Nucleoside diphosphate kinase 7

Overview
NameNucleoside diphosphate kinase 7
Smed IDSMED30007606
Uniprot Best hitNucleoside diphosphate kinase 7 OS=Homo sapiens OX=9606 GN=NME7 PE=1 SV=1 (E=4.33125e-140)
Length (bp)1305
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleoside diphosphate kinase 7 (SMED30007606) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleoside diphosphate kinase 7 (SMED30007606) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleoside diphosphate kinase 7 (SMED30007606) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleoside diphosphate kinase 7 (SMED30007606) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007606

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007606SMESG000069915.1 SmedASXL_005668SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30007606SMESG000069915.1 dd_Smed_v6_10129_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007606SMESG000069915.1 dd_Smed_v4_10129_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30007606SMESG000069915.1 dd_Smed_v4_10129_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Human
Match: NME7 (NME/NM23 family member 7 [Source:HGNC Symbol;Acc:HGNC:20461])

HSP 1 Score: 408.683 bits (1049), Expect = 9.019e-141
Identity = 192/376 (51.06%), Postives = 264/376 (70.21%), Query Frame = 1
Query:   82 RYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF-RENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            R+ F  EWYD  A+++R+Y LLF+P D  VEM D+KN+R FLKRTK + L L DL +GN VN+ SRQL ++D+GD++T R L S  EKTL +IKP A+S  G+II  I KA F I  LKM  L R++A++ +  H+ +PF   L+  +T+GPI+A E++R++A+  W  ++GP +  +A+ +A  S+RA +G D + N  HG +   +A RE+  FF    GC   NTA+F+  TC +VKPH V+ G LG I+++I +AGFEI+A++MFN+D+ N EEF EVYKGV+ EY  ++ E+ SGPCVAMEI      +   A K+FREF GP DPE+ARHLRP TLRA++GK K+ N +HCTDLPED  LEVQYFF+ILD
Sbjct:    6 RFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEI------QQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKILD 375          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Human
Match: NME7 (NME/NM23 family member 7 [Source:HGNC Symbol;Acc:HGNC:20461])

HSP 1 Score: 371.318 bits (952), Expect = 1.378e-126
Identity = 176/345 (51.01%), Postives = 242/345 (70.14%), Query Frame = 1
Query:  175 MFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF-RENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            M D+KN+R FLKRTK + L L DL +GN VN+ SRQL ++D+GD++T R L S  EKTL +IKP A+S  G+II  I KA F I  LKM  L R++A++ +  H+ +PF   L+  +T+GPI+A E++R++A+  W  ++GP +  +A+ +A  S+RA +G D + N  HG +   +A RE+  FF    GC   NTA+F+  TC +VKPH V+ G LG I+++I +AGFEI+A++MFN+D+ N EEF EVYKGV+ EY  ++ E+ SGPCVAMEI      +   A K+FREF GP DPE+ARHLRP TLRA++GK K+ N +HCTDLPED  LEVQYFF+ILD
Sbjct:    1 MHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEI------QQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKILD 339          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Human
Match: NME7 (NME/NM23 family member 7 [Source:HGNC Symbol;Acc:HGNC:20461])

HSP 1 Score: 335.495 bits (859), Expect = 1.701e-112
Identity = 159/331 (48.04%), Postives = 225/331 (67.98%), Query Frame = 1
Query:   82 RYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF-RENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDP 1071
            R+ F  EWYD  A+++R+Y LLF+P D  VEM D+KN+R FLKRTK + L L DL +GN VN+ SRQL ++D+GD++T R L S  EKTL +IKP A+S  G+II  I KA F I  LKM  L R++A++ +  H+ +PF   L+  +T+GPI+A E++R++A+  W  ++GP +  +A+ +A  S+RA +G D + N  HG +   +A RE+  FF    GC   NTA+F+  TC +VKPH V+ G LG I+++I +AGFEI+A++MFN+D+ N EEF EVYKGV+ EY  ++ E+ SGPCVAMEI      +   A K+FREF GP DP
Sbjct:    6 RFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEI------QQNNATKTFREFCGPADP 330          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Human
Match: NME7 (NME/NM23 family member 7 [Source:HGNC Symbol;Acc:HGNC:20461])

HSP 1 Score: 249.21 bits (635), Expect = 5.082e-80
Identity = 112/245 (45.71%), Postives = 163/245 (66.53%), Query Frame = 1
Query:   82 RYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF-RENGCSIPNTARFSKSTCAVVKPHLVT 813
            R+ F  EWYD  A+++R+Y LLF+P D  VEM D+KN+R FLKRTK + L L DL +GN VN+ SRQL ++D+GD++T R L S  EKTL +IKP A+S  G+II  I KA F I  LKM  L R++A++ +  H+ +PF   L+  +T+GPI+A E++R++A+  W  ++GP +  +A+ +A  S+RA +G D + N  HG +   +A RE+  FF    GC   NTA+F+  TC +VKPH V+
Sbjct:    6 RFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVS 250          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Human
Match: NME5 (NME/NM23 family member 5 [Source:HGNC Symbol;Acc:HGNC:7853])

HSP 1 Score: 107.842 bits (268), Expect = 1.256e-26
Identity = 58/135 (42.96%), Postives = 76/135 (56.30%), Query Frame = 1
Query:  334 HTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
            + EKTL IIKP  +    +I   I ++ F IV  +  +L  EQ    Y    GK F  NL   M+SGP++A  L R  A++ WL+++GP + L+AK   P SLRA YG D + N LHGS    AA REI F F E
Sbjct:   11 YVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVEKYGKMFFPNLTAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIRFMFPE 145          

HSP 2 Score: 53.5286 bits (127), Expect = 1.477e-7
Identity = 42/149 (28.19%), Postives = 69/149 (46.31%), Query Frame = 1
Query:  748 SIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
            S+P    + + T A++KP +V   +   I   I+ +GF I   R   L       F  V K     +  +   + SGP VAM       L    A   + E +GP +  +A+   P++LRA+YG D + N +H ++    AE E+++ F
Sbjct:    4 SMPPPQIYVEKTLAIIKPDIVDKEE--EIQDIILRSGFTIVQRRKLRLSPEQCSNFY-VEKYGKMFFPNLTAYMSSGPLVAM------ILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIRFMF 143          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 73.9442 bits (180), Expect = 1.614e-15
Identity = 44/138 (31.88%), Postives = 74/138 (53.62%), Query Frame = 1
Query:  331 SHTEKTLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
            S+TE+T   IKP  +    +G+II+  E+  + +V LK     +      Y   K KPF  +L+  M+SGP++A      + V     M+G T+PL +   AP ++R  + + +  N  HGS+ V++A REI  +F++
Sbjct:    2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLAS---APGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQ 136          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 73.9442 bits (180), Expect = 1.614e-15
Identity = 44/138 (31.88%), Postives = 74/138 (53.62%), Query Frame = 1
Query:  331 SHTEKTLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
            S+TE+T   IKP  +    +G+II+  E+  + +V LK     +      Y   K KPF  +L+  M+SGP++A      + V     M+G T+PL +   AP ++R  + + +  N  HGS+ V++A REI  +F++
Sbjct:    2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLAS---APGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQ 136          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 73.9442 bits (180), Expect = 1.614e-15
Identity = 44/138 (31.88%), Postives = 74/138 (53.62%), Query Frame = 1
Query:  331 SHTEKTLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
            S+TE+T   IKP  +    +G+II+  E+  + +V LK     +      Y   K KPF  +L+  M+SGP++A      + V     M+G T+PL +   AP ++R  + + +  N  HGS+ V++A REI  +F++
Sbjct:    2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLAS---APGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQ 136          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 73.9442 bits (180), Expect = 1.614e-15
Identity = 44/138 (31.88%), Postives = 74/138 (53.62%), Query Frame = 1
Query:  331 SHTEKTLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
            S+TE+T   IKP  +    +G+II+  E+  + +V LK     +      Y   K KPF  +L+  M+SGP++A      + V     M+G T+PL +   AP ++R  + + +  N  HGS+ V++A REI  +F++
Sbjct:    2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLAS---APGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQ 136          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Fly
Match: nmdyn-D7 (gene:FBgn0028997 transcript:FBtr0082083)

HSP 1 Score: 222.246 bits (565), Expect = 3.385e-68
Identity = 134/381 (35.17%), Postives = 209/381 (54.86%), Query Frame = 1
Query:   76 ELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALS-NMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMEN-LLNLMTSGPIMAFELMRENAVNG--WLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            E R AF  EW+ + A IIR +++ ++  D  VE+FD +N R FL+RTK   L   D  VG+ +N+  RQ  IVD+ D+ TR NL+ + +K   ++K    + ++G+ +  +      I    M Q   +   +  +         + L+N + +GP ++ EL+ +N V           T+      +   SL   +  + +  G + S+  N    ++ F   E   SI     F  +T A++KPH + +G LG II  I++ GF +TA+RM  + + N EEF EVY+GV+ EY  ++ +L SG C+ MEI+     K     + FR F GPMDPE+A+ LRP+TLRA +GK KV N +HCTDLP+D+ LE+QY F+I+D
Sbjct:   10 ERRLAFVAEWFHAEAGIIRTFLITYYVSDKAVEVFDQRNKRTFLRRTKIPELTQRDFFVGSKINVFGRQFDIVDYADDTTRTNLAKYRKKGFVLLKNNMWTKHLGKFLKTLIDNKININQGMMVQFSPKMVTQFLSGKDTTDVSSSVLMNELLAGPAISLELIGDNVVETIKACAQYKSTEAETPSVKLSPSLEELFESEEIRYGFYYSDNDNDVEMDLKFI-SEARHSIIKECVFKNTTLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFYEVYRGVVPEYIPMVAQLASGVCMCMEIACADPEKK--TDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTDLPDDSNLELQYMFKIID 387          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Fly
Match: nmdyn-D6 (gene:FBgn0030573 transcript:FBtr0073933)

HSP 1 Score: 92.0485 bits (227), Expect = 6.482e-22
Identity = 52/136 (38.24%), Postives = 71/136 (52.21%), Query Frame = 1
Query:  340 EKTLGIIKPQALSN---MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
            E TL +IKP  L N   M QI + I + NF I++ K   + +E +   YA HKGK F   L + M SGP  A  L  E  +  W  ++GPT    A    P+ +RA YG+    N  HGS+   +A+REI+  F E
Sbjct:    2 EITLALIKPHVLRNTYAMQQIRALISQ-NFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREISILFPE 136          

HSP 2 Score: 48.9062 bits (115), Expect = 1.082e-6
Identity = 37/142 (26.06%), Postives = 63/142 (44.37%), Query Frame = 1
Query:  781 TCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            T A++KPH++ N      I ++++  F I   +   + K  +E F   +KG    Y  +   + SGP      S  + L+++   + +R  +GP     A +  PN +RA+YG     N  H +D    A  E+   F   D
Sbjct:    4 TLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKG-KFFYHRLTSFMNSGP------SYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREISILFPEFD 138          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0346611)

HSP 1 Score: 68.1662 bits (165), Expect = 2.176e-13
Identity = 41/140 (29.29%), Postives = 70/140 (50.00%), Query Frame = 1
Query:  325 LSSHTEKTLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
            ++++ E+T  ++KP  +    +G+II   E+  F +V LK     +E   + YA    +PF   L+N M SGP++       N V     M+G T+P       P ++R  + +    N +HGS+ V +A +EI  +F E
Sbjct:    1 MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNP---ADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNE 137          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0346150)

HSP 1 Score: 68.1662 bits (165), Expect = 2.658e-13
Identity = 41/141 (29.08%), Postives = 70/141 (49.65%), Query Frame = 1
Query:  322 NLSSHTEKTLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
             ++++ E+T  ++KP  +    +G+II   E+  F +V LK     +E   + YA    +PF   L+N M SGP++       N V     M+G T+P       P ++R  + +    N +HGS+ V +A +EI  +F E
Sbjct:   15 TMAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNP---ADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNE 152          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0339146)

HSP 1 Score: 68.1662 bits (165), Expect = 2.658e-13
Identity = 41/141 (29.08%), Postives = 70/141 (49.65%), Query Frame = 1
Query:  322 NLSSHTEKTLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
             ++++ E+T  ++KP  +    +G+II   E+  F +V LK     +E   + YA    +PF   L+N M SGP++       N V     M+G T+P       P ++R  + +    N +HGS+ V +A +EI  +F E
Sbjct:   15 TMAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNP---ADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNE 152          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Zebrafish
Match: nme7 (NME/NM23 family member 7 [Source:ZFIN;Acc:ZDB-GENE-000210-35])

HSP 1 Score: 412.535 bits (1059), Expect = 1.806e-142
Identity = 198/379 (52.24%), Postives = 269/379 (70.98%), Query Frame = 1
Query:   73 IELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFREN-GCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            +E R+AF  EWYD +A ++R+Y LL++PKD  VEMFD+KN R FL+RTK E L+  DL VGN VNI SRQL ++ +GD++T   L S  E+TL +IKP A+S +G II  I  AN ++   KM +L  +QA + Y  H+ K F  NL+  ++SGP++A ELM + AV+ W  ++GPTD  +A++EA HSLR ++G D   N  HGS+ + +A RE+ +FF    G  + NTA++S  TC ++KPH ++    G I+ SI+  GFEI+AL+MFN+D+ANAEEFLEVYKGV+AEY  ++ EL SGPC+A+EI          A ++FREF GP DPE+ARHLRP TLRA+YGK+K+ NG+HCTDLPED  LEVQYFF+ILD
Sbjct:    1 MEERFAFLAEWYDPSAALLRRYQLLYYPKDGSVEMFDMKNQRTFLRRTKLEELQPEDLFVGNRVNIFSRQLNLISYGDQYTANKLGSKKERTLAMIKPDAVSKVGDIIQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVSSGPVIAMELMGDEAVSTWRKVLGPTDSGVAQKEAAHSLRGQFGTDGTKNAGHGSDSLASAARELEYFFPSTAGHGLSNTAKYSDCTCCIIKPHAISEALTGKILKSIIENGFEISALQMFNMDRANAEEFLEVYKGVVAEYTKMVDELCSGPCMALEIHA------TDAPRTFREFCGPADPEIARHLRPKTLRALYGKNKLQNGVHCTDLPEDGILEVQYFFKILD 373          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Zebrafish
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:58120])

HSP 1 Score: 103.219 bits (256), Expect = 1.852e-25
Identity = 51/134 (38.06%), Postives = 79/134 (58.96%), Query Frame = 1
Query:  346 TLGIIKPQALSNMGQIISDIEKA---NFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
            TL +IKP A+++   I+  + +    NF+I+  K    ++  +   YA H G+ F + L+  M+SGP+ A+ L RE+A+  W  M+GPT    A+  +P +LR KYGL    N  HGS+ + +A REI+FFF E
Sbjct:   10 TLAVIKPDAMAH-PLILEALHQKILENFIIIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMSSGPMRAYILAREDAITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSDSIESAKREISFFFPE 142          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Zebrafish
Match: nme8 (NME/NM23 family member 8 [Source:ZFIN;Acc:ZDB-GENE-070410-39])

HSP 1 Score: 108.227 bits (269), Expect = 6.157e-25
Identity = 85/293 (29.01%), Postives = 146/293 (49.83%), Query Frame = 1
Query:  346 TLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMR----ENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNT---ARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYG-KDKVCNGIHCTDLPEDAELEVQYFF 1194
            T+ IIKP  +++    +II  I+ A FVI+  +   L   +A + Y     +P+ + L+  M+SGP     + +    E+ +  W + IGP D   A+RE P SLRA+YG +S+ NGLHGS     A RE+ FFF     S+ ++       + T A+V+P      +   I+  I  AGF +   +   L +     F   +      + +++  + SG  +A+       L  + A + +R  +GP DP  A++ +P++LRA +  ++   N +H +   E+AE E+ +FF
Sbjct:  162 TVAIIKPDVVAHGKADEIIMKIQDAGFVILAHEERTLTEAEAQDFYQHKAAEPYFQELVQFMSSGPSHVLVISKTEGCEDVIPAWREFIGPADVEEARREQPESLRAQYGSESLLNGLHGSSDRERASRELAFFFPNFSFSVWDSRPEEEPVERTLALVRPDAARENR-EEILSRIRQAGFRVAMQKELMLTEEQVRLFYSTHVE-EEYFNSLMENMTSGLVLAL------ALVKEGAVEHWRNILGPKDPIKAKNEQPDSLRAQFSVENSSINQLHGSSSSEEAEKEISFFF 446          

HSP 2 Score: 102.834 bits (255), Expect = 3.439e-23
Identity = 72/210 (34.29%), Postives = 110/210 (52.38%), Query Frame = 1
Query:  310 WTRRNLSSHTEKTLGIIKPQAL-SNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVS-NGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNA-GFEITALRMFNLDKANAEEFLEVYK 930
            W  R      E+TL +++P A   N  +I+S I +A F +   K   L  EQ    Y+ H  + +  +L+  MTSG ++A  L++E AV  W +++GP DP+ AK E P SLRA++ +++ S N LHGS     A +EI+FFF              + T AV+KP    + Q    IL  + A GF I+ L+   L +  AEEF + ++
Sbjct:  304 WDSRPEEEPVERTLALVRPDAARENREEILSRIRQAGFRVAMQKELMLTEEQVRLFYSTHVEEEYFNSLMENMTSGLVLALALVKEGAVEHWRNILGPKDPIKAKNEQPDSLRAQFSVENSSINQLHGSSSSEEAEKEISFFFP------------PEDTLAVIKP----DTQHKEEILEEIQAQGFTISQLKDTILSREMAEEFYKEHR 497          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Zebrafish
Match: nme5 (NME/NM23 family member 5 [Source:ZFIN;Acc:ZDB-GENE-040718-221])

HSP 1 Score: 101.293 bits (251), Expect = 2.254e-24
Identity = 50/131 (38.17%), Postives = 74/131 (56.49%), Query Frame = 1
Query:  340 EKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF 732
            E+TL +IKP A+    +I   I ++ F I+  +  QL  EQ  + YA H GK    +L   M+SGP++A  L R+ A+  W  ++GP   + A+   P  LRA++G   + N +HGSE  +AA REI F F
Sbjct:   23 ERTLALIKPDAIHKTDEIEDIILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFMSSGPVVALALARDQAIATWKAIMGPVSSIKARETHPDCLRARFGTCDLRNAVHGSETFSAAEREIRFMF 153          

HSP 2 Score: 47.7506 bits (112), Expect = 8.823e-6
Identity = 38/149 (25.50%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  751 IPNTARFSKSTCAVVKPHLV-TNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
            +P    F + T A++KP  +    ++  IIL    +GF I   R   L      +F   + G    +  +   + SGP VA+ ++     ++Q A  +++  +GP+    AR   P+ LRA +G   + N +H ++    AE E+++ F
Sbjct:   15 MPEPRIFVERTLALIKPDAIHKTDEIEDIIL---QSGFTILQKRRLQLSPEQCSDFYAEHYG-KLHFPHLTAFMSSGPVVALALA-----RDQ-AIATWKAIMGPVSSIKARETHPDCLRARFGTCDLRNAVHGSETFSAAEREIRFMF 153          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Zebrafish
Match: nme4 (NME/NM23 nucleoside diphosphate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1043])

HSP 1 Score: 80.8777 bits (198), Expect = 2.131e-17
Identity = 51/154 (33.12%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  322 NLSSHTEKTLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFREN------GCSIPN 759
            + S   E+TL  +KP  +    +G++I   E+  F +V LKM Q   +   + Y   + KPF  +LL  MTSGPI+A      N V     M+G TDP  A   AP ++R  + +    N +H S+ V  A REI+ +F  +      GC   N
Sbjct:   36 DFSGVNERTLVAVKPDGVQRRLIGEVIKRFEQRGFRLVGLKMLQAPDKLLAQHYVSLQKKPFYSSLLYYMTSGPIVAMVWEGHNVVKTSRMMVGDTDPAAA---APGTIRGDFSVHISRNVVHASDSVEGAQREISLWFHRSELVDWEGCDHKN 186          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Xenopus
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:394498])

HSP 1 Score: 382.104 bits (980), Expect = 2.765e-130
Identity = 181/372 (48.66%), Postives = 261/372 (70.16%), Query Frame = 1
Query:   76 ELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIP-NTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQY 1188
            E R+AF  EWYD  A I R+Y L ++ KD  VEM+D+KN+R FL+RTK + +   DL VGN +N+ SR L ++D+ D++T R + S  EKTL +IKP A++ MG II  I  + FVI   KM  L R +A++ Y  H  K F  +L++ MTSGPI+A E++ + AV+ W  ++GPT+  +A+ E P S+RA++G D   N  HGS+ + +A RE+ FFF  +G   P NTA+F+  TC ++KPH ++ G  G I+ +I++AGFEI+A++MF +++ANAEEF E+YKGV+AE++ +++EL SGPC+A+EI      ++  A K FR+F GP DPE+ARHLRP TLRA +GK+K+ N +HCTDLPEDA LEV+Y
Sbjct:    4 EDRFAFIAEWYDPNAAIQRRYQLNYYTKDGSVEMYDIKNHRVFLRRTKYDEICKDDLFVGNKINVFSRHLHLIDYADQYTSRKVGSKKEKTLALIKPDAVTKMGSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELEFFFPSSGGRAPKNTAKFTDCTCCIIKPHAISEGLTGKILNAILDAGFEISAMQMFTIERANAEEFCEIYKGVVAEFSDMIVELCSGPCIALEI------RDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIKNAVHCTDLPEDAPLEVRY 369          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Xenopus
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:394498])

HSP 1 Score: 367.851 bits (943), Expect = 1.287e-124
Identity = 179/381 (46.98%), Postives = 257/381 (67.45%), Query Frame = 1
Query:   76 ELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIP-NTARFSKSTCAVVKPHLVTNGQLGSIILSI---VNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            E R+AF  EWYD  A I R+Y L ++ KD  VEM+D+KN+R FL+RTK + +   DL VGN +N+ SR L ++D+ D++T R + S  EKTL +IKP A++ MG II  I  + FVI   KM  L R +A++ Y  H  K F  +L++ MTSGPI+A E++ + AV+ W  ++GPT+  +A+ E P S+RA++G D   N  HGS+ + +A RE+ FFF  +G   P NTA+F+  TC ++KPH ++ G+  +++L     +    E      F +++ANAEEF E+YKGV+AE++ +++EL SGPC+A+EI      ++  A K FR+F GP DPE+ARHLRP TLRA +GK+K+ N +HCTDLPEDA LEVQYFF+ILD
Sbjct:    4 EDRFAFIAEWYDPNAAIQRRYQLNYYTKDGSVEMYDIKNHRVFLRRTKYDEICKDDLFVGNKINVFSRHLHLIDYADQYTSRKVGSKKEKTLALIKPDAVTKMGSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELEFFFPSSGGRAPKNTAKFTDCTCCIIKPHAISEGEYNTMLLFTYQRMTQNSENFTAGYFTIERANAEEFCEIYKGVVAEFSDMIVELCSGPCIALEI------RDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIKNAVHCTDLPEDAPLEVQYFFKILD 378          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Xenopus
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:394498])

HSP 1 Score: 353.599 bits (906), Expect = 3.678e-119
Identity = 175/376 (46.54%), Postives = 250/376 (66.49%), Query Frame = 1
Query:   76 ELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIP-NTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMF----NLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQY 1188
            E R+AF  EWYD  A I R+Y L ++ KD  VEM+D+KN+R FL+RTK + +   DL VGN +N+ SR L ++D+ D++T R + S  EKTL +IKP A++ MG II  I  + FVI   KM  L R +A++ Y  H  K F  +L++ MTSGPI+A E++ + AV+ W  ++GPT+  +A+ E P S+RA++G D   N  HGS+ + +A RE+ FFF  +G   P NTA+F+  TC ++KPH ++ G+  +++L         T  RM     N  +ANAEEF E+YKGV+AE++ +++EL SGPC+A+EI      ++  A K FR+F GP DPE+ARHLRP TLRA +GK+K+ N +HCTDLPEDA LEV+Y
Sbjct:    4 EDRFAFIAEWYDPNAAIQRRYQLNYYTKDGSVEMYDIKNHRVFLRRTKYDEICKDDLFVGNKINVFSRHLHLIDYADQYTSRKVGSKKEKTLALIKPDAVTKMGSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELEFFFPSSGGRAPKNTAKFTDCTCCIIKPHAISEGEYNTMLL--------FTYQRMTQNSENFTRANAEEFCEIYKGVVAEFSDMIVELCSGPCIALEI------RDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIKNAVHCTDLPEDAPLEVRY 365          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Xenopus
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:394498])

HSP 1 Score: 347.436 bits (890), Expect = 3.453e-117
Identity = 170/378 (44.97%), Postives = 246/378 (65.08%), Query Frame = 1
Query:   76 ELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIP-NTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            E R+AF  EWYD  A I R+Y L ++ KD  VEM+D+KN+R FL+RTK + +   DL VGN +N+ SR L ++D+ D++T R + S  EKT                                     +A++ Y  H  K F  +L++ MTSGPI+A E++ + AV+ W  ++GPT+  +A+ E P S+RA++G D   N  HGS+ + +A RE+ FFF  +G   P NTA+F+  TC ++KPH ++ G  G I+ +I++AGFEI+A++MF +++ANAEEF E+YKGV+AE++ +++EL SGPC+A+EI      ++  A K FR+F GP DPE+ARHLRP TLRA +GK+K+ N +HCTDLPEDA LEVQYFF+ILD
Sbjct:    4 EDRFAFIAEWYDPNAAIQRRYQLNYYTKDGSVEMYDIKNHRVFLRRTKYDEICKDDLFVGNKINVFSRHLHLIDYADQYTSRKVGSKKEKT-------------------------------------EAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELEFFFPSSGGRAPKNTAKFTDCTCCIIKPHAISEGLTGKILNAILDAGFEISAMQMFTIERANAEEFCEIYKGVVAEFSDMIVELCSGPCIALEI------RDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIKNAVHCTDLPEDAPLEVQYFFKILD 338          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Xenopus
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:394498])

HSP 1 Score: 337.806 bits (865), Expect = 4.480e-113
Identity = 170/374 (45.45%), Postives = 243/374 (64.97%), Query Frame = 1
Query:   76 ELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREI---NFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQY 1188
            E R+AF  EWYD  A I R+Y L ++ KD  VEM+D+KN+R FL+RTK + +   DL VGN +N+ SR L ++D+ D++T R + S  EKTL +IKP A++ MG II  I  + FVI   KM  L R +A++ Y  H  K F  +L++ MTSGPI+A E++ + AV+ W  ++GPT+  +A+ E P S+RA++G D   N  HGS+ + +A R      +FF    C       F               G  G I+ +I++AGFEI+A++MF +++ANAEEF E+YKGV+AE++ +++EL SGPC+A+EI      ++  A K FR+F GP DPE+ARHLRP TLRA +GK+K+ N +HCTDLPEDA LEV+Y
Sbjct:    4 EDRFAFIAEWYDPNAAIQRRYQLNYYTKDGSVEMYDIKNHRVFLRRTKYDEICKDDLFVGNKINVFSRHLHLIDYADQYTSRKVGSKKEKTLALIKPDAVTKMGSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARVTILYFYFFHTFLCGSKMKMSF----------FFFYTGLTGKILNAILDAGFEISAMQMFTIERANAEEFCEIYKGVVAEFSDMIVELCSGPCIALEI------RDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIKNAVHCTDLPEDAPLEVRY 361          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Mouse
Match: Nme7 (NME/NM23 family member 7 [Source:MGI Symbol;Acc:MGI:2449121])

HSP 1 Score: 405.986 bits (1042), Expect = 1.654e-139
Identity = 195/387 (50.39%), Postives = 266/387 (68.73%), Query Frame = 1
Query:   49 SRYFKMTNIELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF-RENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            S Y    N   R+AF  EWYD  A+++R+Y LLF+P D  VEM D+KN R FLKRTK E LRL DL +GN VN+ SRQL ++D+GD++T R L S  EKTL +IKP A+S  G+II  I K+ F I  L+M  L R++A + +  H  +PF   L+  +TSGP++A E++R++A+  W  ++GP +  L++ +AP S+RA +G D V N  HG +   +A RE+  FF    GC   NTA+F+  TC ++KPH ++ G LG I+++I +A F ++A++MFNLD+AN EEF EVYKGV++EY  ++ EL SGPCVA+EI      +     K+FREF GP DPE+ARHLRP TLRA++GK KV N +HCTDLPED  LEVQYFF+ILD
Sbjct:   14 SPYMAPKNQSERFAFIAEWYDPNASLLRRYELLFYPTDGSVEMHDVKNRRTFLKRTKYEDLRLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAISEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEI------QQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTDLPEDGLLEVQYFFKILD 394          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Mouse
Match: Nme7 (NME/NM23 family member 7 [Source:MGI Symbol;Acc:MGI:2449121])

HSP 1 Score: 405.986 bits (1042), Expect = 1.654e-139
Identity = 195/387 (50.39%), Postives = 266/387 (68.73%), Query Frame = 1
Query:   49 SRYFKMTNIELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF-RENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            S Y    N   R+AF  EWYD  A+++R+Y LLF+P D  VEM D+KN R FLKRTK E LRL DL +GN VN+ SRQL ++D+GD++T R L S  EKTL +IKP A+S  G+II  I K+ F I  L+M  L R++A + +  H  +PF   L+  +TSGP++A E++R++A+  W  ++GP +  L++ +AP S+RA +G D V N  HG +   +A RE+  FF    GC   NTA+F+  TC ++KPH ++ G LG I+++I +A F ++A++MFNLD+AN EEF EVYKGV++EY  ++ EL SGPCVA+EI      +     K+FREF GP DPE+ARHLRP TLRA++GK KV N +HCTDLPED  LEVQYFF+ILD
Sbjct:   14 SPYMAPKNQSERFAFIAEWYDPNASLLRRYELLFYPTDGSVEMHDVKNRRTFLKRTKYEDLRLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAISEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEI------QQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTDLPEDGLLEVQYFFKILD 394          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Mouse
Match: Nme7 (NME/NM23 family member 7 [Source:MGI Symbol;Acc:MGI:2449121])

HSP 1 Score: 405.986 bits (1042), Expect = 1.654e-139
Identity = 195/387 (50.39%), Postives = 266/387 (68.73%), Query Frame = 1
Query:   49 SRYFKMTNIELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF-RENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            S Y    N   R+AF  EWYD  A+++R+Y LLF+P D  VEM D+KN R FLKRTK E LRL DL +GN VN+ SRQL ++D+GD++T R L S  EKTL +IKP A+S  G+II  I K+ F I  L+M  L R++A + +  H  +PF   L+  +TSGP++A E++R++A+  W  ++GP +  L++ +AP S+RA +G D V N  HG +   +A RE+  FF    GC   NTA+F+  TC ++KPH ++ G LG I+++I +A F ++A++MFNLD+AN EEF EVYKGV++EY  ++ EL SGPCVA+EI      +     K+FREF GP DPE+ARHLRP TLRA++GK KV N +HCTDLPED  LEVQYFF+ILD
Sbjct:   14 SPYMAPKNQSERFAFIAEWYDPNASLLRRYELLFYPTDGSVEMHDVKNRRTFLKRTKYEDLRLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAISEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEI------QQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTDLPEDGLLEVQYFFKILD 394          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Mouse
Match: Nme7 (NME/NM23 family member 7 [Source:MGI Symbol;Acc:MGI:2449121])

HSP 1 Score: 254.218 bits (648), Expect = 7.952e-82
Identity = 116/256 (45.31%), Postives = 166/256 (64.84%), Query Frame = 1
Query:   49 SRYFKMTNIELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF-RENGCSIPNTARFSKSTCAVVKPHLVT 813
            S Y    N   R+AF  EWYD  A+++R+Y LLF+P D  VEM D+KN R FLKRTK E LRL DL +GN VN+ SRQL ++D+GD++T R L S  EKTL +IKP A+S  G+II  I K+ F I  L+M  L R++A + +  H  +PF   L+  +TSGP++A E++R++A+  W  ++GP +  L++ +AP S+RA +G D V N  HG +   +A RE+  FF    GC   NTA+F+  TC ++KPH ++
Sbjct:   14 SPYMAPKNQSERFAFIAEWYDPNASLLRRYELLFYPTDGSVEMHDVKNRRTFLKRTKYEDLRLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAIS 269          

HSP 2 Score: 62.003 bits (149), Expect = 2.830e-10
Identity = 46/140 (32.86%), Postives = 71/140 (50.71%), Query Frame = 1
Query:  775 KSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
            + T A++KP  V+    G II  I  +GF IT LRM  L +  A +F  V       Y  ++  + SGP +AMEI     L++  A   ++  +GP +  ++R   P ++RA++G D V N  H  D    A  E++ FF
Sbjct:  111 EKTLALIKPDAVSKA--GEIIEMINKSGFTITKLRMMTLTRKEAADF-HVDHHSRPFYNELIQFITSGPVIAMEI-----LRDD-AICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFF 241          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Mouse
Match: Nme5 (NME/NM23 family member 5 [Source:MGI Symbol;Acc:MGI:1922783])

HSP 1 Score: 99.3673 bits (246), Expect = 1.162e-23
Identity = 52/133 (39.10%), Postives = 72/133 (54.14%), Query Frame = 1
Query:  334 HTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF 732
            + EKTL +IKP  +    +I   I  + F I+  +   L  E     Y    GK F  NL   M+SGP++A  L R  A++ W +++GP++ L+AK   P SLRA YG D + N LHGS    A+ REI F F
Sbjct:   11 YVEKTLALIKPDVVDKEEEIQDIILGSGFTIIQRRKLHLSPEHCSNFYVEQYGKMFFPNLTAYMSSGPLVAMILARHKAISYWKELMGPSNSLVAKETHPDSLRAIYGTDELRNALHGSNDFAASEREIRFMF 143          

HSP 2 Score: 51.9878 bits (123), Expect = 2.624e-7
Identity = 41/150 (27.33%), Postives = 73/150 (48.67%), Query Frame = 1
Query:  748 SIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEF-LEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
            S+P    + + T A++KP +V   +   I   I+ +GF I   R  +L   +   F +E Y  +        +   SGP VAM       L    A   ++E +GP +  +A+   P++LRA+YG D++ N +H ++    +E E+++ F
Sbjct:    4 SMPLPQIYVEKTLALIKPDVVDKEE--EIQDIILGSGFTIIQRRKLHLSPEHCSNFYVEQYGKMFFPNLTAYMS--SGPLVAM------ILARHKAISYWKELMGPSNSLVAKETHPDSLRAIYGTDELRNALHGSNDFAASEREIRFMF 143          
BLAST of Nucleoside diphosphate kinase 7 vs. UniProt
Match: sp|Q9Y5B8|NDK7_HUMAN (Nucleoside diphosphate kinase 7 OS=Homo sapiens OX=9606 GN=NME7 PE=1 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 4.331e-140
Identity = 192/376 (51.06%), Postives = 264/376 (70.21%), Query Frame = 1
Query:   82 RYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF-RENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            R+ F  EWYD  A+++R+Y LLF+P D  VEM D+KN+R FLKRTK + L L DL +GN VN+ SRQL ++D+GD++T R L S  EKTL +IKP A+S  G+II  I KA F I  LKM  L R++A++ +  H+ +PF   L+  +T+GPI+A E++R++A+  W  ++GP +  +A+ +A  S+RA +G D + N  HG +   +A RE+  FF    GC   NTA+F+  TC +VKPH V+ G LG I+++I +AGFEI+A++MFN+D+ N EEF EVYKGV+ EY  ++ E+ SGPCVAMEI      +   A K+FREF GP DPE+ARHLRP TLRA++GK K+ N +HCTDLPED  LEVQYFF+ILD
Sbjct:    6 RFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEI------QQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKILD 375          
BLAST of Nucleoside diphosphate kinase 7 vs. UniProt
Match: sp|Q9QXL7|NDK7_RAT (Nucleoside diphosphate kinase 7 OS=Rattus norvegicus OX=10116 GN=Nme7 PE=1 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 2.658e-139
Identity = 195/387 (50.39%), Postives = 267/387 (68.99%), Query Frame = 1
Query:   49 SRYFKMTNIELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF-RENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            S Y    N   R+AF  EWYD  A+++R+Y LL++P D  VEM D+KN R FLKRTK E LR+ DL +GN VN+ SRQL ++D+GD++T R L S  EKTL +IKP A+S  G+II  I K+ F I  L+M  L R++A + +  H  +PF   L+  +TSGP++A E++R++A+  W  ++GP +  +A+ EAP S+RA +G D + N  HGS+   +A RE+  FF    GC   NTA+F+  TC ++KPH ++ G LG I+++I +A FEI+A++MFN+D+AN EEF EVYKGVL++Y  ++ EL SGPCVA+EI      +     K+FREF GP DPE+ARHLRP TLRA +GK KV N +HCTDLPED  LEVQYFF+ILD
Sbjct:   14 SPYLAPKNQSERFAFIAEWYDPNASLLRRYELLYYPVDGSVEMHDVKNRRTFLKRTKYEDLRVEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLSRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGIARSEAPGSVRALFGTDGIRNAAHGSDTFESAAREMELFFPSSGGCGPTNTAKFTNCTCCIIKPHAISEGMLGKILIAIRDACFEISAIQMFNMDRANVEEFYEVYKGVLSDYNDMVTELYSGPCVAIEI------QQSNPTKTFREFCGPSDPEIARHLRPETLRANFGKTKVQNAVHCTDLPEDGLLEVQYFFKILD 394          
BLAST of Nucleoside diphosphate kinase 7 vs. UniProt
Match: sp|Q5E9Y9|NDK7_BOVIN (Nucleoside diphosphate kinase 7 OS=Bos taurus OX=9913 GN=NME7 PE=2 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 2.933e-137
Identity = 194/377 (51.46%), Postives = 264/377 (70.03%), Query Frame = 1
Query:   82 RYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENG-CSIPNTARFSK-STCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            R+ F  EW+D  A++ R+Y LLF+P D  VEM D+KN+R FLKRTK E L L DL +GN VNI SRQL ++D+GD++T R L S  EKTL +IKP A+S  G+II  I KA F +  LKM  L R++A + +  H+ +PF+  L+  +TSGPI+A E++R++AV  W  ++GP +  LA+ +AP S+RA +G D + N  HG +    A RE+  FF  +G C   NTA+F+  +TC +VKPH V+ G LG I+++I +AGFEI+A++MFN+D+ N EEF EVYKGV++EY  ++ E+ SGPCVAMEI      +      +FREF GP DPE+ARHLRP TLRA++GK K+ N +HCTDLPED  LEVQYFF+ILD
Sbjct:    6 RFVFIAEWFDPNASLFRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYEDLHLEDLFIGNKVNIFSRQLVLLDYGDQYTARQLGSKKEKTLALIKPDAVSKAGEIIEIINKAGFTLTKLKMMTLSRKEATDFHIDHQSRPFLNELIQFITSGPIIAMEILRDDAVCEWKRLLGPANSGLARTDAPESIRALFGTDGIKNAAHGPDSFACAAREMELFFPSSGVCGPANTAKFTNCTTCCIVKPHAVSEGLLGKILMTIRDAGFEISAMQMFNMDRINVEEFYEVYKGVVSEYNEMVTEMYSGPCVAMEI------QQTNPTMTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKILD 376          
BLAST of Nucleoside diphosphate kinase 7 vs. UniProt
Match: sp|Q9QXL8|NDK7_MOUSE (Nucleoside diphosphate kinase 7 OS=Mus musculus OX=10090 GN=Nme7 PE=1 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 4.445e-137
Identity = 194/387 (50.13%), Postives = 265/387 (68.48%), Query Frame = 1
Query:   49 SRYFKMTNIELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF-RENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            S Y    N   R+AF  EWYD  A+++R+Y LLF+P D  VEM D+KN R FLKRTK E LRL DL +GN VN+ SRQL ++D+GD++T R L S  EKTL +IKP A+S  G+II  I K+ F I  L+M  L R++A + +  H  +PF   L+  +TSGP++A E++R++A+  W  ++GP +  L++ +AP S+RA +G D V N  HG +   +A RE+  FF    GC   NTA+F+  TC ++KPH ++ G LG  +++I +A F ++A++MFNLD+AN EEF EVYKGV++EY  ++ EL SGPCVA+EI      +     K+FREF GP DPE+ARHLRP TLRA++GK KV N +HCTDLPED  LEVQYFF+ILD
Sbjct:   14 SPYMAPKNQSERFAFIAEWYDPNASLLRRYELLFYPVDGSVEMHDVKNRRTFLKRTKYEDLRLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAISEGMLGKNLIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEI------QQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTDLPEDGLLEVQYFFKILD 394          
BLAST of Nucleoside diphosphate kinase 7 vs. UniProt
Match: sp|P90666|TXND3_HELCR (Thioredoxin domain-containing protein 3 homolog OS=Heliocidaris crassispina OX=1043166 GN=NME8 PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 2.308e-39
Identity = 99/287 (34.49%), Postives = 155/287 (54.01%), Query Frame = 1
Query:  340 EKTLGIIKPQALSN-MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGL-DSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
            EKTL +I+P AL +   +++  I++A F +   KM QL  +QA E Y   +G P  E+L+  MTSG ++A  L +E+A+  W + IGPT    AK +AP SLRA+Y + D+  N +HGS+ V+ A +E+ FFF              ++T AV+KP      +  +II  I  AGF I+  R   L+K  A +    ++G    Y  ++  + SG  + M +S       + A   +R  +GP DP+ AR   P +LRA+ GKD + N +H +  PE+A+  ++  F
Sbjct:  356 EKTLALIRPSALKDHKDEMLQKIQEAGFEVCLQKMVQLTEDQAKEFYKEQEGTPHFEDLIREMTSGEVLALGLAKESAIQSWREFIGPTTIDEAKEKAPDSLRAQYSIPDTQVNVVHGSDSVDTAEKELGFFFP------------KQTTLAVIKPDAAGEHKE-AIIEKIKEAGFNISLQRDVELNKELASKLYLEHEG-KEFYENLIDHMSSGLSMVMVLS------REDAVDGWRTLMGPTDPDYAREHAPESLRALLGKDVLQNAVHGSSNPEEAKTRIERLF 622          

HSP 2 Score: 124.79 bits (312), Expect = 2.644e-29
Identity = 93/295 (31.53%), Postives = 152/295 (51.53%), Query Frame = 1
Query:  340 EKTLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMR----ENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSI-PNTARFS--KSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYG-KDKVCNGIHCTDLPEDAELEVQYFF 1194
            E T+ +IKP A++N  +  II+ IE+  F I+  +   L  ++A E Y  H+ +   E L+  M SGP     L R    E  V+   +++GP D  +AK EAP SLRA++G D   N +HG++    A RE+ F        I P T      + T A+++P  + + +   ++  I  AGFE+   +M  L +  A+EF +  +G    +  ++ E+ SG  +A+       L  + A +S+REF+GP   + A+   P++LRA Y   D   N +H +D  + AE E+ +FF
Sbjct:  202 EVTVVLIKPDAVANGHVDSIIAKIEEHGFEILTTEDKTLTEDEAREFYKQHEEEEHFEVLVTFMASGPSKILVLTRGDTGEGVVSEVRNLLGPKDIEVAKEEAPDSLRAQFGTDKKMNAMHGADSKETAAREMAFLLPNFSVPIVPGTGPPPTIEKTLALIRPSALKDHK-DEMLQKIQEAGFEVCLQKMVQLTEDQAKEFYKEQEGT-PHFEDLIREMTSGEVLAL------GLAKESAIQSWREFIGPTTIDEAKEKAPDSLRAQYSIPDTQVNVVHGSDSVDTAEKELGFFF 488          
BLAST of Nucleoside diphosphate kinase 7 vs. TrEMBL
Match: gnl|BL_ORD_ID|15745065 (tr|R7TZK1|R7TZK1_CAPTE Nucleoside diphosphate kinase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_160391 PE=3 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 1.261e-140
Identity = 195/375 (52.00%), Postives = 264/375 (70.40%), Query Frame = 1
Query:   82 RYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            RY F  EWYD    IIRKY   F+P D+ +EMFD+KN + FLKR+K E ++L DL++G++VN+LSRQL  +D+GD+ TR  LS  TE+TL +IKP A+   G I+  + ++   I  LKM  L R+ A   YA H+ KPF   L++ M+SGPI+A ELM  NA+  W D+IGPTD  +A+ +A  S+RA++G D+  N  HGS+   +A  E+ FFF   G    NTA F+  TC VVKPH V +G +GSI+  I  +GF+I+A++MF+++KANAEEF EVYKGV+ EY +++ EL SGPC+A+E+      + Q AQK+FRE  GP DPE+A+HLRP +LRA++GKDK+ N +HCTDLPEDA LEVQYFFQILD
Sbjct:    5 RYCFITEWYDPNGAIIRKYQFFFYPNDSTIEMFDIKNRKLFLKRSKAENIKLGDLYIGSTVNVLSRQLNFIDYGDDHTRTKLSRQTERTLALIKPDAIDKKGAILEQVCRSGLYITQLKMCSLSRDLAQSFYAEHQHKPFFNALVDFMSSGPIVAMELMGTNAIAAWRDLIGPTDSAVARSQAATSIRARFGQDNTKNACHGSDSPASAASELEFFFPSKGAGPGNTATFTDGTCCVVKPHAVADGSVGSILSKIEESGFQISAMKMFHMEKANAEEFYEVYKGVVQEYQSMVTELTSGPCLALEV------RAQDAQKNFREMCGPHDPEIAKHLRPRSLRALFGKDKIKNAVHCTDLPEDATLEVQYFFQILD 373          

HSP 2 Score: 96.6709 bits (239), Expect = 3.548e-18
Identity = 49/145 (33.79%), Postives = 86/145 (59.31%), Query Frame = 1
Query:  322 NLSSHTEKTLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGK-PFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGC 747
            N ++ T+ T  ++KP A+++  +G I+S IE++ F I  +KMF +++  A E Y  +KG     ++++  +TSGP +A E+  ++A   + +M GP DP +AK   P SLRA +G D + N +H ++    A  E+ +FF+   C
Sbjct:  230 NTATFTDGTCCVVKPHAVADGSVGSILSKIEESGFQISAMKMFHMEKANAEEFYEVYKGVVQEYQSMVTELTSGPCLALEVRAQDAQKNFREMCGPHDPEIAKHLRPRSLRALFGKDKIKNAVHCTDLPEDATLEVQYFFQILDC 374          
BLAST of Nucleoside diphosphate kinase 7 vs. TrEMBL
Match: gnl|BL_ORD_ID|23509933 (tr|A0A210R3D6|A0A210R3D6_MIZYE Nucleoside diphosphate kinase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT20943 PE=3 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 2.469e-140
Identity = 201/377 (53.32%), Postives = 274/377 (72.68%), Query Frame = 1
Query:   76 ELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGC-SIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQIL 1203
            E RY F  EWYD  A + R+Y  +++ KD  VEMFD+KN R FLKRTK E LRL DL++ N++N+ SRQL  VD+GDE+TRR L++  E+TLG+IKP A+  MGQ++  + K  F++ N+KM QL R +A+E Y  H+GK   + LL  +TSGP++A ELM  + V+ W D++GPTDP  A++ AP+S+RA++G DS+ N  HGS+ + AA RE+ FFF  N   +  NTA+FS+ TC V+KPH V +G  G II  I++AGFEI+ L++F+++KANAEEF EVYKGV+ EY A++ EL SGPC+ +E    IR K+  A K+FR+ VGP DPE+ARHLR  TLRA +G DK+ N +HCTDLPED +LEV+YFF+IL
Sbjct:    6 EDRYCFIAEWYDIHAALKRRYQFMYYVKDKTVEMFDVKNQRVFLKRTKMEDLRLEDLYIKNTLNVFSRQLTFVDYGDEFTRRRLANKKERTLGLIKPDAVPKMGQVLDVLFKNGFLVANMKMCQLSRHEAMEFYKEHQGKTHFDTLLTYITSGPVIAIELMGSDCVSQWTDLLGPTDPAAARQNAPNSIRARFGKDSIQNACHGSDSIGAAARELEFFFPSNDTPARRNTAKFSECTCCVIKPHAVKSGAAGDIISQIMDAGFEISMLQVFHMEKANAEEFYEVYKGVVQEYGAMVNELTSGPCITLE----IRAKD--APKAFRDMVGPADPEIARHLRSRTLRAKFGIDKIQNAVHCTDLPEDGQLEVEYFFRIL 376          
BLAST of Nucleoside diphosphate kinase 7 vs. TrEMBL
Match: gnl|BL_ORD_ID|175069709 (tr|A0A2I4CES8|A0A2I4CES8_9TELE Nucleoside diphosphate kinase 7 OS=Austrofundulus limnaeus OX=52670 GN=nme7 PE=3 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 2.368e-139
Identity = 200/379 (52.77%), Postives = 263/379 (69.39%), Query Frame = 1
Query:   73 IELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFREN-GCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            +E R+AF  EWYD AA ++R+Y L F+PKD  VEMFD+KN R FL+RTK + L   DL VGN VN+ SRQL ++D+GD++T   L S  E+TL +IKP  ++ MG +I  I  ++ ++   KM  L   QA + Y  H+ KPF  NL+   +SGP++A ELM + AV+ W  ++GP D   A++EAP S+RA++G D V N  HGSE ++AA RE+ FFF    G   PNTA F+  TC ++KPH ++ G  G I+ SI  AGFEI+AL MFN+D+ANAEEF EVYKGV+ EY +++ EL SGPC+ +EI          A ++FREF GP DPE+ARHLRPNTLRA+YGKDKV N +HCTDLPED  LEVQYFF+ILD
Sbjct:    1 MEDRFAFLAEWYDPAAGLLRRYQLFFYPKDGSVEMFDVKNQRIFLRRTKYDDLHQEDLFVGNRVNVFSRQLNLIDYGDQYTANKLGSKKERTLALIKPDVVTKMGDVIDLIYSSSLIVTKAKMTTLTWSQAADFYVEHQSKPFFNNLVQFASSGPVVAMELMGDEAVSTWRRLLGPADSAAARKEAPQSIRAQFGTDVVKNVGHGSESLSAAARELEFFFPSTIGHGPPNTATFTDCTCCIIKPHALSEGLAGKILNSISAAGFEISALEMFNVDRANAEEFFEVYKGVVTEYHSMVTELCSGPCMVLEI------HGTDAPRTFREFCGPADPEIARHLRPNTLRALYGKDKVRNAVHCTDLPEDGVLEVQYFFKILD 373          
BLAST of Nucleoside diphosphate kinase 7 vs. TrEMBL
Match: gnl|BL_ORD_ID|173385220 (tr|F1QQX1|F1QQX1_DANRE Nucleoside diphosphate kinase 7 OS=Danio rerio OX=7955 GN=nme7 PE=1 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 4.040e-139
Identity = 198/379 (52.24%), Postives = 269/379 (70.98%), Query Frame = 1
Query:   73 IELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFREN-GCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            +E R+AF  EWYD +A ++R+Y LL++PKD  VEMFD+KN R FL+RTK E L+  DL VGN VNI SRQL ++ +GD++T   L S  E+TL +IKP A+S +G II  I  AN ++   KM +L  +QA + Y  H+ K F  NL+  ++SGP++A ELM + AV+ W  ++GPTD  +A++EA HSLR ++G D   N  HGS+ + +A RE+ +FF    G  + NTA++S  TC ++KPH ++    G I+ SI+  GFEI+AL+MFN+D+ANAEEFLEVYKGV+AEY  ++ EL SGPC+A+EI          A ++FREF GP DPE+ARHLRP TLRA+YGK+K+ NG+HCTDLPED  LEVQYFF+ILD
Sbjct:    1 MEERFAFLAEWYDPSAALLRRYQLLYYPKDGSVEMFDMKNQRTFLRRTKLEELQPEDLFVGNRVNIFSRQLNLISYGDQYTANKLGSKKERTLAMIKPDAVSKVGDIIQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVSSGPVIAMELMGDEAVSTWRKVLGPTDSGVAQKEAAHSLRGQFGTDGTKNAGHGSDSLASAARELEYFFPSTAGHGLSNTAKYSDCTCCIIKPHAISEALTGKILKSIIENGFEISALQMFNMDRANAEEFLEVYKGVVAEYTKMVDELCSGPCMALEIHA------TDAPRTFREFCGPADPEIARHLRPKTLRALYGKNKLQNGVHCTDLPEDGILEVQYFFKILD 373          
BLAST of Nucleoside diphosphate kinase 7 vs. TrEMBL
Match: gnl|BL_ORD_ID|18313835 (tr|A0A267DSF2|A0A267DSF2_9PLAT Nucleoside diphosphate kinase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031786g1 PE=3 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 4.620e-139
Identity = 202/378 (53.44%), Postives = 266/378 (70.37%), Query Frame = 1
Query:   82 RYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENG-CSIPNTARFSKS-TCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILDK 1209
            R+A   EW+D  A I+R+Y LL++  DN VEMFDLKN R FL+RT  + L+L+DL +GN+VN+LSRQL   D+GD++T+R L   TE+T  ++KP A +  G I+   + A   + NL+M +L R +A+E Y  H+GK F+  LL  +TSGPIMA ELM  +AV  W  +IGPTDP  A++EAP SLRA++G D+ +N +HGS+   +A RE+ FFF  +G   + NT+   +  TC +VKPH V +G LG I+ +I  AGF I A+ MF LDKANAEEFLEVYKGV+AEY++++ EL SGPCV +EI     +      K FREF GP DPE+ARHLRP TLRA +GKDKV N +HCTDLPED +LEVQYFF+ILDK
Sbjct:    4 RFALIAEWFDPQAAIVRRYQLLYYTADNTVEMFDLKNRRSFLRRTTVDNLKLADLFIGNTVNVLSRQLTFTDYGDDFTKRRLGQRTERTCALVKPAAFAKAGAILEAAQAAGLSVANLRMGRLDRSEALEFYREHEGKSFLPQLLGSITSGPIMAIELMGPDAVQAWRSLIGPTDPARARQEAPTSLRARFGQDATNNAVHGSDSEASAARELGFFFPASGPARVANTSGGGEGCTCGLVKPHAVASGCLGQILSAIAEAGFSINAIAMFRLDKANAEEFLEVYKGVVAEYSSMVAELTSGPCVVLEIGGPGDV-----YKEFREFCGPADPEIARHLRPRTLRARFGKDKVQNAVHCTDLPEDTQLEVQYFFEILDK 376          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Cavefish
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:103037659])

HSP 1 Score: 408.297 bits (1048), Expect = 8.090e-141
Identity = 198/379 (52.24%), Postives = 267/379 (70.45%), Query Frame = 1
Query:   73 IELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFREN-GCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            +E R+AF  EWYD +A ++R+Y LLF+PKD  VEMFD+KN R FL+RTK + L   DL VGN VN+ SRQL ++D+GD++T   L S  E+TL +IKP A++ +G II  I  A  ++   +M +L  +QA + Y  H+ K F  NL+  ++SGP++  ELM + AV+ W  ++GPTD  +A+++A  SLRA++G D   N  HGS+ + +A RE+ FFF    G S PNTA+FS  TC ++KPH V+ G  G I+ SI  AGFEI+AL+MF+LD+ANAEEFLEVYKGV+ EY +++ EL SGPC+A+EI +        A + FR F GP DPE+ARHLRP TLRA+YGK+KV N +HCTDLPED  LEVQYFF+ILD
Sbjct:    1 MEERFAFLAEWYDPSAALLRRYQLLFYPKDGSVEMFDVKNQRTFLRRTKYDELHPEDLFVGNRVNVFSRQLNLIDYGDQYTANKLGSQKERTLAMIKPDAVTKVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFFPSTAGHSPPNTAKFSDCTCCIIKPHAVSEGLTGKILNSITEAGFEISALQMFSLDRANAEEFLEVYKGVVTEYTSLVAELCSGPCMALEILS------TDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQNAVHCTDLPEDGLLEVQYFFKILD 373          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Cavefish
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:103037659])

HSP 1 Score: 364.77 bits (935), Expect = 3.093e-124
Identity = 179/345 (51.88%), Postives = 241/345 (69.86%), Query Frame = 1
Query:  175 MFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFREN-GCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            MFD+KN R FL+RTK + L   DL VGN VN+ SRQL ++D+GD++T   L S  E+TL +IKP A++ +G II  I  A  ++   +M +L  +QA + Y  H+ K F  NL+  ++SGP++  ELM + AV+ W  ++GPTD  +A+++A  SLRA++G D   N  HGS+ + +A RE+ FFF    G S PNTA+FS  TC ++KPH V+ G  G I+ SI  AGFEI+AL+MF+LD+ANAEEFLEVYKGV+ EY +++ EL SGPC+A+EI +        A + FR F GP DPE+ARHLRP TLRA+YGK+KV N +HCTDLPED  LEVQYFF+ILD
Sbjct:    1 MFDVKNQRTFLRRTKYDELHPEDLFVGNRVNVFSRQLNLIDYGDQYTANKLGSQKERTLAMIKPDAVTKVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFFPSTAGHSPPNTAKFSDCTCCIIKPHAVSEGLTGKILNSITEAGFEISALQMFSLDRANAEEFLEVYKGVVTEYTSLVAELCSGPCMALEILS------TDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQNAVHCTDLPEDGLLEVQYFFKILD 339          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Cavefish
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:103037659])

HSP 1 Score: 326.635 bits (836), Expect = 1.501e-109
Identity = 166/346 (47.98%), Postives = 226/346 (65.32%), Query Frame = 1
Query:  172 EMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFREN-GCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            ++FD+KN R FL+RTK + L   DL VGN VN+ SRQL ++D+GD++T   L S  E+TL +IKP A++ +G II  I  A  ++   +M +L  +QA + Y  H+ K F  NL+  ++SGP++  ELM + AV+ W  ++GPTD  +A+++A  SLRA++G D   N  HGS+ + +A RE+ FFF    G S PNTA+FS  TC ++KPH V+ G+   I  S+            F+LD+ANAEEFLEVYKGV       + EL SGPC+A+EI +        A + FR F GP DPE+ARHLRP TLRA+YGK+KV N +HCTDLPED  LEVQYFF+ILD
Sbjct:    3 KLFDVKNQRTFLRRTKYDELHPEDLFVGNRVNVFSRQLNLIDYGDQYTANKLGSQKERTLAMIKPDAVTKVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFFPSTAGHSPPNTAKFSDCTCCIIKPHAVSEGK---IQFSL-----------QFSLDRANAEEFLEVYKGV--VTEYTVTELCSGPCMALEILS------TDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQNAVHCTDLPEDGLLEVQYFFKILD 326          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Cavefish
Match: nme8 (thioredoxin domain-containing protein 3 homolog [Source:NCBI gene;Acc:103039823])

HSP 1 Score: 142.51 bits (358), Expect = 1.688e-36
Identity = 92/287 (32.06%), Postives = 146/287 (50.87%), Query Frame = 1
Query:  340 EKTLGIIKPQ-ALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKY-GLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
            E+TL +I+P  A  N   I++ I KA F +   K   L  EQ    Y+ H+ + +   LL  MTSGP++A  L ++ AV  W +++GP DP  AK + P SLRA++ G     N LHGS+ +  A +EI+FFF +            + T AV+KP   +      I+  I   GF I+ L+   L +  AEEF   ++     ++ ++  +  GPC      T + L  + A + +R  +GP DP  A+   P +LRA + KD + N +H +   E A+ ++ + F
Sbjct:  295 ERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPK------------EQTLAVIKPD-TSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRD-KPFFSQLVDYMCRGPC------TMLILTKENAVEEWRAMMGPTDPNDAKENAPGSLRARFAKDILENAVHGSSNTEHAQEKIHFLF 561          

HSP 2 Score: 124.405 bits (311), Expect = 2.923e-30
Identity = 90/309 (29.13%), Postives = 145/309 (46.93%), Query Frame = 1
Query:  346 TLGIIKPQ--ALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMR----ENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF---------RENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALR----------MFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVC-NGIHCTDLPEDAELEVQYFF 1194
            T+ IIKP   A     +II  I+ A F I+  +   L   +A E Y     +P+ + L+  M+SGP     + +    ++ +  W + +GPTD   AKRE P SLRA+YG +++ N +HGS     A RE+ FFF         R +G + P      + T A+++P      +   I+  I  AGF++   +          +F  +  N E F  + K +            SGP +A+       L  Q A + +R  +GP DP+ A+  +P +LRA +  +  C N +H +   E+AE E+ +FF
Sbjct:  138 TVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVISKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETLFNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVER-TLALIRPDTARENR-EMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSM-----------TSGPVLAL------ALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFF 427          

HSP 3 Score: 105.916 bits (263), Expect = 3.726e-24
Identity = 55/134 (41.04%), Postives = 75/134 (55.97%), Query Frame = 1
Query:  340 EKTLGIIKPQ-ALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
            E+TL +IKP  +  +  +I+ +I+   F I  L+   L RE A E Y  H+ KPF   L++ M  GP     L +ENAV  W  M+GPTDP  AK  AP SLRA++  D + N +HGS     A  +I+F F E
Sbjct:  430 EQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYMCRGPCTMLILTKENAVEEWRAMMGPTDPNDAKENAPGSLRARFAKDILENAVHGSSNTEHAQEKIHFLFGE 563          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Cavefish
Match: nme8 (thioredoxin domain-containing protein 3 homolog [Source:NCBI gene;Acc:103039823])

HSP 1 Score: 142.895 bits (359), Expect = 1.696e-36
Identity = 92/287 (32.06%), Postives = 146/287 (50.87%), Query Frame = 1
Query:  340 EKTLGIIKPQ-ALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKY-GLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
            E+TL +I+P  A  N   I++ I KA F +   K   L  EQ    Y+ H+ + +   LL  MTSGP++A  L ++ AV  W +++GP DP  AK + P SLRA++ G     N LHGS+ +  A +EI+FFF +            + T AV+KP   +      I+  I   GF I+ L+   L +  AEEF   ++     ++ ++  +  GPC      T + L  + A + +R  +GP DP  A+   P +LRA + KD + N +H +   E A+ ++ + F
Sbjct:  319 ERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPK------------EQTLAVIKPD-TSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRD-KPFFSQLVDYMCRGPC------TMLILTKENAVEEWRAMMGPTDPNDAKENAPGSLRARFAKDILENAVHGSSNTEHAQEKIHFLF 585          

HSP 2 Score: 124.405 bits (311), Expect = 2.756e-30
Identity = 90/309 (29.13%), Postives = 145/309 (46.93%), Query Frame = 1
Query:  346 TLGIIKPQ--ALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMR----ENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF---------RENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALR----------MFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVC-NGIHCTDLPEDAELEVQYFF 1194
            T+ IIKP   A     +II  I+ A F I+  +   L   +A E Y     +P+ + L+  M+SGP     + +    ++ +  W + +GPTD   AKRE P SLRA+YG +++ N +HGS     A RE+ FFF         R +G + P      + T A+++P      +   I+  I  AGF++   +          +F  +  N E F  + K +            SGP +A+       L  Q A + +R  +GP DP+ A+  +P +LRA +  +  C N +H +   E+AE E+ +FF
Sbjct:  162 TVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVISKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETLFNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVER-TLALIRPDTARENR-EMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSM-----------TSGPVLAL------ALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFF 451          

HSP 3 Score: 106.301 bits (264), Expect = 3.652e-24
Identity = 55/134 (41.04%), Postives = 75/134 (55.97%), Query Frame = 1
Query:  340 EKTLGIIKPQ-ALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
            E+TL +IKP  +  +  +I+ +I+   F I  L+   L RE A E Y  H+ KPF   L++ M  GP     L +ENAV  W  M+GPTDP  AK  AP SLRA++  D + N +HGS     A  +I+F F E
Sbjct:  454 EQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYMCRGPCTMLILTKENAVEEWRAMMGPTDPNDAKENAPGSLRARFAKDILENAVHGSSNTEHAQEKIHFLFGE 587          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Sea Lamprey
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:58120])

HSP 1 Score: 110.923 bits (276), Expect = 3.638e-29
Identity = 56/134 (41.79%), Postives = 78/134 (58.21%), Query Frame = 1
Query:  346 TLGIIKPQALSN---MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
            TL ++KP AL++      +  D+ K  F+IV  K  +LKR  +   YA HKGK F + L+  M SGPI  + L   +AV GW +++GPT    A   AP S+RA YGL    N  HGS+   +A++EI+FFF E
Sbjct:   13 TLALLKPDALAHGIAWEAVHQDVLKNKFLIVKSKELRLKRSDSERFYAAHKGKFFFQRLVEFMASGPIRVYVLAHHDAVRGWRELMGPTKVFRAVHTAPESIRACYGLTDTRNTTHGSDSSASALQEISFFFPE 146          

HSP 2 Score: 46.9802 bits (110), Expect = 1.553e-6
Identity = 37/143 (25.87%), Postives = 65/143 (45.45%), Query Frame = 1
Query:  781 TCAVVKPHLVTNG-QLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            T A++KP  + +G    ++   ++   F I   +   L ++++E F   +KG    +  ++  + SGP     I   + L +  A + +RE +GP     A H  P ++RA YG     N  H +D    A  E+ +FF   D
Sbjct:   13 TLALLKPDALAHGIAWEAVHQDVLKNKFLIVKSKELRLKRSDSERFYAAHKG-KFFFQRLVEFMASGP-----IRVYV-LAHHDAVRGWRELMGPTKVFRAVHTAPESIRACYGLTDTRNTTHGSDSSASALQEISFFFPEFD 148          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008106.1 (pep scaffold:Pmarinus_7.0:GL476850:19893:22834:-1 gene:ENSPMAG00000007330.1 transcript:ENSPMAT00000008106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 6.695e-20
Identity = 42/114 (36.84%), Postives = 64/114 (56.14%), Query Frame = 1
Query:  391 IISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF 732
            ++  I++A F I   K   L  EQA E Y  H+G+ +   L+  MT GP +   L RE+AV  W  ++GP DP +A++ AP SLRA++    + N LHG+  ++ A   I+  F
Sbjct:    7 VLGAIKEAGFHIAMQKEVILTEEQAREFYREHEGQDYFGTLVKHMTRGPSLMLVLNREDAVEEWRRLMGPADPDVARKTAPESLRARFARSLLENALHGASNLHHAQENIHLLF 120          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Sea Lamprey
Match: nme3 (NME/NM23 nucleoside diphosphate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-000210-34])

HSP 1 Score: 61.2326 bits (147), Expect = 1.496e-11
Identity = 40/134 (29.85%), Postives = 63/134 (47.01%), Query Frame = 1
Query:  340 EKTLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFR 735
            E+TL  IKP  +    MG I+   E     +V +K  +       + Y   K K F  +L+  M SGP++A        V     M+G TDP      AP ++R  + +D   N +HGS+   +A +EI+ +F+
Sbjct:   21 ERTLLAIKPDGVQRRLMGDIVKRFEGKGLKLVAMKFLKPPVALLQQHYIDLKDKAFYSSLVQFMNSGPVLAMVWEGNGVVRTCRRMLGETDP---ADSAPGTIRGDFCIDIGRNVIHGSDSEESAQKEISLWFQ 151          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Yeast
Match: YNK1 (Nucleoside diphosphate kinase; catalyzes the transfer of gamma phosphates from nucleoside triphosphates, usually ATP, to nucleoside diphosphates by a mechanism that involves formation of an autophosphorylated enzyme intermediate; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001550])

HSP 1 Score: 88.5817 bits (218), Expect = 1.747e-21
Identity = 48/141 (34.04%), Postives = 81/141 (57.45%), Query Frame = 1
Query:  325 LSSHTEKTLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFREN 741
            +SS TE+T   +KP  +    + QI+S  EK  + +V +K+ +   +   + YA H GKPF   +++ M SGPI+A     ++ V     ++G T+PL +   AP ++R  +G+D   N  HGS+ V++A REIN +F++ 
Sbjct:    1 MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGS---APGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKE 138          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Nematostella
Match: EDO34502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP47])

HSP 1 Score: 377.867 bits (969), Expect = 2.038e-129
Identity = 187/376 (49.73%), Postives = 259/376 (68.88%), Query Frame = 1
Query:   82 RYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXX-SGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            R+AF  EWYD  A + RKY LLF+  DN VEM+D+KN R FLKR+KC+  +  D ++G  VNI SRQL+I D+ D+ T   L +  EKTL +IKP A+  +G I+  I++A F +   KM +L R++A + Y  H  +PF + L+  ++SGP++AFEL    AV+ W  ++GPTD   A+ +AP S+RAK+G D+  N  HGS+   +A RE++FFF +      NTA  +  T  VVKPH V +G  G I+L+I +AGFEI+AL+MF+L++ANAEEF EVYKGV+ EY   ++E + SGPC+A+E+      + Q   K+FR+FVGP DPE+ARHLRP +LRA +GKDK+ N +HCTDLPED  LEV+YFF+ILD
Sbjct:    3 RFAFLAEWYDPQAALTRKYQLLFYASDNSVEMYDIKNRRLFLKRSKCDQYKADDFYIGAIVNIHSRQLKITDYCDKHTTNRLKNINEKTLAMIKPDAVGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDKRR---QNTAVLNNCTLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFHEVYKGVVNEYERNMVEELCSGPCLAVEV------RGQDVTKTFRDFVGPADPEIARHLRPKSLRAKFGKDKIKNAVHCTDLPEDGLLEVEYFFKILD 369          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Nematostella
Match: EDO50065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFA5])

HSP 1 Score: 282.337 bits (721), Expect = 3.545e-93
Identity = 136/285 (47.72%), Postives = 191/285 (67.02%), Query Frame = 1
Query:   82 RYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGV 936
            R+AF  EWYD  A + RKY LLF+  DN VEM+D+KN R FLKR+KC+  +  D ++G  VNI SRQL+I D+ D+ T   L +  EKTL +IKP A+  +G I+  I++A F +   KM +L R++A + Y  H  +PF + L+  ++SGP++AFEL    AV+ W  ++GPTD   A+ +AP S+RAK+G D+  N  HGS+   +A RE++FFF +      NTA  +  T  VVKPH V +G  G I+L+I +AGFEI+AL+MF+L++ANAEEF EVYKGV
Sbjct:    3 RFAFLAEWYDPQAALTRKYQLLFYASDNSVEMYDIKNRRLFLKRSKCDQYKADDFYIGAIVNIHSRQLKITDYCDKHTTNRLKNINEKTLAMIKPDAVGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDKRR---QNTAVLNNCTLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFHEVYKGV 284          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Nematostella
Match: EDO42234 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S268])

HSP 1 Score: 159.073 bits (401), Expect = 6.373e-43
Identity = 106/287 (36.93%), Postives = 152/287 (52.96%), Query Frame = 1
Query:  340 EKTLGIIKPQAL-SNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGL-DSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
            ++TL +I+P AL S    I+S I++A F I   K   L REQA E Y+ HK + F + L+  M+SGP+MA  L RE+A+ GW  M+GP +   AK EAP SLRA++ + DS  N LHGS+    A +EI  FF              +ST AV+KP  V   Q   I   I  AGF+I   +   L K  A +F   ++G    +  +   + SGP + M +S       + A   +R  +GP+DPE A+ + P ++RA  GKD + N +H    PE A   ++ FF
Sbjct:  285 QRTLALIRPDALRSRRESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKDQEFFDTLVTNMSSGPMMALCLAREDAIEGWRGMLGPKEVEKAKDEAPESLRAQFQVEDSPINPLHGSDTAENAEKEIQKFFP------------MQSTVAVIKPE-VEPDQRELIKQRIKEAGFKIQLQKEVTLSKELASQFYHEHEG-KDFFEGLTDYMSSGPTMFMVLS------KEDAVSGWRSLMGPVDPEQAKEMAPESIRAALGKDVMKNVVHGPSDPEKAGKVIKEFF 551          

HSP 2 Score: 145.591 bits (366), Expect = 3.429e-38
Identity = 97/299 (32.44%), Postives = 160/299 (53.51%), Query Frame = 1
Query:  346 TLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMR--------ENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTA-----RFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYG-KDKVCNGIHCTDLPEDAELEVQYFF 1194
            T+ +IKP A+    + +II  +E+A   ++ ++   L RE+A E Y  H+G    + L+  M+SGP+M   L +        E  ++ + ++IGP D  +AK EAP+SLRA YG D+V N +HG +   +A RE+ FFF +   + P  A     R  + T A+++P  + + +  SI+  I  AGFEI   +  +L +  AEEF   +K     +  ++  + SGP +A+       L  + A + +R  +GP + E A+   P +LRA +  +D   N +H +D  E+AE E+Q FF
Sbjct:  129 TVAVIKPDAVKAGLVEEIIRKVEEAGIEVLKMEERTLTREEAAEFYKQHEGTEHFDQLVEFMSSGPLMTLALSKAGETPEALEGVIDNFRELIGPKDVNVAKEEAPNSLRAMYGTDTVMNAVHGCDSNESAARELAFFFPD--FAAPTVANKRKKRQLQRTLALIRPDALRS-RRESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKD-QEFFDTLVTNMSSGPMMAL------CLAREDAIEGWRGMLGPKEVEKAKDEAPESLRAQFQVEDSPINPLHGSDTAENAEKEIQKFF 417          

HSP 3 Score: 98.9821 bits (245), Expect = 2.596e-22
Identity = 58/164 (35.37%), Postives = 82/164 (50.00%), Query Frame = 1
Query:  340 EKTLGIIKPQALSNMGQIISD-IEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLG 828
            + T+ +IKP+   +  ++I   I++A F I   K   L +E A + Y  H+GK F E L + M+SGP M   L +E+AV+GW  ++GP DP  AK  AP S+RA  G D + N +HG      A + I  FF       P        T   V+P     GQ G
Sbjct:  420 QSTVAVIKPEVEPDQRELIKQRIKEAGFKIQLQKEVTLSKELASQFYHEHEGKDFFEGLTDYMSSGPTMFMVLSKEDAVSGWRSLMGPVDPEQAKEMAPESIRAALGKDVMKNVVHGPSDPEKAGKVIKEFF-------PEAKILPDGTVKKVQPDKAEEGQEG 576          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Nematostella
Match: EDO39201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAT1])

HSP 1 Score: 121.324 bits (303), Expect = 3.154e-32
Identity = 63/148 (42.57%), Postives = 89/148 (60.14%), Query Frame = 1
Query:  334 HTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSK 777
            H E+TL +IKP A+    +I   I +  F I+  +   L  EQ  + YA H GK F  +L+  M+SGPIMA  L RENA++ W  +IGPT+   A+ +AP SLRA YG DS  N LHGS+   +A +EI+FFF ++     +T + +K
Sbjct:   16 HIERTLALIKPDAVHKSDEIEEIILQHGFTILQKRRAHLTPEQTSDFYAEHYGKMFFPSLVAYMSSGPIMALVLARENAISYWRQLIGPTNTQKARDQAPESLRAIYGTDSTRNALHGSDGTVSADKEIHFFFPDSIVEPVSTGQAAK 163          

HSP 2 Score: 56.6102 bits (135), Expect = 2.310e-9
Identity = 43/155 (27.74%), Postives = 73/155 (47.10%), Query Frame = 1
Query:  733 RENGCSIPNTARFSKSTCAVVKPHLV-TNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
             E   + P  A   + T A++KP  V  + ++  IIL     GF I   R  +L      +F   + G    + +++  + SGP +A+       L  + A   +R+ +GP + + AR   P +LRA+YG D   N +H +D    A+ E+ +FF
Sbjct:    4 EEKPTAFPPPAIHIERTLALIKPDAVHKSDEIEEIIL---QHGFTILQKRRAHLTPEQTSDFYAEHYG-KMFFPSLVAYMSSGPIMAL------VLARENAISYWRQLIGPTNTQKARDQAPESLRAIYGTDSTRNALHGSDGTVSADKEIHFFF 148          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Nematostella
Match: EDO30526 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0J8])

HSP 1 Score: 96.6709 bits (239), Expect = 8.120e-24
Identity = 53/134 (39.55%), Postives = 75/134 (55.97%), Query Frame = 1
Query:  346 TLGIIKPQALSN--MGQIISDIEKAN-FVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRE 738
            TL I+KP  + +    Q + +I   N F+IV  ++ +  RE A   Y  HKG+ F   L+  M+SGP+ A  L RENA+  W  ++GPT    A+  AP S+RA YG+    N  HGS+   +A +EI FFF E
Sbjct:   11 TLAILKPDLMLHPVRTQAVKNILVDNQFMIVRSRVLKWSREDAECFYTEHKGRFFYNRLVGFMSSGPMTAMILGRENAITHWRKLMGPTHAYKARSIAPKSIRALYGISDTRNATHGSDSDESARKEIEFFFPE 144          

HSP 2 Score: 56.225 bits (134), Expect = 1.466e-9
Identity = 42/143 (29.37%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  781 TCAVVKPHLVTNGQLGSIILSI-VNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            T A++KP L+ +      + +I V+  F I   R+    + +AE F   +KG    Y  ++  + SGP  AM       L  + A   +R+ +GP     AR + P ++RA+YG     N  H +D  E A  E+++FF   D
Sbjct:   11 TLAILKPDLMLHPVRTQAVKNILVDNQFMIVRSRVLKWSREDAECFYTEHKG-RFFYNRLVGFMSSGPMTAMI------LGRENAITHWRKLMGPTHAYKARSIAPKSIRALYGISDTRNATHGSDSDESARKEIEFFFPEFD 146          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Medaka
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:101164143])

HSP 1 Score: 395.971 bits (1016), Expect = 4.435e-136
Identity = 190/379 (50.13%), Postives = 260/379 (68.60%), Query Frame = 1
Query:   73 IELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFREN-GCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILD 1206
            +E RYAF  EW+D  A ++R++ L ++P D  +EMFD+KN R FLKR K + +   DL VGN VN+ SRQL ++D+GD++TR  L S  E+TL +IKP  ++ +G ++  +  +N ++   KM +L   QA + Y  H+ K F  NL+  M+SGP++A E+M + A + W  ++GP D   A+REAP S+RA +G D + N  HGSE ++AA RE+ FFF    G    NTA F+  TC ++KPH V++G  G I+ SI  AGFEI+AL+MFN+++ NAEEF EVYKGV+ EY  ++ EL SGPC+A+EI      +     K+FREF GP DPE+ARHLRPNTLRA+YGKDKV N +HCTDLPED  LEVQYFF+ILD
Sbjct:    1 MEDRYAFLAEWFDPIAALMRRFQLFYYPNDGSMEMFDVKNQRVFLKRIKYDDIHPRDLFVGNRVNVFSRQLNLIDYGDQYTRNKLGSKKERTLALIKPDVVTKIGDVMELVYSSNLIVTKAKMTRLSWSQAADFYMEHQSKSFFNNLVQFMSSGPVVAMEIMGDEATSVWRKLLGPADSAAARREAPQSIRAHFGTDGLQNVGHGSESLDAAARELEFFFPSAIGHGPSNTATFTDCTCCIIKPHAVSDGLTGKILNSISAAGFEISALQMFNMERVNAEEFYEVYKGVVLEYPGMVTELCSGPCMALEI------RGTDTPKTFREFCGPADPEIARHLRPNTLRALYGKDKVRNAVHCTDLPEDGVLEVQYFFKILD 373          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Medaka
Match: nme8 (thioredoxin domain-containing protein 6 [Source:NCBI gene;Acc:101170553])

HSP 1 Score: 122.865 bits (307), Expect = 7.408e-30
Identity = 105/372 (28.23%), Postives = 175/372 (47.04%), Query Frame = 1
Query:  109 DSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSD-LHVGNSVNILSRQL-------RIVDFGDEWTRRNLSSHTEKTLGIIKPQ-ALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVS-NGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
            DS+ +++  ++    P D    + + +  +P   R +     L + +H     N  SR+L       R+   G+E          E+TL +I+P  A  N  +I++ I KA F +   +   L  EQ   LY  H  + +   LL  MTSGP+ A  L  + AV+ W ++IGP+D   AK E P  LRA++ +++   + +HGSE   AA REI+FFF +            ++T AV+K H        +I+  I + GF +T  +   L +  AEE  + +K     +  ++  +  G C+ +       L  + A + +R  +GP DP  A+     +LRA +G D + N +H +   + AE E+Q  F
Sbjct:  234 DSSVSVLPAWLEFMGPTD----VSEARRAKPECLRAQYGTETLHNAVHGSEDSNHASRELAFFFPNFRVEQDGEE-------ERVERTLALIRPGLARENREEILARIHKAGFTVSLQREVMLTEEQVRLLYFQHINEDYFPALLQSMTSGPVAAMVLAGKEAVHHWKNIIGPSDLDKAKAENPECLRAQFPVENEPISHIHGSEDQEAAEREISFFFPK------------QNTLAVIK-HEAMEQHRETILEEIRDRGFSVTQQKEMVLSRELAEELYKEHKE-KPFFTKLVDYICQGHCLML------VLTKENAVEEWRVMMGPSDPAKAKETSTESLRARFGSDILQNSVHGSSNVQHAEEEIQLIF 574          

HSP 2 Score: 110.153 bits (274), Expect = 1.448e-25
Identity = 83/300 (27.67%), Postives = 139/300 (46.33%), Query Frame = 1
Query:  346 TLGIIKPQALSN--MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENA----VNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEIT----------ALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYG-KDKVCNGIHCTDLPEDAELEVQYFF 1194
            T+ IIKP A+S+    +II  I+++ F I+  K  +L   +A   Y     +P  ++L+  M+SG      L   ++    +  WL+ +GPTD   A+R  P  LRA+YG +++ N +HGSE  N A RE+ FFF              + T A+++P L    +   I+  I  AGF ++           +R+      N + F  + + +            SGP  AM       L  + A   ++  +GP D + A+   P  LRA +  +++  + IH ++  E AE E+ +FF
Sbjct:  159 TVAIIKPDAVSHRKTNEIIMKIQESGFEILAHKKHKLTEAEARRFYQHKAEEPCFQDLVQFMSSGHCHILVLSHTDSSVSVLPAWLEFMGPTDVSEARRAKPECLRAQYGTETLHNAVHGSEDSNHASRELAFFFPNFRVEQDGEEERVERTLALIRPGLARENR-EEILARIHKAGFTVSLQREVMLTEEQVRLLYFQHINEDYFPALLQSM-----------TSGPVAAM------VLAGKEAVHHWKNIIGPSDLDKAKAENPECLRAQFPVENEPISHIHGSEDQEAAEREISFFF 440          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Medaka
Match: nme5 (NME/NM23 family member 5 [Source:NCBI gene;Acc:101162299])

HSP 1 Score: 108.227 bits (269), Expect = 3.410e-27
Identity = 56/138 (40.58%), Postives = 74/138 (53.62%), Query Frame = 1
Query:  319 RNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF 732
            R    + E+TL IIKP       +I   I ++   I+  +  QL +EQ  + Y+   GKPF  +L+  M+SGPI+A  L  E+AV  W  +IGP     AK   P  LRAKYG   + N LHGSE    A+REI F F
Sbjct:    2 RGKDKNQERTLAIIKPDIYEKAEKIEGFILQSGLTILQKRRLQLSQEQCSDFYSDCSGKPFFPSLMAYMSSGPIVAMVLACEDAVTRWKSIIGPASITNAKESQPECLRAKYGTSDLKNALHGSESFQEAVREIKFMF 139          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 104.76 bits (260), Expect = 4.891e-26
Identity = 54/143 (37.76%), Postives = 84/143 (58.74%), Query Frame = 1
Query:  313 TRRNLSSHTEKTLGIIKPQALSN---MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF 732
            T R+LS   + TL +IKP A+++   M  +   I   +F IV  K    +R+ + + YA H G+ F + L+  M+SGP+ A+ L RE+A+  W  ++GPT    A+   P+S+RA++GL    N  HGS+   +A REI+FFF
Sbjct:    4 TTRHLSRVLQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFF 146          

HSP 2 Score: 53.1434 bits (126), Expect = 6.750e-8
Identity = 41/152 (26.97%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  751 IPNTARFSKS---TCAVVKPHLVTNG-QLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
             P T   S+    T AV+KP  V +   + ++   I++  F+I   +    ++ ++E+F   + G    Y  ++  + SGP  A        L  + A + +R  +GP     AR+  PN++RA +G     N  H +D PE A+ E+ +FF
Sbjct:    2 FPTTRHLSRVLQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSG-RFFYQRLVEFMSSGPMRAYV------LAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFF 146          
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 104.76 bits (260), Expect = 4.891e-26
Identity = 54/143 (37.76%), Postives = 84/143 (58.74%), Query Frame = 1
Query:  313 TRRNLSSHTEKTLGIIKPQALSN---MGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFF 732
            T R+LS   + TL +IKP A+++   M  +   I   +F IV  K    +R+ + + YA H G+ F + L+  M+SGP+ A+ L RE+A+  W  ++GPT    A+   P+S+RA++GL    N  HGS+   +A REI+FFF
Sbjct:    4 TTRHLSRVLQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFF 146          

HSP 2 Score: 53.1434 bits (126), Expect = 6.750e-8
Identity = 41/152 (26.97%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  751 IPNTARFSKS---TCAVVKPHLVTNG-QLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
             P T   S+    T AV+KP  V +   + ++   I++  F+I   +    ++ ++E+F   + G    Y  ++  + SGP  A        L  + A + +R  +GP     AR+  PN++RA +G     N  H +D PE A+ E+ +FF
Sbjct:    2 FPTTRHLSRVLQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSG-RFFYQRLVEFMSSGPMRAYV------LAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFF 146          
BLAST of Nucleoside diphosphate kinase 7 vs. Planmine SMEST
Match: SMESG000069915.1 (SMESG000069915.1)

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 381/382 (99.74%), Postives = 382/382 (100.00%), Query Frame = 1
Query:   64 MTNIELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILDK 1209
            MTNIELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRM+NLDKANAEEFLEVYKGVLAEYAAILLELISGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILDK
Sbjct:    1 MTNIELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMYNLDKANAEEFLEVYKGVLAEYAAILLELISGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILDK 382          
BLAST of Nucleoside diphosphate kinase 7 vs. Planmine SMEST
Match: SMESG000069915.1 (SMESG000069915.1)

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 344/345 (99.71%), Postives = 345/345 (100.00%), Query Frame = 1
Query:  175 MFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILDK 1209
            MFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRM+NLDKANAEEFLEVYKGVLAEYAAILLELISGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILDK
Sbjct:    1 MFDLKNNRPFLKRTKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMYNLDKANAEEFLEVYKGVLAEYAAILLELISGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQILDK 345          
BLAST of Nucleoside diphosphate kinase 7 vs. Planmine SMEST
Match: SMESG000043677.1 (SMESG000043677.1)

HSP 1 Score: 138.658 bits (348), Expect = 4.850e-35
Identity = 90/297 (30.30%), Postives = 154/297 (51.85%), Query Frame = 1
Query:  319 RNLSSHTEKTLGIIKPQALSNMGQ-IISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVS-NGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQIL 1203
            ++ +S+ ++TL +++P A +   + I+  I  A F +   K  QL +E+A   Y  HK KPF E L+  M+ G ++A  L ++NAV GW  M+GP D   AK   P+SLRA++  + +  N +HGS+    A  E+ +FF       P      + T A +KP  + N +   I   I++A F+I  ++   ++K+ AEEF    +     +  ++  + SGP   M +S       + A + +R  +GP DP+ A    P+++RA+YG+D   N ++ +    D E EVQ    ++
Sbjct:  302 KHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF-------P-----VEQTIAAIKPDGIENEE--EIFNKILDAKFKIVKIKRITMEKSLAEEFY-SDQSHQEYFNDLIAHMESGPTYFMVLS------REDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGS----DNESEVQRVMNLI 573          

HSP 2 Score: 117.087 bits (292), Expect = 8.236e-28
Identity = 91/298 (30.54%), Postives = 152/298 (51.01%), Query Frame = 1
Query:  340 EKTLGIIKPQALS--NMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENA--VNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFS------KSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKV-CNGIHCTDLPEDAELEVQYFFQI 1200
            E TL +IKP  +    + +II+ +++    I+  +   L  E+A E Y         E+L+  + SGP     L + +A  ++ + ++IGP     AK  +P S+RA YG +S+ N +HG++  + A RE+ FFF +    +P  AR        + T A+V+P   T  +  SI+  I NAGF++   +   L K  A  F   +K     +  ++ E+  G  +A+       L+ Q A + +R  +GP D E A+ + PN+LRA + K+ +  N IH +D  E AE E++YFF +
Sbjct:  156 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPD--FMVPKIARVKHEASNVQRTLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKD-KPFFEELIKEMSKGTLLAL------ALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 443          

HSP 3 Score: 92.4337 bits (228), Expect = 9.964e-20
Identity = 60/199 (30.15%), Postives = 90/199 (45.23%), Query Frame = 1
Query:  340 EKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFF-----FRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLE 921
            E+T+  IKP  + N  +I + I  A F IV +K   +++  A E Y+    + +  +L+  M SGP     L RE+A+ GW  +IGP DP  A+   P S+RA YG D   N ++GS+  +   R +N       F E+G  +P             K  +V      SI +       E+T  +     KA   E LE
Sbjct:  444 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYED---------KLEVVEESNKESINIEETQQETEVTDEKQRESPKAEVSETLE 633          
BLAST of Nucleoside diphosphate kinase 7 vs. Planmine SMEST
Match: SMESG000043677.1 (SMESG000043677.1)

HSP 1 Score: 138.658 bits (348), Expect = 4.990e-35
Identity = 90/297 (30.30%), Postives = 154/297 (51.85%), Query Frame = 1
Query:  319 RNLSSHTEKTLGIIKPQALSNMGQ-IISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVS-NGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFFQIL 1203
            ++ +S+ ++TL +++P A +   + I+  I  A F +   K  QL +E+A   Y  HK KPF E L+  M+ G ++A  L ++NAV GW  M+GP D   AK   P+SLRA++  + +  N +HGS+    A  E+ +FF       P      + T A +KP  + N +   I   I++A F+I  ++   ++K+ AEEF    +     +  ++  + SGP   M +S       + A + +R  +GP DP+ A    P+++RA+YG+D   N ++ +    D E EVQ    ++
Sbjct:  302 KHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF-------P-----VEQTIAAIKPDGIENEE--EIFNKILDAKFKIVKIKRITMEKSLAEEFY-SDQSHQEYFNDLIAHMESGPTYFMVLS------REDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGS----DNESEVQRVMNLI 573          

HSP 2 Score: 117.087 bits (292), Expect = 7.429e-28
Identity = 91/298 (30.54%), Postives = 152/298 (51.01%), Query Frame = 1
Query:  340 EKTLGIIKPQALS--NMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENA--VNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFS------KSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKV-CNGIHCTDLPEDAELEVQYFFQI 1200
            E TL +IKP  +    + +II+ +++    I+  +   L  E+A E Y         E+L+  + SGP     L + +A  ++ + ++IGP     AK  +P S+RA YG +S+ N +HG++  + A RE+ FFF +    +P  AR        + T A+V+P   T  +  SI+  I NAGF++   +   L K  A  F   +K     +  ++ E+  G  +A+       L+ Q A + +R  +GP D E A+ + PN+LRA + K+ +  N IH +D  E AE E++YFF +
Sbjct:  156 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPD--FMVPKIARVKHEASNVQRTLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKD-KPFFEELIKEMSKGTLLAL------ALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 443          

HSP 3 Score: 92.0485 bits (227), Expect = 1.412e-19
Identity = 49/144 (34.03%), Postives = 75/144 (52.08%), Query Frame = 1
Query:  340 EKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFF-----FRENGCSIP 756
            E+T+  IKP  + N  +I + I  A F IV +K   +++  A E Y+    + +  +L+  M SGP     L RE+A+ GW  +IGP DP  A+   P S+RA YG D   N ++GS+  +   R +N       F E+G  +P
Sbjct:  444 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLP 587          
BLAST of Nucleoside diphosphate kinase 7 vs. Planmine SMEST
Match: SMESG000039529.1 (SMESG000039529.1)

HSP 1 Score: 117.087 bits (292), Expect = 2.279e-30
Identity = 59/135 (43.70%), Postives = 80/135 (59.26%), Query Frame = 1
Query:  337 TEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFREN 741
             E+TL IIKP A+    +I+  I    F I+  K   L  E+A + Y  H GK F  +L+  M+SGP+    L  ENA++ W D+IGPT+ + AK  +P SLRA YG D   NG HGS+  ++A REI FFF E+
Sbjct:   16 VERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPED 150          

HSP 2 Score: 57.3806 bits (137), Expect = 2.402e-9
Identity = 40/142 (28.17%), Postives = 70/142 (49.30%), Query Frame = 1
Query:  769 FSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVXXXXXXXXXXXXSGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 1194
            F + T A++KP  +   +   I+  I++ GF I   +  +L    A +F   + G    + +++  + SGP         I L ++ A   +R+ +GP +   A+   P +LRA+YG D   NG H +D    AE E+++FF
Sbjct:   15 FVERTLAIIKPDAI--HRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFG-KLFFPSLIAYMSSGPVHV------IVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF 147          
The following BLAST results are available for this feature:
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NME79.019e-14151.06NME/NM23 family member 7 [Source:HGNC Symbol;Acc:H... [more]
NME71.378e-12651.01NME/NM23 family member 7 [Source:HGNC Symbol;Acc:H... [more]
NME71.701e-11248.04NME/NM23 family member 7 [Source:HGNC Symbol;Acc:H... [more]
NME75.082e-8045.71NME/NM23 family member 7 [Source:HGNC Symbol;Acc:H... [more]
NME51.256e-2642.96NME/NM23 family member 5 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ndk-11.614e-1531.88Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-11.614e-1531.88Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-11.614e-1531.88Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-11.614e-1531.88Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmdyn-D73.385e-6835.17gene:FBgn0028997 transcript:FBtr0082083[more]
nmdyn-D66.482e-2238.24gene:FBgn0030573 transcript:FBtr0073933[more]
awd2.176e-1329.29gene:FBgn0000150 transcript:FBtr0346611[more]
awd2.658e-1329.08gene:FBgn0000150 transcript:FBtr0346150[more]
awd2.658e-1329.08gene:FBgn0000150 transcript:FBtr0339146[more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme71.806e-14252.24NME/NM23 family member 7 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme61.852e-2538.06NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme86.157e-2529.01NME/NM23 family member 8 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme52.254e-2438.17NME/NM23 family member 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme42.131e-1733.12NME/NM23 nucleoside diphosphate kinase 4 [Source:Z... [more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme72.765e-13048.66NME/NM23 family member 7 [Source:NCBI gene;Acc:394... [more]
nme71.287e-12446.98NME/NM23 family member 7 [Source:NCBI gene;Acc:394... [more]
nme73.678e-11946.54NME/NM23 family member 7 [Source:NCBI gene;Acc:394... [more]
nme73.453e-11744.97NME/NM23 family member 7 [Source:NCBI gene;Acc:394... [more]
nme74.480e-11345.45NME/NM23 family member 7 [Source:NCBI gene;Acc:394... [more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nme71.654e-13950.39NME/NM23 family member 7 [Source:MGI Symbol;Acc:MG... [more]
Nme71.654e-13950.39NME/NM23 family member 7 [Source:MGI Symbol;Acc:MG... [more]
Nme71.654e-13950.39NME/NM23 family member 7 [Source:MGI Symbol;Acc:MG... [more]
Nme77.952e-8245.31NME/NM23 family member 7 [Source:MGI Symbol;Acc:MG... [more]
Nme51.162e-2339.10NME/NM23 family member 5 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y5B8|NDK7_HUMAN4.331e-14051.06Nucleoside diphosphate kinase 7 OS=Homo sapiens OX... [more]
sp|Q9QXL7|NDK7_RAT2.658e-13950.39Nucleoside diphosphate kinase 7 OS=Rattus norvegic... [more]
sp|Q5E9Y9|NDK7_BOVIN2.933e-13751.46Nucleoside diphosphate kinase 7 OS=Bos taurus OX=9... [more]
sp|Q9QXL8|NDK7_MOUSE4.445e-13750.13Nucleoside diphosphate kinase 7 OS=Mus musculus OX... [more]
sp|P90666|TXND3_HELCR2.308e-3934.49Thioredoxin domain-containing protein 3 homolog OS... [more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157450651.261e-14052.00tr|R7TZK1|R7TZK1_CAPTE Nucleoside diphosphate kina... [more]
gnl|BL_ORD_ID|235099332.469e-14053.32tr|A0A210R3D6|A0A210R3D6_MIZYE Nucleoside diphosph... [more]
gnl|BL_ORD_ID|1750697092.368e-13952.77tr|A0A2I4CES8|A0A2I4CES8_9TELE Nucleoside diphosph... [more]
gnl|BL_ORD_ID|1733852204.040e-13952.24tr|F1QQX1|F1QQX1_DANRE Nucleoside diphosphate kina... [more]
gnl|BL_ORD_ID|183138354.620e-13953.44tr|A0A267DSF2|A0A267DSF2_9PLAT Nucleoside diphosph... [more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme78.090e-14152.24NME/NM23 family member 7 [Source:NCBI gene;Acc:103... [more]
nme73.093e-12451.88NME/NM23 family member 7 [Source:NCBI gene;Acc:103... [more]
nme71.501e-10947.98NME/NM23 family member 7 [Source:NCBI gene;Acc:103... [more]
nme81.688e-3632.06thioredoxin domain-containing protein 3 homolog [S... [more]
nme81.696e-3632.06thioredoxin domain-containing protein 3 homolog [S... [more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nme63.638e-2941.79NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
ENSPMAT00000008106.16.695e-2036.84pep scaffold:Pmarinus_7.0:GL476850:19893:22834:-1 ... [more]
nme31.496e-1129.85NME/NM23 nucleoside diphosphate kinase 3 [Source:Z... [more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YNK11.747e-2134.04Nucleoside diphosphate kinase; catalyzes the trans... [more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO345022.038e-12949.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500653.545e-9347.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422346.373e-4336.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392013.154e-3242.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305268.120e-2439.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme74.435e-13650.13NME/NM23 family member 7 [Source:NCBI gene;Acc:101... [more]
nme87.408e-3028.23thioredoxin domain-containing protein 6 [Source:NC... [more]
nme53.410e-2740.58NME/NM23 family member 5 [Source:NCBI gene;Acc:101... [more]
nme64.891e-2637.76NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme64.891e-2637.76NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
back to top
BLAST of Nucleoside diphosphate kinase 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069915.10.000e+099.74SMESG000069915.1[more]
SMESG000069915.10.000e+099.71SMESG000069915.1[more]
SMESG000043677.14.850e-3530.30SMESG000043677.1[more]
SMESG000043677.14.990e-3530.30SMESG000043677.1[more]
SMESG000039529.12.279e-3043.70SMESG000039529.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007606 ID=SMED30007606|Name=Nucleoside diphosphate kinase 7|organism=Schmidtea mediterranea sexual|type=transcript|length=1305bp
AGAGCTTGTTTAAAATTCCTAATGCAGTTACTATAGATATTTTTGTGATC
TAGATATTTCAAAATGACAAATATTGAACTAAGATATGCATTCGATGTTG
AATGGTATGACTCGGCAGCTACTATTATTAGAAAATATATTCTATTATTC
TTTCCTAAAGACAATGGTGTTGAAATGTTTGATTTGAAAAACAACAGACC
TTTTCTTAAGAGAACAAAATGCGAAGGATTAAGATTATCAGATTTACATG
TTGGAAATTCAGTAAATATCCTCTCTCGACAATTGAGAATTGTTGATTTT
GGAGACGAATGGACTCGTCGAAATTTGAGCTCCCACACTGAAAAAACGTT
GGGAATCATTAAACCTCAAGCCTTGTCAAACATGGGCCAAATCATTTCTG
ACATTGAGAAAGCAAATTTCGTGATTGTCAATTTAAAAATGTTTCAGTTG
AAACGAGAACAAGCAATAGAATTGTACGCACCACACAAAGGCAAACCTTT
TATGGAAAATTTATTGAATCTGATGACATCTGGTCCAATAATGGCTTTTG
AATTGATGCGAGAAAATGCCGTTAACGGTTGGCTAGATATGATTGGACCG
ACTGATCCGTTGCTTGCCAAGAGAGAAGCCCCTCATAGTTTGCGTGCTAA
ATACGGGCTGGACTCCGTCAGCAATGGCCTTCATGGATCTGAATGTGTAA
ATGCTGCTATTCGGGAAATCAATTTCTTTTTCCGGGAAAATGGATGCTCC
ATACCAAATACAGCGAGATTTTCGAAGAGCACTTGCGCTGTGGTGAAGCC
GCATTTAGTGACAAATGGACAACTGGGATCAATCATTCTCTCTATCGTCA
ATGCTGGCTTTGAAATCACAGCTCTGAGAATGTTCAATCTAGATAAGGCA
AATGCTGAAGAATTTCTCGAGGTTTACAAAGGAGTTCTTGCAGAATATGC
TGCCATTTTGTTGGAATTGATTTCTGGTCCGTGCGTTGCCATGGAAATTT
CAACCGGAATCAGACTAAAGAATCAAATTGCTCAAAAATCATTCCGAGAA
TTCGTTGGTCCAATGGATCCGGAAATGGCGCGCCACCTGCGCCCGAACAC
CCTAAGAGCCATGTATGGAAAAGACAAAGTTTGCAATGGGATACATTGCA
CAGATTTACCAGAAGATGCTGAATTAGAAGTCCAATATTTTTTCCAAATC
CTGGACAAATAATTCCCTCTTACACTTATTTAATTATTCCAATTTTTGTG
TTTATCATTATAAAATTGGTCTTGTAGAATGTTGTTGACAATAAATATGT
AGGCT
back to top

protein sequence of SMED30007606-orf-1

>SMED30007606-orf-1 ID=SMED30007606-orf-1|Name=SMED30007606-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=383bp
MTNIELRYAFDVEWYDSAATIIRKYILLFFPKDNGVEMFDLKNNRPFLKR
TKCEGLRLSDLHVGNSVNILSRQLRIVDFGDEWTRRNLSSHTEKTLGIIK
PQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENL
LNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLD
SVSNGLHGSECVNAAIREINFFFRENGCSIPNTARFSKSTCAVVKPHLVT
NGQLGSIILSIVNAGFEITALRMFNLDKANAEEFLEVYKGVLAEYAAILL
ELISGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAM
YGKDKVCNGIHCTDLPEDAELEVQYFFQILDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR034907NDK-like_dom
IPR036850NDK-like_dom_sf
IPR037993NDPk7B
IPR001564Nucleoside_diP_kinase
IPR006602Uncharacterised_DM10
IPR011410NDPK7
Vocabulary: biological process
TermDefinition
GO:0006165nucleoside diphosphate phosphorylation
GO:0006183GTP biosynthetic process
GO:0006228UTP biosynthetic process
GO:0006241CTP biosynthetic process
GO:0009117nucleotide metabolic process
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004550nucleoside diphosphate kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005813centrosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001564Nucleoside diphosphate kinasePRINTSPR01243NUCDPKINASEcoord: 157..174
score: 26.34
coord: 137..156
score: 39.11
coord: 204..223
score: 45.4
IPR034907Nucleoside diphosphate kinase-like domainSMARTSM00562ndk_5coord: 237..381
e-value: 1.5E-27
score: 107.5
coord: 92..229
e-value: 1.0E-47
score: 174.5
IPR034907Nucleoside diphosphate kinase-like domainPFAMPF00334NDKcoord: 239..378
e-value: 9.7E-26
score: 90.4
coord: 93..226
e-value: 6.9E-38
score: 129.7
IPR006602Uncharacterised domain DM10SMARTSM00676dm10coord: 4..92
e-value: 5.1E-20
score: 82.5
IPR006602Uncharacterised domain DM10PROSITEPS51336DM10coord: 4..92
score: 18.368
IPR036850Nucleoside diphosphate kinase-like domain superfamilyGENE3DG3DSA:3.30.70.141coord: 82..232
e-value: 2.1E-45
score: 156.1
IPR036850Nucleoside diphosphate kinase-like domain superfamilyGENE3DG3DSA:3.30.70.141coord: 237..381
e-value: 8.5E-40
score: 138.2
IPR036850Nucleoside diphosphate kinase-like domain superfamilySUPERFAMILYSSF54919Nucleoside diphosphate kinase, NDKcoord: 238..379
IPR036850Nucleoside diphosphate kinase-like domain superfamilySUPERFAMILYSSF54919Nucleoside diphosphate kinase, NDKcoord: 92..226
IPR011410Nucleoside diphosphate kinase 7PIRSFPIRSF036503NDK7coord: 2..382
e-value: 2.5E-149
score: 494.9
IPR011410Nucleoside diphosphate kinase 7PANTHERPTHR43109FAMILY NOT NAMEDcoord: 2..376
NoneNo IPR availablePANTHERPTHR43109:SF2NUCLEOSIDE DIPHOSPHATE KINASE 7coord: 2..376
IPR037993NDPK7, second NDPk domainCDDcd04412NDPk7Bcoord: 239..377
e-value: 3.55751E-65
score: 201.709