DES LTGES  V K  N+               +  S + V++G  K +V+     S+ G I   L G
Sbjct:   91 WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKN--LSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQG 242          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 61.2326 bits (147), Expect = 1.680e-10
Identity = 46/154 (29.87%), Postives = 74/154 (48.05%), Query Frame = 3
Query:  414 WIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDV-------------MLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNG 836
            WI G  I   + V V +    +++  +    L+N   +  N  VIR+G  + I  +++V GD+C +K GD +PAD  +I++ +   DES LTGES  V K  N+               +  S + V++G  K +V+     S+ G I   L G
Sbjct:   91 WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKN--LSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQG 242          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO41775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I0])

HSP 1 Score: 273.092 bits (697), Expect = 2.596e-82
Identity = 183/401 (45.64%), Postives = 260/401 (64.84%), Query Frame = 3
Query:   69 LTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSI-NGISS--QEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLEN--DTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            ++  +L+++MK RG++    + +    ++GL+  + +S   GIS   ++   R++++G N IPPKP K+F    WE   D      ++   ++ V+SL + +    E     +E   GWI+G AIL AV +V  VTA ND+QKE+QFRGLQ+KI+ E  F VIR+G  ++I   EIVVGD+CQIKYGDLLPADG+++QSNDL+VDESSLTGESD VKKGE  D + L+GTH+MEGSGKM+V AVG  SQSGIIFTLL     +  D+       S   K +  + F   + +   E++   +++      +EKSVLQ KLTKLA+ IG+ G   +L+T++++ L+F I  +  E+  W+ + HL   +   I G+TVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   30 ISVGDLKQLMKCRGLEAKDHLAS-TGGLHGLVRKLHTSTEKGISGFPEDIENRKRVFGPNVIPPKPPKTF----WEFLVDACKDTTLIILTVAAVVSLLLGIFAPEECG--GSEANTGWIDGFAILIAVCIVALVTAVNDYQKEQQFRGLQSKIELEHKFTVIRNGDAKEILNSEIVVGDLCQIKYGDLLPADGVVVQSNDLKVDESSLTGESDMVKKGEK-DPLFLAGTHIMEGSGKMIVTAVGLNSQSGIIFTLLGATHPDKIDSGDDAPPQSPAIKGAPGDDFEDVNLDDDQESSENGKER---KDKQEKSVLQAKLTKLAVTIGWFGVAAALLTIIVMALQFSIRKYVKEKASWQ-NTHLNAYVNAFITGLTVLVVAVPEGLPLAVTISLAYSVKKM 418          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO41774 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3H9])

HSP 1 Score: 131.724 bits (330), Expect = 4.325e-33
Identity = 122/382 (31.94%), Postives = 199/382 (52.09%), Query Frame = 3
Query:  150 INGLLDSICSSINGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRD-GTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQS------------GIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            I  L  S    + G +   A  RR++YG N +P    +S    +  + +D  L++L++ AIISLVL L    +    +N     GE  W EGV IL  V++++ ++A +D+ ++  FR  Q ++  E    VIRD G ++ I   E+VVGD+C +K G L+ ADG+++QS+DL VDE+  +    H      +D ++ +GTHV++G+GK +V+AVG  +Q+            GI       G  N+  S N    L +K   E                            E + L+ K+ ++A+ +GYIG  ++LIT++++++ F +  +    +P K +  +   +   I+G+ VLVV+VPEGLPLAVT ALA+  K M
Sbjct:   46 IRNLRTSAFKGLTGFADNLAH-RRQVYGSNEMPLARRRSLFHFLLYSMKDWILIVLVIGAIISLVLGLVYPESCKGVIN-----GEVAWYEGVGILVMVVLMILISALSDYLRDADFRCQQKRVHMEERVTVIRDSGAVKDILKSELVVGDLCLLKAGSLVAADGVVVQSSDLVVDETLFSRSERH---KSVVDPLVFAGTHVVKGTGKFIVLAVGASTQAMMQLRLGDPASPGIELQPAPAGPINNKGSQNL---LEFKRHKE----------------------------ENATLEGKVNRVAVALGYIGIAVALITMIVIMVHFSVTNYYTNEKPAKPED-VNMYVRAFIMGMVVLVVSVPEGLPLAVTFALAFCTKMM 386          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO44517 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVV7])

HSP 1 Score: 105.531 bits (262), Expect = 1.907e-24
Identity = 77/252 (30.56%), Postives = 136/252 (53.97%), Query Frame = 3
Query:   78 NELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGI--SSQEAPLRRKIYGKNSIPPKPAKS--FITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGII 818
             +L EI+  +   G+ M+ +    + G++  +  SS  GI  +S     R K +G N I  +  +   F  L++  T  + +L+++      ++   Y +V +   +   E   +  W+EG  IL    V+V ++  +D+ +E+ F  LQ +I++E   +V+R G +++I  Q++ VGD+C I  G ++PADGI++++ +L  DESSL  ES   K     D  + + THV EGSGKM+++AVG  +Q   I
Sbjct:   16 TKLVEILTQKDGKGLQMLDDDFGGVRGIIHRLQTSSKKGILDTSDALARRTKSFGSNRISGQAKRRGFFRALLYSMTDIVLILLVLGGIASVILGYYYREVCKGKYIPDSE---KNAWMEGAGILGTAAVIVLLSTLSDYLREKSFYRLQKRIESERKTRVMRGGEMKEICYQDVKVGDLCVIGPGSIIPADGILVENTELTTDESSLNKESRASKTSR--DPFVFASTHVTEGSGKMIILAVGDSTQIAAI 262          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO40680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M1])

HSP 1 Score: 60.4622 bits (145), Expect = 7.046e-10
Identity = 40/119 (33.61%), Postives = 61/119 (51.26%), Query Frame = 3
Query:  507 LQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKG---------ENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNG 836
             +N +  E N  V+R G  + +  + +V+GDV  +K GD LP D  I++    +VD SSLTGES+   +G         E  ++   S T+ +EG+   VVV  G  +  G I  L +G
Sbjct:  189 FKNLVPQEAN--VLRSGGRKTVGAENLVIGDVVSVKGGDRLPGDIRILECKSFKVDNSSLTGESEPQSRGPDCTHENPLETRNLAFFS-TYALEGNATGVVVQTGDNTVMGRIANLASG 304          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 54.299 bits (129), Expect = 6.182e-8
Identity = 40/133 (30.08%), Postives = 58/133 (43.61%), Query Frame = 3
Query:  540 QVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKK----------GENIDV---MLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNG------GLENDTSSYNKNMSL 881
              +R G +     + +V GD+  I  GD +PAD  + ++ DL +DESS TGE +   K          G  +     +   GT V  G GK VV+  G  S+ G IF L+         L+    S  K +S 
Sbjct:  125 HCVRAGKMFNFLARCLVPGDLVCISIGDRVPADIRLTEAVDLEIDESSFTGEMEPASKTTLPIPAVNSGSGVSARRNIAFMGTLVRSGRGKGVVIGTGENSEFGEIFKLMKAEETPKTPLQKSMDSLGKQLSF 257          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3 [Source:NCBI gene;Acc:101161727])

HSP 1 Score: 316.235 bits (809), Expect = 1.294e-97
Identity = 219/414 (52.90%), Postives = 281/414 (67.87%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSI-NGISSQEAPLRRK--IYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMK-------VTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG-LENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSV--KEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F +T  EL+E+M+ R  D +  I     +  GL   + S++ +G+S   A L R+  IYG+N IPPK  K+F+ LVWEA QD+TL+IL  AAIISL LS Y           ES     DE E +AGWIEG AIL +V+ VVFVTAFNDW KE+QFRGLQ++I+ E  F V+R G + QIPV ++VVGD+ Q+KYGDLLPADGI+IQ NDL++DESSLTGESDHV+K  + D MLLSGTHVMEGSG+M+V AVG  SQ+GIIFTLL  G +E D            K  D  + ++     + E   +++ +    +V  KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI+TF V+ + W    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   35 FGVTVKELRELMELRSTDALQKIQESYGDTKGLCQRLQSNVTDGLSGDPADLERRGQIYGQNFIPPKKPKTFLELVWEALQDVTLIILEAAAIISLGLSFYQPPNQESAICGESTGGAEDEGEADAGWIEGAAILLSVVCVVFVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRKGNVIQIPVADMVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVRKSVDKDPMLLSGTHVMEGSGRMLVTAVGVNSQTGIIFTLLGAGEIEEDVKEKKA------KKQDGGVAMEMQPLKSAEGGEVEDREKKKTNVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILMLFFVINTFVVKERSWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 442          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3 [Source:NCBI gene;Acc:101161727])

HSP 1 Score: 315.464 bits (807), Expect = 5.429e-97
Identity = 222/425 (52.24%), Postives = 286/425 (67.29%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSI-NGISSQEAPLRRK--IYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMK-------VTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG-LEND-----------TSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSV--KEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F +T  EL+E+M+ R  D +  I     +  GL   + S++ +G+S   A L R+  IYG+N IPPK  K+F+ LVWEA QD+TL+IL  AAIISL LS Y           ES     DE E +AGWIEG AIL +V+ VVFVTAFNDW KE+QFRGLQ++I+ E  F V+R G + QIPV ++VVGD+ Q+KYGDLLPADGI+IQ NDL++DESSLTGESDHV+K  + D MLLSGTHVMEGSG+M+V AVG  SQ+GIIFTLL  G +E D           T   N+N +   K  D  + ++     + E   +++ +    +V  KEKSVLQ KLTKLA+QIG  G ++S ITV+IL+L FVI+TF V+ + W    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   41 FGVTVKELRELMELRSTDALQKIQESYGDTKGLCQRLQSNVTDGLSGDPADLERRGQIYGQNFIPPKKPKTFLELVWEALQDVTLIILEAAAIISLGLSFYQPPNQESAICGESTGGAEDEGEADAGWIEGAAILLSVVCVVFVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRKGNVIQIPVADMVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVRKSVDKDPMLLSGTHVMEGSGRMLVTAVGVNSQTGIIFTLLGAGEIEEDVKEKKGKQPDGTVENNQNKA---KKQDGGVAMEMQPLKSAEGGEVEDREKKKTNVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILMLFFVINTFVVKERSWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 462          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b2 (ATPase plasma membrane Ca2+ transporting 2 [Source:NCBI gene;Acc:101156400])

HSP 1 Score: 312.768 bits (800), Expect = 4.679e-96
Identity = 217/427 (50.82%), Postives = 282/427 (66.04%), Query Frame = 3
Query:   18 IFTKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNL--------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWK---TDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
             + KN        + F  +  +L+ +M+ RG +G+  +      + GL   +  S   G+   +A L  R++I+GKN IPPK  K+F+ LVWEA QD+TL+IL +AA+ISL LS Y    ES             DE E +AGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  FQV+R   + Q+PV +I+VGD+ QIKYGDLLPADG++IQ NDL++DESSLTGESDHVKK  + D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G+E +     K        + E   ++   ++     + KE K VS   KEKSVLQ KLTKLA+QIGY G ++S ITV IL+L F I  F ++++PW    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:    9 FYAKNQRNEGNHAADFGCSVMDLRSLMELRGTEGVVKLQEDYGGVEGLCKRLKTSPTEGLLGVQADLDKRKEIFGKNLIPPKKPKTFLQLVWEALQDVTLIILELAALISLGLSFYHPPGESGGEMCGSAAGGVEDEGEADAGWIEGAAILLSVVCVVIVTAFNDWSKEKQFRGLQSRIEQEQKFQVVRGSQVIQLPVADILVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKAADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGVEEEEKKEKKVKKQDGAAAME---MQPLKSAEGGEADEKEKKKVSAPKKEKSVLQGKLTKLAVQIGYAGLVMSSITVTILVLYFSIDNFVMKKRPWMAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 432          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b2 (ATPase plasma membrane Ca2+ transporting 2 [Source:NCBI gene;Acc:101156400])

HSP 1 Score: 309.686 bits (792), Expect = 8.829e-95
Identity = 219/449 (48.78%), Postives = 286/449 (63.70%), Query Frame = 3
Query:   18 IFTKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNL--------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGL-----------------ENDTSSYNKNM---SLPYKTSD--ENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWK---TDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
             + KN        + F  +  +L+ +M+ RG +G+  +      + GL   +  S   G+   +A L  R++I+GKN IPPK  K+F+ LVWEA QD+TL+IL +AA+ISL LS Y    ES             DE E +AGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  FQV+R   + Q+PV +I+VGD+ QIKYGDLLPADG++IQ NDL++DESSLTGESDHVKK  + D MLLSGTHVMEGSG+MVV AVG  SQ+GIIFTLL  G+                 +N     + NM    +  K  D    + ++   ++     + KE K VS   KEKSVLQ KLTKLA+QIGY G ++S ITV IL+L F I  F ++++PW    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:    9 FYAKNQRNEGNHAADFGCSVMDLRSLMELRGTEGVVKLQEDYGGVEGLCKRLKTSPTEGLLGVQADLDKRKEIFGKNLIPPKKPKTFLQLVWEALQDVTLIILELAALISLGLSFYHPPGESGGEMCGSAAGGVEDEGEADAGWIEGAAILLSVVCVVIVTAFNDWSKEKQFRGLQSRIEQEQKFQVVRGSQVIQLPVADILVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKAADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGVEEEEKKEKKGGAVEDGHQNTGKMQDGNMESNQIKVKKQDGAAAMEMQPLKSAEGGEADEKEKKKVSAPKKEKSVLQGKLTKLAVQIGYAGLVMSSITVTILVLYFSIDNFVMKKRPWMAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 457          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000027433.1 (ATPase plasma membrane Ca2+ transporting 1 [Source:NCBI gene;Acc:101166674])

HSP 1 Score: 302.753 bits (774), Expect = 2.932e-92
Identity = 221/421 (52.49%), Postives = 276/421 (65.56%), Query Frame = 3
Query:   54 NSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPL--RRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNL--------DETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLP-----YKTSDENIFLXXXXXXXXXXXXXXXDKIVSN-SVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPW---KTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            ++ F  T  EL+ +M+ RG + I  +     +  GL + +  S  +G+S Q A L  R+  +G+N IPPK  K+F+ LVWEA QD+TL+IL VAAI+SL LS Y +  E+   N         DE E EAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ++I+ E  F V+R G + QIPV EIVVGDV QIKYGDLLPADG++IQ NDL++DESSLTGESDHVKK +  D MLLSGTHVMEGSGKMVV AVG  SQ+GIIFTLL    + D     K           KT   +           +     E+K  SN   KEKSVLQ KLTKLA+QIG  G ++S ITV+IL++ FV+ TF ++   W    T  +++  +   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   19 DAEFGCTLKELRSLMELRGAEAISKLGESYGDTQGLCNRLKTSPADGLSGQPADLEKRKTTFGENLIPPKKPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFY-RPPEAERENCGKAAGGVEDEHESEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQVIQIPVAEIVVGDVAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTQEKDPMLLSGTHVMEGSGKMVVTAVGVNSQTGIIFTLLGANEDEDEDEDEKKKEKEEKKKQRKTKAHDGAAMEMQPLNSDEGADAEEKKKSNLPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVVLFVVDTFWIQNLYWVKECTPIYIQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 438          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000006504.1 (SMESG000006504.1)

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 403/405 (99.51%), Postives = 405/405 (100.00%), Query Frame = 3
Query:   42 MNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSINGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            MNEFNSPFTLTANELQE+MKHRGVDGIHMIINRVKNINGLLDSICSSINGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTLLILIVAAIISLVLSLYMKVTESHELNLDETEGEAGWIEGVAILAAVLVVVFVTAFNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLKSSNNSTIENNNIKEDKIVSNSVKEKSVLQTKLTKLAIQIGYIGTIISLITVLILILKF+IHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM
Sbjct:    1 MNEFNSPFTLTANELQEMMKHRGVDGIHMIINRVKNINGLLDSICSSINGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTLLILIVAAIISLVLSLYMKVTESHELNLDETEGEAGWIEGVAILAAVLVVVFVTAFNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDENIFLKSSNNSTIENNNIKEDKIVSNSVKEKSVLQTKLTKLAIQIGYIGTIISLITVLILILKFLIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 405          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000014734.1 (SMESG000014734.1)

HSP 1 Score: 339.347 bits (869), Expect = 4.800e-106
Identity = 236/420 (56.19%), Postives = 295/420 (70.24%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG---LEN-----DTSSYNKNMSLPYK-----------TSD--ENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F L+  ELQ+IM+ RG + I+ I N+   I+GL   +  S   G+   + P R +IYG N IPPKP K+F  LV+EA QDLTL++LI+AA+ISL LS+Y      H+    + E E GWIEGVAILAAV++VVFV AFNDWQKERQFRGLQNKI++E  FQVIR+   Q+I V +I+VGD+CQIKYGDLLPADG+IIQSNDL++DESSLTGESD VKKGEN D ++LSGTHVMEGSGK+++ AVG  SQ+GIIF LL      LE+     +  + NK  S   K           TS+  E + +  ++       + K+ K  S  VKE SVLQ KLTKLAIQIGYIGTI++++TV ILI+KF    F  + + WKT  HL++II   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   22 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTLIVLIIAALISLGLSIYTMYFGDHK----DDEAEVGWIEGVAILAAVVLVVFVIAFNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 437          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000014734.1 (SMESG000014734.1)

HSP 1 Score: 339.347 bits (869), Expect = 9.521e-106
Identity = 236/420 (56.19%), Postives = 295/420 (70.24%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG---LEN-----DTSSYNKNMSLPYK-----------TSD--ENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F L+  ELQ+IM+ RG + I+ I N+   I+GL   +  S   G+   + P R +IYG N IPPKP K+F  LV+EA QDLTL++LI+AA+ISL LS+Y      H+    + E E GWIEGVAILAAV++VVFV AFNDWQKERQFRGLQNKI++E  FQVIR+   Q+I V +I+VGD+CQIKYGDLLPADG+IIQSNDL++DESSLTGESD VKKGEN D ++LSGTHVMEGSGK+++ AVG  SQ+GIIF LL      LE+     +  + NK  S   K           TS+  E + +  ++       + K+ K  S  VKE SVLQ KLTKLAIQIGYIGTI++++TV ILI+KF    F  + + WKT  HL++II   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   16 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTLIVLIIAALISLGLSIYTMYFGDHK----DDEAEVGWIEGVAILAAVVLVVFVIAFNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 431          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000014734.1 (SMESG000014734.1)

HSP 1 Score: 338.961 bits (868), Expect = 1.514e-105
Identity = 236/420 (56.19%), Postives = 295/420 (70.24%), Query Frame = 3
Query:   63 FTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSI-CSSINGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGG---LEN-----DTSSYNKNMSLPYK-----------TSD--ENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            F L+  ELQ+IM+ RG + I+ I N+   I+GL   +  S   G+   + P R +IYG N IPPKP K+F  LV+EA QDLTL++LI+AA+ISL LS+Y      H+    + E E GWIEGVAILAAV++VVFV AFNDWQKERQFRGLQNKI++E  FQVIR+   Q+I V +I+VGD+CQIKYGDLLPADG+IIQSNDL++DESSLTGESD VKKGEN D ++LSGTHVMEGSGK+++ AVG  SQ+GIIF LL      LE+     +  + NK  S   K           TS+  E + +  ++       + K+ K  S  VKE SVLQ KLTKLAIQIGYIGTI++++TV ILI+KF    F  + + WKT  HL++II   IIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:   16 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTLIVLIIAALISLGLSIYTMYFGDHK----DDEAEVGWIEGVAILAAVVLVVFVIAFNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 431          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000038461.1 (SMESG000038461.1)

HSP 1 Score: 320.857 bits (821), Expect = 1.687e-99
Identity = 227/418 (54.31%), Postives = 293/418 (70.10%), Query Frame = 3
Query:   48 EFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNINGLLDSICSSIN-GISS-QEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDLTXXXXXXXXXXXXXXXXYMKVTESHELNLDETEGEAGWIEGXXXXXXXXXXXXXXXXNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDVCQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTHVMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTS------------SYNKNMSLPYKTSD-ENIFLXXXXXXXXXXXXXXXDKIVSNSVKEKSVLQTKLTKLAIQIGYXXXXXXXXXXXXXXXKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVPEGLPLAVTLALAYSVKKM 1256
            E +S F++   EL E+M  R  + I  I N+ ++IN L   + +S N G+S+  +  LRR+++G N IPPKP K+F+ L++EA QD+TL++L+ AA+ISL L+LY K   S E   D +E +AGWIEGVAIL AV+VVV VTAFNDWQKE+QFRGLQ+KI+      VIR G + +I V +IVVGD+CQ+KYGDLLPADGIIIQSND++VDESSLTGE DHVKKG + D MLLSGTHVMEGSGKMVV AVG  SQ+GIIF LL     N+ S            + + ++ L   T + EN +L             K+ K   +  K+ SVLQTKL KLA  IG +GT+I+++TV+ILI++F I T+ ++   W  D HLKK+I+ LIIGVTVLVVAVPEGLPLAVT++LAYSVKKM
Sbjct:    2 ESDSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKY--SGEETSDSSESDAGWIEGVAILGAVVVVVMVTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELNEKSTKEPTETKKTKKNKSDSVELEKLTDNTENHYLSDKQKDDTTKEEAKK-KKKKSFKKKGSVLQTKLNKLAALIGKVGTVIAVLTVVILIIRFCIETYHIKSMLWHMD-HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKM 415          
The following BLAST results are available for this feature:
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2B32.521e-9753.28ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B32.873e-9753.04ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B46.440e-9653.46ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
ATP2B46.440e-9653.46ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
ATP2B49.676e-9653.46ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mca-22.844e-8649.88Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-31.750e-8351.00Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-31.750e-8351.00Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-31.750e-8351.00Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-31.750e-8351.00Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PMCA8.010e-10353.98gene:FBgn0259214 transcript:FBtr0304047[more]
PMCA2.357e-10152.46gene:FBgn0259214 transcript:FBtr0300559[more]
PMCA4.437e-10152.46gene:FBgn0259214 transcript:FBtr0304048[more]
PMCA4.590e-10152.46gene:FBgn0259214 transcript:FBtr0300556[more]
PMCA5.840e-10152.46gene:FBgn0259214 transcript:FBtr0300554[more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2b3a4.918e-9952.61ATPase plasma membrane Ca2+ transporting 3a [Sourc... [more]
atp2b3a1.685e-9852.61ATPase plasma membrane Ca2+ transporting 3a [Sourc... [more]
atp2b3b2.767e-9451.06ATPase plasma membrane Ca2+ transporting 3b [Sourc... [more]
atp2b3b3.418e-9451.06ATPase plasma membrane Ca2+ transporting 3b [Sourc... [more]
atp2b3b3.870e-9451.06ATPase plasma membrane Ca2+ transporting 3b [Sourc... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam149a3.137e-9952.17family with sequence similarity 149 member A [Sour... [more]
fam149a1.888e-9851.74family with sequence similarity 149 member A [Sour... [more]
fam149a7.910e-9849.79family with sequence similarity 149 member A [Sour... [more]
ugdh4.934e-9753.60UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB... [more]
ugdh7.114e-9753.60UDP-glucose 6-dehydrogenase [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp2b24.172e-9750.70ATPase, Ca++ transporting, plasma membrane 2 [Sour... [more]
Atp2b21.529e-9650.70ATPase, Ca++ transporting, plasma membrane 2 [Sour... [more]
Atp2b21.532e-9650.70ATPase, Ca++ transporting, plasma membrane 2 [Sour... [more]
Atp2b21.532e-9650.70ATPase, Ca++ transporting, plasma membrane 2 [Sour... [more]
Atp2b31.352e-9451.18ATPase, Ca++ transporting, plasma membrane 3 [Sour... [more]
back to top
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R0K7|AT2B2_MOUSE1.072e-9550.70Plasma membrane calcium-transporting ATPase 2 OS=M... [more]
sp|P23634|AT2B4_HUMAN8.037e-9553.46Plasma membrane calcium-transporting ATPase 4 OS=H... [more]
sp|Q16720|AT2B3_HUMAN1.618e-9450.69Plasma membrane calcium-transporting ATPase 3 OS=H... [more]
sp|Q98SH2|AT2B1_CHICK5.593e-9452.80Plasma membrane calcium-transporting ATPase 1 OS=G... [more]
sp|D3K0R6|AT2B4_BOVIN1.059e-9353.16Plasma membrane calcium-transporting ATPase 4 OS=B... [more]
back to top
BLAST of Calcium-transporting ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7CLD81.364e-10853.38Plasma membrane calcium-transporting ATPase 3 (Fra... [more]
A0A5K3EPV41.447e-10856.97Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3END52.928e-10856.97Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K4F6A72.623e-10653.59Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4F7M15.018e-10653.59Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2b3a1.644e-9852.33ATPase plasma membrane Ca2+ transporting 3a [Sourc... [more]
ENSAMXT00000014864.25.949e-9652.51pep primary_assembly:Astyanax_mexicanus-2.0:7:3530... [more]
atp2b1b1.973e-9450.93plasma membrane calcium-transporting ATPase 1-like... [more]
atp2b44.451e-9252.48ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
atp2b49.024e-9151.84ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002775.15.512e-6962.91pep scaffold:Pmarinus_7.0:GL486089:3809:7949:1 gen... [more]
ENSPMAT00000001468.14.584e-6153.36pep scaffold:Pmarinus_7.0:GL477283:10882:33618:1 g... [more]
ENSPMAT00000010087.13.219e-5955.65pep scaffold:Pmarinus_7.0:GL482626:10460:17067:1 g... [more]
ENSPMAT00000007912.12.818e-2064.89pep scaffold:Pmarinus_7.0:GL490738:3481:17315:-1 g... [more]
ENSPMAT00000009058.15.710e-1136.45pep scaffold:Pmarinus_7.0:GL480374:1:11062:-1 gene... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PMC14.134e-2732.32Vacuolar Ca2+ ATPase involved in depleting cytosol... [more]
PMA13.304e-1139.80Plasma membrane P2-type H+-ATPase; pumps protons o... [more]
PMR11.081e-1028.26High affinity Ca2+/Mn2+ P-type ATPase; required fo... [more]
ENA11.526e-1029.87P-type ATPase sodium pump; involved in Na+ and Li+... [more]
ENA21.680e-1029.87P-type ATPase sodium pump; involved in Na+ efflux ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO417752.596e-8245.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417744.325e-3331.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445171.907e-2430.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406807.046e-1033.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356166.182e-830.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2b3b1.294e-9752.90ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
atp2b3b5.429e-9752.24ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
atp2b24.679e-9650.82ATPase plasma membrane Ca2+ transporting 2 [Source... [more]
atp2b28.829e-9548.78ATPase plasma membrane Ca2+ transporting 2 [Source... [more]
ENSORLT00000027433.12.932e-9252.49ATPase plasma membrane Ca2+ transporting 1 [Source... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006504.10.000e+099.51SMESG000006504.1[more]
SMESG000014734.14.800e-10656.19SMESG000014734.1[more]
SMESG000014734.19.521e-10656.19SMESG000014734.1[more]
SMESG000014734.11.514e-10556.19SMESG000014734.1[more]
SMESG000038461.11.687e-9954.31SMESG000038461.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007620 ID=SMED30007620|Name=Calcium-transporting ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=1257bp
AGAATTTTTATATATATATATTTACCAAGAATATTTCAAAAATGAATGAA
TTTAATTCACCGTTCACTTTGACTGCTAATGAACTTCAAGAAATAATGAA
ACATAGAGGAGTTGATGGAATACACATGATTATAAATCGTGTCAAAAATA
TAAATGGATTATTAGATAGCATATGTTCGTCAATAAACGGAATATCATCA
CAAGAAGCTCCCCTAAGACGAAAAATTTATGGTAAAAATTCTATTCCTCC
GAAACCCGCTAAAAGCTTTATAACATTGGTATGGGAAGCCACACAAGATT
TAACTTTACTTATTTTAATAGTTGCAGCTATTATCTCTTTAGTTTTGTCT
CTTTACATGAAAGTGACTGAAAGTCATGAATTGAATCTTGATGAAACCGA
AGGTGAAGCAGGGTGGATTGAAGGGGTAGCCATATTAGCGGCAGTTCTTG
TGGTGGTTTTTGTCACTGCTTTCAATGACTGGCAGAAAGAACGACAGTTT
AGAGGTCTTCAAAATAAAATCCAAACTGAAACTAATTTTCAAGTTATTAG
AGACGGAACATTGCAACAAATTCCGGTACAAGAAATTGTTGTTGGAGACG
TGTGCCAAATTAAATATGGGGATTTATTGCCGGCTGATGGAATAATTATA
CAAAGTAACGACCTAAGAGTAGACGAAAGTTCACTAACTGGAGAATCTGA
TCATGTAAAGAAAGGAGAAAATATCGATGTTATGCTTTTGTCAGGTACGC
ATGTTATGGAGGGCTCAGGTAAAATGGTTGTGGTTGCCGTTGGTCCCAGG
TCGCAATCGGGGATTATTTTCACATTGTTAAATGGCGGTTTGGAAAACGA
TACAAGTAGCTACAACAAAAATATGAGTTTACCCTATAAAACGAGTGATG
AAAATATTTTTTTAAAATCCTCAAATAATTCAACTATAGAGAACAATAAT
ATCAAAGAAGATAAAATTGTATCTAATTCTGTTAAAGAAAAGTCTGTTTT
ACAAACTAAGTTAACGAAACTTGCTATTCAAATTGGTTACATAGGAACGA
TAATTTCACTCATAACTGTTTTAATTTTAATATTGAAATTCGTAATTCAT
ACATTTGCAGTTGAAAGGCAACCGTGGAAAACGGATAAACATTTAAAAAA
AATTATATACGACTTAATCATTGGTGTGACTGTGCTGGTTGTCGCAGTTC
CAGAGGGGTTACCATTAGCCGTAACGTTGGCTTTGGCATATTCAGTTAAA
AAAATGA
back to top

protein sequence of SMED30007620-orf-1

>SMED30007620-orf-1 ID=SMED30007620-orf-1|Name=SMED30007620-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
NFYIYIFTKNISKMNEFNSPFTLTANELQEIMKHRGVDGIHMIINRVKNI
NGLLDSICSSINGISSQEAPLRRKIYGKNSIPPKPAKSFITLVWEATQDL
TLLILIVAAIISLVLSLYMKVTESHELNLDETEGEAGWIEGVAILAAVLV
VVFVTAFNDWQKERQFRGLQNKIQTETNFQVIRDGTLQQIPVQEIVVGDV
CQIKYGDLLPADGIIIQSNDLRVDESSLTGESDHVKKGENIDVMLLSGTH
VMEGSGKMVVVAVGPRSQSGIIFTLLNGGLENDTSSYNKNMSLPYKTSDE
NIFLKSSNNSTIENNNIKEDKIVSNSVKEKSVLQTKLTKLAIQIGYIGTI
ISLITVLILILKFVIHTFAVERQPWKTDKHLKKIIYDLIIGVTVLVVAVP
EGLPLAVTLALAYSVKKM
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR004014ATPase_P-typ_cation-transptr_N
IPR023298ATPase_P-typ_TM_dom_sf
IPR008250ATPase_P-typ_transduc_dom_A_sf
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0005388calcium-transporting ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0070588calcium ion transmembrane transport
GO:0099132ATP hydrolysis coupled cation transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane