serine/threonine/tyrosine-interacting-like protein 1

Overview
Nameserine/threonine/tyrosine-interacting-like protein 1
Smed IDSMED30007587
Length (bp)1150
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of serine/threonine/tyrosine-interacting-like protein 1 (SMED30007587) t-SNE clustered cells

Violin plots show distribution of expression levels for serine/threonine/tyrosine-interacting-like protein 1 (SMED30007587) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of serine/threonine/tyrosine-interacting-like protein 1 (SMED30007587) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for serine/threonine/tyrosine-interacting-like protein 1 (SMED30007587) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007587

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30007587SMESG000070767.1 SmedASXL_010500SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30007587SMESG000070767.1 dd_Smed_v4_11358_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007587SMESG000016474.1 Contig4862GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007587SMESG000070767.1 Contig4862GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30007587SMESG000070767.1 dd_Smed_v6_11358_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30007587SMESG000070767.1 Contig48014newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30007587SMESG000070767.1 Contig48014uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30007587SMESG000070767.1 PL06015B1A04ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30007587SMESG000070767.1 dd_Smed_v4_11358_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30007587SMESG000070767.1 dd_Smed_v4_11358_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Human
Match: STYXL1 (serine/threonine/tyrosine interacting like 1 [Source:HGNC Symbol;Acc:HGNC:18165])

HSP 1 Score: 244.588 bits (623), Expect = 4.127e-78
Identity = 131/314 (41.72%), Postives = 187/314 (59.55%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLD--------------PSSEAVKCANV----LLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEP-TYTEDPFY 1003
            M  L L EPT LY ILNQ    S L++P YL LLD R K EY+E H+I A R+KK + N+Y++P   +LEC +  VVYD N+++L+                 + V  A +    +LT    + V ILKGGYE FS  Y FLRTQKI+WMP+ELD + P+P+E++P  +++GN   ACD  +QK LKIK H+N + +    F    + L  +++ D+PE+ I  +   +C FI+ +   G  + ++S  GISR+   I+AYLMH  E +L +SW+Y+K   + M PNRG VSQL E+EK  + +  T   DP Y
Sbjct:    1 MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKN-NEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY 313          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Human
Match: STYXL1 (serine/threonine/tyrosine interacting like 1 [Source:HGNC Symbol;Acc:HGNC:18165])

HSP 1 Score: 244.588 bits (623), Expect = 4.127e-78
Identity = 131/314 (41.72%), Postives = 187/314 (59.55%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLD--------------PSSEAVKCANV----LLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEP-TYTEDPFY 1003
            M  L L EPT LY ILNQ    S L++P YL LLD R K EY+E H+I A R+KK + N+Y++P   +LEC +  VVYD N+++L+                 + V  A +    +LT    + V ILKGGYE FS  Y FLRTQKI+WMP+ELD + P+P+E++P  +++GN   ACD  +QK LKIK H+N + +    F    + L  +++ D+PE+ I  +   +C FI+ +   G  + ++S  GISR+   I+AYLMH  E +L +SW+Y+K   + M PNRG VSQL E+EK  + +  T   DP Y
Sbjct:    1 MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKN-NEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY 313          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Human
Match: STYXL1 (serine/threonine/tyrosine interacting like 1 [Source:HGNC Symbol;Acc:HGNC:18165])

HSP 1 Score: 244.588 bits (623), Expect = 4.127e-78
Identity = 131/314 (41.72%), Postives = 187/314 (59.55%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLD--------------PSSEAVKCANV----LLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEP-TYTEDPFY 1003
            M  L L EPT LY ILNQ    S L++P YL LLD R K EY+E H+I A R+KK + N+Y++P   +LEC +  VVYD N+++L+                 + V  A +    +LT    + V ILKGGYE FS  Y FLRTQKI+WMP+ELD + P+P+E++P  +++GN   ACD  +QK LKIK H+N + +    F    + L  +++ D+PE+ I  +   +C FI+ +   G  + ++S  GISR+   I+AYLMH  E +L +SW+Y+K   + M PNRG VSQL E+EK  + +  T   DP Y
Sbjct:    1 MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKN-NEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY 313          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Human
Match: STYXL1 (serine/threonine/tyrosine interacting like 1 [Source:HGNC Symbol;Acc:HGNC:18165])

HSP 1 Score: 207.994 bits (528), Expect = 3.170e-64
Identity = 111/270 (41.11%), Postives = 160/270 (59.26%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLD--------------PSSEAVKCANV----LLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISL 874
            M  L L EPT LY ILNQ    S L++P YL LLD R K EY+E H+I A R+KK + N+Y++P   +LEC +  VVYD N+++L+                 + V  A +    +LT    + V ILKGGYE FS  Y FLRTQKI+WMP+ELD + P+P+E++P  +++GN   ACD  +QK LKIK H+N + +    F    + L  +++ D+PE+ I  +   +C FI+ +   G  + ++S  GISR+   I+AYLMH  E +L
Sbjct:    1 MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKN-NEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTL 269          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Human
Match: STYXL1 (serine/threonine/tyrosine interacting like 1 [Source:HGNC Symbol;Acc:HGNC:18165])

HSP 1 Score: 142.124 bits (357), Expect = 1.070e-39
Identity = 72/189 (38.10%), Postives = 111/189 (58.73%), Query Frame = 2
Query:  254 HIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLD--------------PSSEAVKCANV----LLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFID 766
            H+I A R+KK + N+Y++P   +LEC +  VVYD N+++L+                 + V  A +    +LT    + V ILKGGYE FS  Y FLRTQKI+WMP+ELD + P+P+E++P  +++GN   ACD  +QK LKIK H+N + +    F    + L  +++ D+PE+ I  +   +C FI+
Sbjct:    1 HVITALRVKKKN-NEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIE 188          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Celegans
Match: lip-1 (Dual specificity protein phosphatase lip-1 [Source:UniProtKB/Swiss-Prot;Acc:V6CIV8])

HSP 1 Score: 78.5666 bits (192), Expect = 6.822e-16
Identity = 47/141 (33.33%), Postives = 75/141 (53.19%), Query Frame = 2
Query:  542 FPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFE-STNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEK 961
            FP+++    LYLGN+  A +R V K+  I   IN T+ +   FE   N     +   DN   N+  +F +  SFID  R+      V+   GISR+  I +AYLM  E  +L  ++ +++  ++ + PN  F+ QL++YEK
Sbjct:  184 FPVKLT-NFLYLGNAETAKNRDVLKKYSISHVINVTSNLPNTFEEDPNMRYLRISADDNASHNLTKFFPEAISFIDDARRNDSACLVHCLAGISRSVTICLAYLMKTEMCTLDSAYEWVQKRNASIAPNFHFMGQLTDYEK 323          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Celegans
Match: lip-1 (Dual specificity protein phosphatase lip-1 [Source:UniProtKB/Swiss-Prot;Acc:V6CIV8])

HSP 1 Score: 78.5666 bits (192), Expect = 6.976e-16
Identity = 47/141 (33.33%), Postives = 75/141 (53.19%), Query Frame = 2
Query:  542 FPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFE-STNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEK 961
            FP+++    LYLGN+  A +R V K+  I   IN T+ +   FE   N     +   DN   N+  +F +  SFID  R+      V+   GISR+  I +AYLM  E  +L  ++ +++  ++ + PN  F+ QL++YEK
Sbjct:  184 FPVKLT-NFLYLGNAETAKNRDVLKKYSISHVINVTSNLPNTFEEDPNMRYLRISADDNASHNLTKFFPEAISFIDDARRNDSACLVHCLAGISRSVTICLAYLMKTEMCTLDSAYEWVQKRNASIAPNFHFMGQLTDYEK 323          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 75.0998 bits (183), Expect = 2.223e-14
Identity = 48/188 (25.53%), Postives = 96/188 (51.06%), Query Frame = 2
Query:  437 VLILKGGYEYFSRLYPFL--RTQKILWMPRELDT---YHPFP--LEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCT-TEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAE 976
            V++L+GG++ F++ YP L   ++ +  +P+ L       P    + +I  ++YLG+   + D  +   L I   IN + T    +    ++N   + V+D+ +  +  YF     F++K R+ GK+  ++   GISR+P + ++Y+M   ++    ++ Y+K     + PN  F+ QL EYE   + +
Sbjct:  136 VMVLEGGFKQFAQQYPQLCESSEGMTRLPQSLSQPCLSQPTGDGITLITPNIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVLIKD 323          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 75.0998 bits (183), Expect = 2.223e-14
Identity = 48/188 (25.53%), Postives = 96/188 (51.06%), Query Frame = 2
Query:  437 VLILKGGYEYFSRLYPFL--RTQKILWMPRELDT---YHPFP--LEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCT-TEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAE 976
            V++L+GG++ F++ YP L   ++ +  +P+ L       P    + +I  ++YLG+   + D  +   L I   IN + T    +    ++N   + V+D+ +  +  YF     F++K R+ GK+  ++   GISR+P + ++Y+M   ++    ++ Y+K     + PN  F+ QL EYE   + +
Sbjct:  136 VMVLEGGFKQFAQQYPQLCESSEGMTRLPQSLSQPCLSQPTGDGITLITPNIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVLIKD 323          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 74.7146 bits (182), Expect = 2.535e-14
Identity = 48/188 (25.53%), Postives = 96/188 (51.06%), Query Frame = 2
Query:  437 VLILKGGYEYFSRLYPFL--RTQKILWMPRELDT---YHPFP--LEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCT-TEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAE 976
            V++L+GG++ F++ YP L   ++ +  +P+ L       P    + +I  ++YLG+   + D  +   L I   IN + T    +    ++N   + V+D+ +  +  YF     F++K R+ GK+  ++   GISR+P + ++Y+M   ++    ++ Y+K     + PN  F+ QL EYE   + +
Sbjct:  132 VMVLEGGFKQFAQQYPQLCESSEGMTRLPQSLSQPCLSQPTGDGITLITPNIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVLIKD 319          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Fly
Match: Mkp3 (gene:FBgn0036844 transcript:FBtr0075036)

HSP 1 Score: 89.7373 bits (221), Expect = 2.385e-20
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  533 YHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEI-NEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEP 979
            Y+  P+E+IP  L+LGN+ H+CD    K+  IK  +N T ++ N+  ES +     + ++D+   ++ I+F D   FI++ R     V V+   G+SR+  + +AYLMH   +SL  +++ ++     + PN  F+ QL  +E +    P
Sbjct:   41 YNEAPVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQLRLRP 190          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Fly
Match: Mkp3 (gene:FBgn0036844 transcript:FBtr0333220)

HSP 1 Score: 89.3521 bits (220), Expect = 2.794e-19
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  533 YHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEI-NEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEP 979
            Y+  P+E+IP  L+LGN+ H+CD    K+  IK  +N T ++ N+  ES +     + ++D+   ++ I+F D   FI++ R     V V+   G+SR+  + +AYLMH   +SL  +++ ++     + PN  F+ QL  +E +    P
Sbjct:  211 YNEAPVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQLRLRP 360          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Fly
Match: Mkp3 (gene:FBgn0036844 transcript:FBtr0075035)

HSP 1 Score: 89.3521 bits (220), Expect = 2.794e-19
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  533 YHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEI-NEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEP 979
            Y+  P+E+IP  L+LGN+ H+CD    K+  IK  +N T ++ N+  ES +     + ++D+   ++ I+F D   FI++ R     V V+   G+SR+  + +AYLMH   +SL  +++ ++     + PN  F+ QL  +E +    P
Sbjct:  211 YNEAPVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQLRLRP 360          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Fly
Match: Mkp3 (gene:FBgn0036844 transcript:FBtr0330089)

HSP 1 Score: 89.3521 bits (220), Expect = 4.607e-19
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  533 YHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEI-NEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEP 979
            Y+  P+E+IP  L+LGN+ H+CD    K+  IK  +N T ++ N+  ES +     + ++D+   ++ I+F D   FI++ R     V V+   G+SR+  + +AYLMH   +SL  +++ ++     + PN  F+ QL  +E +    P
Sbjct:  211 YNEAPVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQLRLRP 360          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Fly
Match: puc (gene:FBgn0243512 transcript:FBtr0339722)

HSP 1 Score: 77.0258 bits (188), Expect = 3.059e-15
Identity = 43/133 (32.33%), Postives = 64/133 (48.12%), Query Frame = 2
Query:  569 LYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKF 967
            L LGN R A D      +   C +N T +              +  SD P  NI  YF +   FI+  RK G RV ++ H GISR+  I +AY+M  + +SL +++  +K    ++ PN  F+ QL E E+  
Sbjct:   34 LLLGNGRDADD---PSSVGANCVLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNL 163          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Zebrafish
Match: styxl1 (serine/threonine/tyrosine interacting-like 1 [Source:ZFIN;Acc:ZDB-GENE-040912-45])

HSP 1 Score: 217.238 bits (552), Expect = 5.950e-68
Identity = 112/296 (37.84%), Postives = 182/296 (61.49%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEP-TYTEDPFY 1003
            M+   L E T L+ +LNQY  +  L+   YL L+DAR+++ YN  HII A+  K + +  +I+P D E+E    I+VYD  T SL  S  A+ CA+ L    ++  + IL GGYE FS LYPFLRT+KIL+  REL++ + +P+E++P  LY+G+ + A +  V K LK+   +N + + + IF+  N  +  ++V+D+ E+++   F+ +C FI+ +      V V+S LG SR   + MAYLM   + ++ ++W++++   + MRPNRGFV QLS++E + + +  T T +P Y
Sbjct:    1 MAGKVLCEATSLFNLLNQYTNFPRLAESNYLCLIDARVEESYNFSHIITARNAKWDFEGKFIMPVDVEVESMRYIIVYDNGTQSLSDSGPAIDCADSL-EKASQFPIQILTGGYEKFSALYPFLRTEKILYNIRELESLNLYPVEILPGQLYMGDYKQATNLKVLKDLKLNAIVNVSNDCSLIFKKANCTVLHIRVADSAEADLVTSFERICVFINSHLNNASSVLVFSTLGKSRCCAVAMAYLMSHLKYTIKEAWNHIQQCKANMRPNRGFVQQLSDWELQTLGKRVTDTSEPNY 295          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Zebrafish
Match: dusp1 (dual specificity phosphatase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2018])

HSP 1 Score: 95.9005 bits (237), Expect = 1.248e-21
Identity = 63/218 (28.90%), Postives = 107/218 (49.08%), Query Frame = 2
Query:  404 NVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKI----LWMPRELDTY-----------------HPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTED 994
            N L        V +LKGG++ FS  +P   T+ +    L +P   + +                    P+E++P  LYLG++ HA  + +   L I   IN ++     FE  +     + V DN ++NI  +F++   FID  R +G RVFV+   GISR+  I +AYLM    + L +++ ++K   S++ PN  F+ QL ++E + +A  T + +
Sbjct:  117 NALCRKQCGASVYLLKGGFDTFSAEFPEKCTKTVPPQGLSLPLSSNCHSNTADSSCNTCTTPLYDQGGPVEILP-FLYLGSAYHASRKDMLDMLGITALINVSSNCPNHFED-HYQYKSIPVEDNHKANISSWFNEAIEFIDSVRNKGGRVFVHCQAGISRSATICLAYLMRTNRVKLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLASSTCSSE 332          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Zebrafish
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 95.5153 bits (236), Expect = 1.663e-21
Identity = 79/293 (26.96%), Postives = 137/293 (46.76%), Query Frame = 2
Query:  212 LLLDAR---------IKDEYN-ECHIIMAKRMKKNDKNDYIVPYDSELECQEK------IVVYD---GNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYP--FLRTQKILWMPRE-------LDTYHP-----FPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTE 991
            LLLD R         ++   N  C+ I+ +R K +   D I+  D E   + K      +++YD    +TN++   S      N L  +     V +LKGGY+ FS  YP   L+T+ +     +       L    P      P+E++P  L+LG++ HA  + +  ++ I   +N ++     FE   +    + V DN + +I  +F +   FID  +    RV V+   GISR+  I +AYLM  + + L +++ ++K   S++ PN  F+ QL ++E + +A     E
Sbjct:   27 LLLDCRSFLAFSAGHLRGAVNIRCNTIVRRRAKGSVSLDQILSGDDEARSRLKSGLYSAVILYDERSSDTNTMKDDSTITLVHNALCRDTFSTEVYLLKGGYDRFSTQYPDYCLKTRTLSVSSSQSSMESSCLSCATPQHDQGGPVEILP-FLFLGSALHASKKDMLDRMGISALLNVSSNCPNHFEGDYQYKC-IPVEDNHKEDISSWFIEAIEFIDSVKDSNGRVLVHCQAGISRSATICLAYLMKKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCSVE 317          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Zebrafish
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 95.5153 bits (236), Expect = 1.663e-21
Identity = 79/293 (26.96%), Postives = 137/293 (46.76%), Query Frame = 2
Query:  212 LLLDAR---------IKDEYN-ECHIIMAKRMKKNDKNDYIVPYDSELECQEK------IVVYD---GNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYP--FLRTQKILWMPRE-------LDTYHP-----FPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTE 991
            LLLD R         ++   N  C+ I+ +R K +   D I+  D E   + K      +++YD    +TN++   S      N L  +     V +LKGGY+ FS  YP   L+T+ +     +       L    P      P+E++P  L+LG++ HA  + +  ++ I   +N ++     FE   +    + V DN + +I  +F +   FID  +    RV V+   GISR+  I +AYLM  + + L +++ ++K   S++ PN  F+ QL ++E + +A     E
Sbjct:   27 LLLDCRSFLAFSAGHLRGAVNIRCNTIVRRRAKGSVSLDQILSGDDEARSRLKSGLYSAVILYDERSSDTNTMKDDSTITLVHNALCRDTFSTEVYLLKGGYDRFSTQYPDYCLKTRTLSVSSSQSSIESSCLSCATPQHDQGGPVEILP-FLFLGSALHASKKDMLDRMGISALLNVSSNCPNHFEGDYQYKC-IPVEDNHKEDISSWFIEAIEFIDSVKDSNGRVLVHCQAGISRSATICLAYLMKKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCSVE 317          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Zebrafish
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 95.5153 bits (236), Expect = 1.663e-21
Identity = 79/293 (26.96%), Postives = 137/293 (46.76%), Query Frame = 2
Query:  212 LLLDAR---------IKDEYN-ECHIIMAKRMKKNDKNDYIVPYDSELECQEK------IVVYD---GNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYP--FLRTQKILWMPRE-------LDTYHP-----FPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTE 991
            LLLD R         ++   N  C+ I+ +R K +   D I+  D E   + K      +++YD    +TN++   S      N L  +     V +LKGGY+ FS  YP   L+T+ +     +       L    P      P+E++P  L+LG++ HA  + +  ++ I   +N ++     FE   +    + V DN + +I  +F +   FID  +    RV V+   GISR+  I +AYLM  + + L +++ ++K   S++ PN  F+ QL ++E + +A     E
Sbjct:   27 LLLDCRSFLAFSAGHLRGAVNIRCNTIVRRRAKGSVSLDQILSGDDEARSRLKSGLYSAVILYDERSSDTNTMKDDSTITLVHNALCRDTFSTEVYLLKGGYDRFSTQYPDYCLKTRTLSVSSSQSSMESSCLSCATPQHDQGGPVEILP-FLFLGSALHASKKDMLDRMGISALLNVSSNCPNHFEGDYQYKC-IPVEDNHKEDISSWFIEAIEFIDSVKDSNGRVLVHCQAGISRSATICLAYLMKKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCSVE 317          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000032730.1 (serine/threonine/tyrosine interacting-like 1 [Source:NCBI gene;Acc:100379735])

HSP 1 Score: 250.751 bits (639), Expect = 1.022e-80
Identity = 127/296 (42.91%), Postives = 186/296 (62.84%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVA-EPTYTEDPFY 1003
            M+ L L +PT LY ILNQ   +S L+ P YL LLDAR K EYNE HI+ A+R K++   +Y++P   ELEC    VVYDGNT SL+ +  A+KC+ V+     R  VL+L+GGYE FS  Y F R+QK+ WMP+E++ +  +P+E+IP  LYLG+ R A DR++ K LKI   +N + +  +   S   N   + V D+ +S++  +F   C FIDK+      V V+S LGISR+  +++AYL++ ++  L ++W+++ +    MRPNRGFV QLSE+E   +  + T   DP Y
Sbjct:    1 MADLVLCKPTELYNILNQSTKFSRLAEPNYLCLLDARSKREYNESHIVTARRAKQDKDENYLLPESVELECVRYCVVYDGNTASLNETGPAIKCSRVV-AQVYRYPVLVLEGGYERFSAYYHFFRSQKVFWMPQEIEEFLSYPIEIIPGLLYLGDQRQANDRHIHKDLKINAQVNVSLDPEKNLSSEVHNELHIPVMDSCDSDLLKFFSRACEFIDKHMGTNSAVLVFSKLGISRSSTVVIAYLIYCKKYFLKEAWTHVLTCKPNMRPNRGFVKQLSEWENIILGQQSTDIADPHY 295          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Xenopus
Match: ibtk (inhibitor of Bruton tyrosine kinase [Source:Xenbase;Acc:XB-GENE-5755983])

HSP 1 Score: 96.6709 bits (239), Expect = 1.075e-21
Identity = 76/274 (27.74%), Postives = 129/274 (47.08%), Query Frame = 2
Query:  260 IMAKRMKKNDKNDYIVPYDSELECQ------EKIVVYDGNTNSLD---PSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFL--RTQKILWMPRELDTYH--------------PF-----PLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTE 991
            I+ +R K +   ++IVP + E  C+      E +V+ D  T+ LD     S  +   N L  +   + +  LKGGYE FS   P    ++   + +   L T +              P      P+E++P  LYLG++ HA  + +   L I   IN +      FE  +     + V D+ +++I  +F++   FID  +  G RVFV+   GISR+  I +AYLM    + L +++ ++K   S++ PN  F+ QL ++E + +A     E
Sbjct:   52 IVKRRAKGSMGLEHIVP-NEEQRCRLLAGMYEAVVLLDERTSELDMLRKDSTMMLAVNALCRDSRGSSIYFLKGGYETFSSQCPEFCNKSSPPVCLSLPLSTNNVPGSADSNCTPCGTPLYDQGGPVEILP-FLYLGSAYHASRKDMLDALGITALINVSANCPNHFEG-HFQYKSIPVEDSHKADISSWFNEAIDFIDSVKNSGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPSCSAE 322          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Xenopus
Match: pnpt1 (polyribonucleotide nucleotidyltransferase 1 [Source:Xenbase;Acc:XB-GENE-967251])

HSP 1 Score: 93.5893 bits (231), Expect = 4.011e-20
Identity = 80/287 (27.87%), Postives = 138/287 (48.08%), Query Frame = 2
Query:  209 LLLLDARIKDEYNECHIIMA------KRMKKNDKNDYI---------VPYDSELECQ-EKIVVYDGNTNSLDPSSEAVKC-ANVLLTNGAR--NGVLILKGGYEYFSRLYPFLRTQKILWMPRE-----LDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTEDP 997
            +LL+D+R   E+N  HI+ A      K MK+  + D +              EL+CQ +++VVYD   +S+D S+   +C  +VLL    +  + V +L GG+  FS  +P L   K   +P       L      P  ++P  LYLG  R   ++ + +Q +I   +N +    +    ++ +   + V+D+    I  + D    FI+K +    RV V+   GISR+  I +AY+M   ++SL +++ ++K     + PN  F+ QL ++EKK  A+      P
Sbjct:   27 VLLIDSRPFVEFNTAHILEAININCSKLMKRRLQQDKVQIVELIQHSAKQTVELDCQAQQVVVYD--QSSVDVSALPAECFLSVLLGKLDKLFHNVQLLSGGFSEFSACFPGLCEGKASMVPTCISQPCLPVSSVGPTRILPH-LYLGCQRDVLNKELMQQNEIGYVLNASNTCPKPDFISDSHFLRIPVNDSFCEKILPWLDKSVDFIEKAKASNDRVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQLLDFEKKIKAQTGQAAPP 310          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Xenopus
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:Xenbase;Acc:XB-GENE-983314])

HSP 1 Score: 90.8929 bits (224), Expect = 1.257e-19
Identity = 79/301 (26.25%), Postives = 138/301 (45.85%), Query Frame = 2
Query:  212 LLLDAR---------IKDEYN-ECHIIMAKRMKKNDKNDYIVP---YDSELECQEK--------IVVYDGNT---NSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYP--FLRTQKI--LWMPRELDTY-------------HPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTE 991
            LLLD R         I+   N  C+ I+ +R K +   + I+P    + E E   +        I+VYD  +   ++L   S        L  +     + +LKGGYE F   YP    +T+ I  + +P  ++                  P+E++P  LYLG++ HA  R +   L+I   +N + +    FE  +     + V DN +++I  +F +   +ID  + +  RV V+   GISR+  I +AYLM  + + L +++ ++K   S++ PN  F+ QL ++E + +     TE
Sbjct:   29 LLLDCRPFLAHSAGFIQGSVNVRCNTIVRRRAKGSVSLEQILPPGCKEGEEEVLSRLRSGLYSAIIVYDERSPRADALREDSTVYLVVQALRRDTDSTDICLLKGGYERFHSEYPEFCAKTKSINSISLPASIEPAGIGCSSCTTPLHDQGGPVEILP-FLYLGSAYHAARRDMLDALRITALMNVSADCPNHFEG-HYQYKCIPVEDNHKADISSWFMEAIEYIDSVKDQNGRVLVHCQAGISRSATICLAYLMMTKRVKLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLTTTCATE 327          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Xenopus
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:Xenbase;Acc:XB-GENE-983314])

HSP 1 Score: 90.5077 bits (223), Expect = 1.660e-19
Identity = 79/301 (26.25%), Postives = 138/301 (45.85%), Query Frame = 2
Query:  212 LLLDAR---------IKDEYN-ECHIIMAKRMKKNDKNDYIVP---YDSELECQEK--------IVVYDGNT---NSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYP--FLRTQKI--LWMPRELDTY-------------HPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTE 991
            LLLD R         I+   N  C+ I+ +R K +   + I+P    + E E   +        I+VYD  +   ++L   S        L  +     + +LKGGYE F   YP    +T+ I  + +P  ++                  P+E++P  LYLG++ HA  R +   L+I   +N + +    FE  +     + V DN +++I  +F +   +ID  + +  RV V+   GISR+  I +AYLM  + + L +++ ++K   S++ PN  F+ QL ++E + +     TE
Sbjct:   41 LLLDCRPFLAHSAGFIQGSVNVRCNTIVRRRAKGSVSLEQILPPGCKEGEEEVLSRLRSGLYSAIIVYDERSPRADALREDSTVYLVVQALRRDTDSTDICLLKGGYERFHSEYPEFCAKTKSINSISLPASIEPAGIGCSSCTTPLHDQGGPVEILP-FLYLGSAYHAARRDMLDALRITALMNVSADCPNHFEG-HYQYKCIPVEDNHKADISSWFMEAIEYIDSVKDQNGRVLVHCQAGISRSATICLAYLMMTKRVKLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLTTTCATE 339          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Mouse
Match: Styxl1 (serine/threonine/tyrosine interacting-like 1 [Source:MGI Symbol;Acc:MGI:1923821])

HSP 1 Score: 229.18 bits (583), Expect = 3.586e-72
Identity = 125/323 (38.70%), Postives = 181/323 (56.04%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPS---------------------------SEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKF-------VAEPTY 985
            M+ L   EPT LY ILNQ    S L+ P YL LLD R K +Y+E H+I A R+KK D + Y++P   +LEC    +VYD NT+SL+                               AV+   +L+ +  R  V +L+GGYE FS +Y F RTQKI+WMP+ELD + P+P+E++P  +YLG    AC+  + K LKIK H+N + E    F    + L  +K+ D+P++ +  YF  +C FI+ + +    V V+S  GISR+   ++A LMH  E +L +SW+ +K   + MRPNR FV+QL E+EK         ++EP Y
Sbjct:    1 MADLLFCEPTELYNILNQVSKLSRLAEPNYLCLLDVRSKRQYDESHVITALRVKKRD-HQYLIPESVDLECVRYCIVYDSNTSSLELCIRRQLEEEEEEEEVEREDKEEDTELLPGPAVEFGQILI-HFTRQPVYVLRGGYECFSGMYHFFRTQKIIWMPQELDAFQPYPVEILPGRVYLGKISQACNAKMHKDLKIKAHVNISMETTPYFIGNADKLLHIKLEDSPDTLLFDYFRHICHFIELHLRLHSVVLVFSTRGISRSVAAVVALLMHYNEETLKRSWAQVKKCKTNMRPNRAFVAQLLEWEKVLHGEYLTDISEPIY 321          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Mouse
Match: Styxl1 (serine/threonine/tyrosine interacting-like 1 [Source:MGI Symbol;Acc:MGI:1923821])

HSP 1 Score: 229.18 bits (583), Expect = 3.586e-72
Identity = 125/323 (38.70%), Postives = 181/323 (56.04%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPS---------------------------SEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKF-------VAEPTY 985
            M+ L   EPT LY ILNQ    S L+ P YL LLD R K +Y+E H+I A R+KK D + Y++P   +LEC    +VYD NT+SL+                               AV+   +L+ +  R  V +L+GGYE FS +Y F RTQKI+WMP+ELD + P+P+E++P  +YLG    AC+  + K LKIK H+N + E    F    + L  +K+ D+P++ +  YF  +C FI+ + +    V V+S  GISR+   ++A LMH  E +L +SW+ +K   + MRPNR FV+QL E+EK         ++EP Y
Sbjct:    1 MADLLFCEPTELYNILNQVSKLSRLAEPNYLCLLDVRSKRQYDESHVITALRVKKRD-HQYLIPESVDLECVRYCIVYDSNTSSLELCIRRQLEEEEEEEEVEREDKEEDTELLPGPAVEFGQILI-HFTRQPVYVLRGGYECFSGMYHFFRTQKIIWMPQELDAFQPYPVEILPGRVYLGKISQACNAKMHKDLKIKAHVNISMETTPYFIGNADKLLHIKLEDSPDTLLFDYFRHICHFIELHLRLHSVVLVFSTRGISRSVAAVVALLMHYNEETLKRSWAQVKKCKTNMRPNRAFVAQLLEWEKVLHGEYLTDISEPIY 321          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Mouse
Match: Styxl1 (serine/threonine/tyrosine interacting-like 1 [Source:MGI Symbol;Acc:MGI:1923821])

HSP 1 Score: 229.18 bits (583), Expect = 3.586e-72
Identity = 125/323 (38.70%), Postives = 181/323 (56.04%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPS---------------------------SEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKF-------VAEPTY 985
            M+ L   EPT LY ILNQ    S L+ P YL LLD R K +Y+E H+I A R+KK D + Y++P   +LEC    +VYD NT+SL+                               AV+   +L+ +  R  V +L+GGYE FS +Y F RTQKI+WMP+ELD + P+P+E++P  +YLG    AC+  + K LKIK H+N + E    F    + L  +K+ D+P++ +  YF  +C FI+ + +    V V+S  GISR+   ++A LMH  E +L +SW+ +K   + MRPNR FV+QL E+EK         ++EP Y
Sbjct:    1 MADLLFCEPTELYNILNQVSKLSRLAEPNYLCLLDVRSKRQYDESHVITALRVKKRD-HQYLIPESVDLECVRYCIVYDSNTSSLELCIRRQLEEEEEEEEVEREDKEEDTELLPGPAVEFGQILI-HFTRQPVYVLRGGYECFSGMYHFFRTQKIIWMPQELDAFQPYPVEILPGRVYLGKISQACNAKMHKDLKIKAHVNISMETTPYFIGNADKLLHIKLEDSPDTLLFDYFRHICHFIELHLRLHSVVLVFSTRGISRSVAAVVALLMHYNEETLKRSWAQVKKCKTNMRPNRAFVAQLLEWEKVLHGEYLTDISEPIY 321          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Mouse
Match: Styxl1 (serine/threonine/tyrosine interacting-like 1 [Source:MGI Symbol;Acc:MGI:1923821])

HSP 1 Score: 229.18 bits (583), Expect = 3.586e-72
Identity = 125/323 (38.70%), Postives = 181/323 (56.04%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPS---------------------------SEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKF-------VAEPTY 985
            M+ L   EPT LY ILNQ    S L+ P YL LLD R K +Y+E H+I A R+KK D + Y++P   +LEC    +VYD NT+SL+                               AV+   +L+ +  R  V +L+GGYE FS +Y F RTQKI+WMP+ELD + P+P+E++P  +YLG    AC+  + K LKIK H+N + E    F    + L  +K+ D+P++ +  YF  +C FI+ + +    V V+S  GISR+   ++A LMH  E +L +SW+ +K   + MRPNR FV+QL E+EK         ++EP Y
Sbjct:    1 MADLLFCEPTELYNILNQVSKLSRLAEPNYLCLLDVRSKRQYDESHVITALRVKKRD-HQYLIPESVDLECVRYCIVYDSNTSSLELCIRRQLEEEEEEEEVEREDKEEDTELLPGPAVEFGQILI-HFTRQPVYVLRGGYECFSGMYHFFRTQKIIWMPQELDAFQPYPVEILPGRVYLGKISQACNAKMHKDLKIKAHVNISMETTPYFIGNADKLLHIKLEDSPDTLLFDYFRHICHFIELHLRLHSVVLVFSTRGISRSVAAVVALLMHYNEETLKRSWAQVKKCKTNMRPNRAFVAQLLEWEKVLHGEYLTDISEPIY 321          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Mouse
Match: Styxl1 (serine/threonine/tyrosine interacting-like 1 [Source:MGI Symbol;Acc:MGI:1923821])

HSP 1 Score: 151.369 bits (381), Expect = 5.280e-44
Identity = 71/177 (40.11%), Postives = 108/177 (61.02%), Query Frame = 2
Query:  476 LYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKF-------VAEPTY 985
            +Y F RTQKI+WMP+ELD + P+P+E++P  +YLG    AC+  + K LKIK H+N + E    F    + L  +K+ D+P++ +  YF  +C FI+ + +    V V+S  GISR+   ++A LMH  E +L +SW+ +K   + MRPNR FV+QL E+EK         ++EP Y
Sbjct:    1 MYHFFRTQKIIWMPQELDAFQPYPVEILPGRVYLGKISQACNAKMHKDLKIKAHVNISMETTPYFIGNADKLLHIKLEDSPDTLLFDYFRHICHFIELHLRLHSVVLVFSTRGISRSVAAVVALLMHYNEETLKRSWAQVKKCKTNMRPNRAFVAQLLEWEKVLHGEYLTDISEPIY 177          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y6J8|STYL1_HUMAN (Serine/threonine/tyrosine-interacting-like protein 1 OS=Homo sapiens OX=9606 GN=STYXL1 PE=1 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 1.982e-77
Identity = 131/314 (41.72%), Postives = 187/314 (59.55%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLD--------------PSSEAVKCANV----LLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEP-TYTEDPFY 1003
            M  L L EPT LY ILNQ    S L++P YL LLD R K EY+E H+I A R+KK + N+Y++P   +LEC +  VVYD N+++L+                 + V  A +    +LT    + V ILKGGYE FS  Y FLRTQKI+WMP+ELD + P+P+E++P  +++GN   ACD  +QK LKIK H+N + +    F    + L  +++ D+PE+ I  +   +C FI+ +   G  + ++S  GISR+   I+AYLMH  E +L +SW+Y+K   + M PNRG VSQL E+EK  + +  T   DP Y
Sbjct:    1 MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKN-NEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY 313          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. UniProt/SwissProt
Match: sp|P28562|DUS1_HUMAN (Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3)

HSP 1 Score: 101.293 bits (251), Expect = 1.433e-22
Identity = 85/293 (29.01%), Postives = 137/293 (46.76%), Query Frame = 2
Query:  212 LLLDARIKDEYNECHI----------IMAKRMKKNDKNDYIVPYDSELECQ------EKIVVYDGNTNSLDPSSE--AVKCANVLLTNGARNG-VLILKGGYEYFSRLYPFLRTQKI--LWMPRELDTYHP------------------FPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVA 973
            LLLD R    +N  HI          I+ +R K     ++IVP ++EL  +        +V+ D  + +LD +     +  A   L   AR   V  LKGGYE FS   P L +++   + +   L T  P                   P+E++P  LYLG++ HA  + +   L I   IN +      FE  +     + V DN +++I  +F++   FID  +  G RVFV+   GISR+  I +AYLM    + L +++ ++K   S++ PN  F+ QL ++E + +A
Sbjct:   25 LLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAMGLEHIVP-NAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFFLKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILP-FLYLGSAYHASRKDMLDALGITALINVSANCPNHFEG-HYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLA 314          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. UniProt/SwissProt
Match: sp|Q13115|DUS4_HUMAN (Dual specificity protein phosphatase 4 OS=Homo sapiens OX=9606 GN=DUSP4 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.029e-21
Identity = 74/276 (26.81%), Postives = 129/276 (46.74%), Query Frame = 2
Query:  251 CHIIMAKRMKKNDKNDYIVPYDSELECQ------EKIVVYDGNT---NSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFL--RTQKILWMPREL--DTYHPF----------------PLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTE 991
            C+ I+ +R K +   + I+P + E+  +        ++VYD  +    SL   S        L  N  R  + +LKGGYE FS  YP    +T+ +  +P  +      P                 P+E++P  LYLG++ HA  R +   L I   +N +++    FE  +     + V DN +++I  +F +   +ID  +    RV V+   GISR+  I +AYLM  + + L +++ ++K   S++ PN  F+ QL ++E + +A     E
Sbjct:   69 CNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILP-FLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEG-HYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAE 342          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. UniProt/SwissProt
Match: sp|P28563|DUS1_MOUSE (Dual specificity protein phosphatase 1 OS=Mus musculus OX=10090 GN=Dusp1 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 2.070e-21
Identity = 85/295 (28.81%), Postives = 132/295 (44.75%), Query Frame = 2
Query:  212 LLLDARIKDEYNECHI----------IMAKRMKKNDKNDYIVPYDSELECQ------EKIVVYDGNTNSLDPS---SEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFL----RTQKILWMPRELDTYHP------------------FPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVA 973
            LLLD R    +N  HI          I+ +R K     ++IVP ++EL  +        +V+ D  + SLD +         A  L        V  L+GGYE FS   P L     T   L +P  L T  P                   P+E++   LYLG++ HA  + +   L I   IN +      FE  +     + V DN +++I  +F++   FID  +  G RVFV+   GISR+  I +AYLM    + L +++ ++K   S++ PN  F+ QL ++E + +A
Sbjct:   25 LLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAMGLEHIVP-NAELRGRLLAGAYHAVVLLDERSASLDGAKRDGTLALAAGALCREARSTQVFFLQGGYEAFSASCPELCSKQSTPTGLSLP--LSTSVPDSAESGCSSCSTPLYDQGGPVEIL-SFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEG-HYQYKSIPVEDNHKADISSWFNEAIDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLA 314          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. UniProt/SwissProt
Match: sp|Q64623|DUS1_RAT (Dual specificity protein phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Dusp1 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 3.429e-21
Identity = 81/293 (27.65%), Postives = 133/293 (45.39%), Query Frame = 2
Query:  212 LLLDARIKDEYNECHI----------IMAKRMKKNDKNDYIVPYDSELECQ------EKIVVYDGNTNSLDPS---SEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKI--LWMPRELDTYHP------------------FPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVA 973
            LLLD R    +N  HI          I+ +R K     ++IVP ++EL  +        +V+ D  + +LD +         A  L        V  L+GGYE FS   P L +++   + +   L T  P                   P+E++   LYLG++ HA  + +   L I   IN +      FE  +     + V DN +++I  +F++   FID  +  G RVFV+   GISR+  I +AYLM    + L +++ ++K   S++ PN  F+ QL ++E + +A
Sbjct:   25 LLLDCRSFFAFNAGHIVGSVNVRFSTIVRRRAKGAMGLEHIVP-NTELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARSTQVFFLQGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEIL-SFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEG-HYQYKSIPVEDNHKADISSWFNEAIDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLA 314          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. TrEMBL
Match: V4B117 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_238401 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 3.962e-92
Identity = 145/294 (49.32%), Postives = 198/294 (67.35%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKK-FVAEPTYTEDP 997
            M  LKL+EP+ LY IL Q   +S LS+P YLLL+DAR K+EYNE HII AK+  KN+++ +++PYD+ELEC++ IVVYD NT SL   + A   A +L   G+RN V ILKGGYE FS LYPFLRTQKI++MPRELD   P+P+E+IP  LYLGN +     YVQK LKIK HINC  E    F  +   L  ++V D  +++I  +F   C+F+D +R+  K V V+S+LGISR+  +I+AYLM+ ++ SL +++  +      +RPNRGF+ QLS +E + F  + T   DP
Sbjct:    1 MDGLKLLEPSELYNILQQSTVFSCLSDPNYLLLMDARKKNEYNESHIITAKKAPKNEEDQFMIPYDAELECKQTIVVYDSNTESLKEETPATDYAKLLWKLGSRNEVNILKGGYEAFSALYPFLRTQKIIYMPRELDDLKPYPIEIIPGLLYLGNWQQGNAAYVQKDLKIKGHINCVIESETYFPESGPQLLHIQVEDRNDADIYNHFAAACAFLDTHRRLKKAVLVFSNLGISRSVTVIVAYLMYYKKCSLKEAYEIVSKCCKNLRPNRGFIEQLSNWEVELFDTQKTDISDP 294          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. TrEMBL
Match: A0A1S3HY40 (serine/threonine/tyrosine-interacting-like protein 1 OS=Lingula unguis OX=7574 GN=LOC106170221 PE=4 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 1.064e-90
Identity = 138/289 (47.75%), Postives = 196/289 (67.82%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSL-DPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPT 982
            M+ + L+E T LY +LN    Y  LS+P Y++LLDAR K EYNE H++ +K+  KN+  D+ VPY +ELEC++ +VVYDGNT+SL D  S A +CA+V+    +RN V ILKGGYE FS LYPFLRTQKI++MP+E+D    +P+EVIP  LY+GN R     Y+QK LK+K HINC  E  EIF+     L  + V DN E+++   F + C+F+D++R   + V VYS  GISR+  I+MAYLMH  + +L +++ +    S  +RPNRGFV QL+++E++ + + T
Sbjct:    1 MAGIVLLEATDLYNLLNAATIYPCLSDPNYMMLLDARKKHEYNESHVVTSKKAPKNENGDFTVPYGAELECKQHVVVYDGNTDSLKDTESPAYQCASVM-AETSRNPVNILKGGYEDFSALYPFLRTQKIIFMPQEMDNLKTYPIEVIPGFLYMGNMRQGNAAYIQKDLKVKGHINCCVEPGEIFKEQGPQLLHIPVEDNEEADMYSQFKEACTFLDEHRNGNRVVLVYSARGISRSACIVMAYLMHHNKWTLKEAYQHALRCSPTVRPNRGFVEQLAKWEEEVLGQKT 288          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. TrEMBL
Match: A0A210QWI6 (Serine/threonine/tyrosine-interacting-like protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT00533 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 6.309e-89
Identity = 136/293 (46.42%), Postives = 195/293 (66.55%), Query Frame = 2
Query:  128 LKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEK-KFVAEPTYTEDPFY 1003
            L ++EPT LY +L Q   YSNLS+P YLLL+DAR K+EYNE H++ AK+  K+ +  + VPYD+ELEC++ +VVYD NT +L     A+ C  +L   G+RN V ILKGGYE FS LYPFLRTQK+++MP+E+D    +P+E+I   LYLGN R     Y+QK LKIK H+NC  E    F     +L  ++V+D  E+++     + C+FID ++++ + V V+S LGISR+  +I+AYLMH  + +L +++ +L    S +RPNRGF+ QLS++E+  F    T  EDP Y
Sbjct:    6 LDVLEPTDLYNMLQQATIYSNLSDPNYLLLIDARNKNEYNESHVVTAKKAPKDAEGSFGVPYDAELECKQNVVVYDSNTKTLREGGLAIDCGVMLWEKGSRNRVKILKGGYEEFSALYPFLRTQKVMFMPKEMDEMKSYPIEIIHGFLYLGNWRQGNAPYIQKDLKIKGHVNCCLESETFFSEPGPHLLHLQVNDEVEADLYSKLQNACAFIDTHKEKNEAVLVFSSLGISRSATVIVAYLMHHFKWTLKEAYGHLTQCCSTVRPNRGFIHQLSKFEEYLFGKATTQIEDPNY 298          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. TrEMBL
Match: R7TM04 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_126144 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 3.213e-88
Identity = 139/296 (46.96%), Postives = 190/296 (64.19%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEP-TYTEDPFY 1003
            M  L L+EPT LY +LNQ   Y  LS+P YLLLLDAR  DEYNE HI+ AK+  +N  + + VP D+ELEC+  ++VYDGNT+SL   + AV CA ++   G+R  V +LKGGYE FS +YPFLRTQKI++MPRELD     P E+IP  L+LGN R     Y+QK LKIK HINC+      +     +L  V V D+ +++I  +F   C FID ++++   V V+S LGISR+  I +AYL+H  + +L +S+++       +RPNR FV QLS++E+K + E  T   DP Y
Sbjct:    1 MVGLDLLEPTDLYNLLNQATKYPFLSDPAYLLLLDARKTDEYNESHIVTAKKAPQNRDDSFKVPQDAELECKTHVIVYDGNTSSLKDKTPAVHCAELMWRMGSRGPVKVLKGGYEAFSAMYPFLRTQKIIYMPRELDCIETLPTEIIPGLLHLGNWRQGNAAYIQKDLKIKGHINCSMTPETFYREEGPSLLQVSVEDSVDADISNFFQAACEFIDSHKEKKNVVLVFSDLGISRSAAIAVAYLIHCNKWTLKESYAHALKCCVTIRPNRSFVEQLSKWEEKILGEKRTDISDPNY 296          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. TrEMBL
Match: A0A452IS09 (Serine/threonine/tyrosine interacting like 1 OS=Gopherus agassizii OX=38772 GN=STYXL1 PE=4 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 8.174e-86
Identity = 139/313 (44.41%), Postives = 189/313 (60.38%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLD-----------------PSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKF-------VAEPTY 985
            M+ L L EPT LY ILNQ    S L+ P YL LLDAR K EYNE H+I A+R+K+N   DY+VP   ELEC +  VVYD  T+SLD                     A++CA VL     R+ V ILKGGYE F+  Y FLRTQKI WMP+ELD + P+P+E++P  LY+G+ R ACD+ +QK LKIK  +N + E+  +F   ++ L  V V+D+P++++   F  +C FID     G  V V+S LG+SR+   +MA+LMH     L ++W Y++   + MRPNRGFV QLS +E +        ++EP Y
Sbjct:    1 MAGLVLCEPTELYNILNQSTKLSRLTEPNYLCLLDARTKREYNESHVITARRVKQNPGGDYLVPESVELECVKYCVVYDSKTSSLDDIYYDDYEEKEEDEKDAEVGAAIQCARVL-EQFTRHPVRILKGGYERFTACYHFLRTQKIFWMPQELDAFQPYPVEILPAQLYMGDYRQACDQQIQKDLKIKAQVNISEELATLFTDESKTLLHVSVADSPDADLFSLFPTICHFIDAKMALGA-VLVFSTLGLSRSSTAVMAFLMHSSHYPLKRAWKYIQKCKTNMRPNRGFVQQLSAWESQIYGSAITDISEPHY 311          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Cavefish
Match: styxl1 (serine/threonine/tyrosine interacting like 1 [Source:NCBI gene;Acc:107197590])

HSP 1 Score: 216.468 bits (550), Expect = 1.148e-67
Identity = 116/296 (39.19%), Postives = 175/296 (59.12%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYE-----KKF--VAEPTY 985
            M+   L EP+ LY ILNQ   YS L+ P +L ++D R +  Y   HII AK  K      +I+P D E+E    I+VYD NT+SL  S  A   A  L    +R+ V ILKGGYE FS +YPF R QKIL+  REL++  P+P+E++P  LY+G  R A +  + K LK+   IN + ++  + E+    +  ++VSD+ ++++   F+ VC+F+  + +     F++S  GISR  V+ MA+LMH  + +L ++W +++   + MRPNRGFV QLS +E     KK   ++EP Y
Sbjct:    1 MAGTVLCEPSELYNILNQNQRYSRLTEPNFLCVIDTRAEGPYFCSHIITAKHAKWGSDGKWIIPADVEVESMRYIIVYDSNTSSLQDSGPATDYAESL-AKASRHPVQILKGGYERFSAIYPFFRNQKILYTIRELESLEPYPVEILPGQLYMGEFRQAANPQILKDLKLTALINVSDDL--MLENGKLTVLHIRVSDSVDADLSSSFESVCNFLTSHLEARSVAFIFSTHGISRCSVLAMAFLMHHLQYTLKEAWDHVQKCKANMRPNRGFVQQLSSWELCVLGKKITDISEPNY 293          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Cavefish
Match: dusp4 (dual specificity phosphatase 4 [Source:NCBI gene;Acc:103029669])

HSP 1 Score: 93.9745 bits (232), Expect = 4.473e-21
Identity = 75/289 (25.95%), Postives = 132/289 (45.67%), Query Frame = 2
Query:  209 LLLLDARIKDEYNECHI----------IMAKRMKKNDKNDYIVPYDSELECQ------EKIVVYDGNTN---SLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYP-FLRTQKILWMPRELDTY--------HPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTE 991
            LLLLD R    ++  HI          I+ +R K +   + I+  D E   +        +++YD  T    ++   S      N L  +  R  V +LKGGY+ F   YP +    + L +P  + +            P+E++P  L+LG++ HA  + +   + I   +N ++     FE   +    + V DN + +I  +F +   FID  +    RV V+   GISR+  I +AYLM  + + L +++ ++K   S++ PN  F+ QL ++E + +A     E
Sbjct:   28 LLLLDCRSFLAFSAGHIRGAVNARANTIVRRRAKGSVSLEQILSGDDEARSRLLAGLYSAVILYDERTQDARAVKEDSTLTLVLNALGRDTFRTDVYLLKGGYDRFCSQYPDYCLKSRTLPVPSTVSSTSCGTPHHDQGGPVEILP-FLFLGSALHASKKDMLDGMGISALLNVSSNCPNHFEGAYQYKC-IPVEDNHKEDISSWFIEAIEFIDSIKDSNGRVLVHCQAGISRSATICLAYLMKKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAVE 314          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Cavefish
Match: dusp2 (dual specificity protein phosphatase 2 [Source:NCBI gene;Acc:103038175])

HSP 1 Score: 93.2041 bits (230), Expect = 7.150e-21
Identity = 56/189 (29.63%), Postives = 98/189 (51.85%), Query Frame = 2
Query:  437 VLILKGGYEYFSRLYPFL--------RTQKILWMPRELDTYHPFPL-------EVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYE 958
            V  L+GG+E F  LYP L         +   L  P  L++    PL       E++P  L+LG++ H+  R   ++  I   +N ++    +FE   + +  +KV D+  ++I ++F +   FID  ++ G RV V+   GISR+  I +AYL+H   + L +++ ++K    V+ PN  F+ QL ++E
Sbjct:  123 VCFLQGGFEEFVSLYPELCLNTPLKCGSPSTLSDPETLNSTKSMPLYDQGDPVEILP-FLFLGSAHHSSQRDTLERCGITAVLNVSSSCPNLFEQELQYM-TLKVEDSLAADIRVFFPEAIRFIDSVKESGGRVLVHCQAGISRSATICLAYLIHARRVRLDEAFDFVKRRRQVISPNLAFMGQLLQFE 309          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Cavefish
Match: dusp2 (dual specificity protein phosphatase 2 [Source:NCBI gene;Acc:103038175])

HSP 1 Score: 92.8189 bits (229), Expect = 8.245e-21
Identity = 56/189 (29.63%), Postives = 98/189 (51.85%), Query Frame = 2
Query:  437 VLILKGGYEYFSRLYPFL--------RTQKILWMPRELDTYHPFPL-------EVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYE 958
            V  L+GG+E F  LYP L         +   L  P  L++    PL       E++P  L+LG++ H+  R   ++  I   +N ++    +FE   + +  +KV D+  ++I ++F +   FID  ++ G RV V+   GISR+  I +AYL+H   + L +++ ++K    V+ PN  F+ QL ++E
Sbjct:  128 VCFLQGGFEEFVSLYPELCLNTPLKCGSPSTLSDPETLNSTKSMPLYDQGDPVEILP-FLFLGSAHHSSQRDTLERCGITAVLNVSSSCPNLFEQELQYM-TLKVEDSLAADIRVFFPEAIRFIDSVKESGGRVLVHCQAGISRSATICLAYLIHARRVRLDEAFDFVKRRRQVISPNLAFMGQLLQFE 314          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Cavefish
Match: dusp1 (dual specificity phosphatase 1 [Source:NCBI gene;Acc:103038437])

HSP 1 Score: 92.8189 bits (229), Expect = 1.471e-20
Identity = 64/218 (29.36%), Postives = 108/218 (49.54%), Query Frame = 2
Query:  404 NVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKI----LWMPR----ELDTYH--------PF-----PLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTED 994
              L  N     ++ LKGG+E F   +P + T+ +    L +P     + DT          P      P+E++P  LYLG++ HA  + +   L I   IN +      FE  +     + V DN +++I  +F++   FID  R +G RVFV+   GISR+  I +AYLM    + L +++ ++K   S++ PN  F+ QL ++E + +A  T + +
Sbjct:  118 TALCRNPCGAEIVFLKGGFETFVSEFPEMCTKPVPPQGLSLPLSDSCQSDTTESGCNTCATPLYDQGGPVEILP-FLYLGSAYHASRKDMLDMLGITALINVSANCPNHFEE-HYQYKSIPVEDNHKADISSWFNEAIEFIDSVRNKGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLASSTCSSE 333          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Sea Lamprey
Match: styxl1 (serine/threonine/tyrosine interacting-like 1 [Source:ZFIN;Acc:ZDB-GENE-040912-45])

HSP 1 Score: 210.69 bits (535), Expect = 3.476e-66
Identity = 109/280 (38.93%), Postives = 170/280 (60.71%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYE 958
            M++L  +EPT LY +LNQ      LS+  Y++L+DAR    Y E HII A+  KK+      + Y++ELEC+E  VVYD  +  LD  S  V CA +L     +N V +L GGYE F+ LYPFLR+ KI++ P+ELD+   +P+E+I   LYLG++  A    V+K LK++ +++ T +   I ++++  L  + V+++  +++  +F ++C FID+  +  + V V+S   ISR   + +AYLMH  +  L KSW +L      +RP+RGFV QLS +E
Sbjct:    1 MASLATMEPTRLYNLLNQ----KCLSDAHYIVLVDARTPSAYEESHIITARHAKKDLHGVLTLLYENELECKEWCVVYDNKSQHLDEESPGVTCARIL-EQSRKNVVYVLSGGYERFTALYPFLRSHKIIYTPQELDSLFVYPVELIAGCLYLGDANQASCACVKKALKLRAYVSITEQEGLICDTSDAALLSIPVAEDQGADLFSHFPNICQFIDEALELKRPVLVFSQSAISRGCTVAIAYLMHRFKWDLQKSWGHLLQCQRNVRPHRGFVEQLSRWE 275          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Sea Lamprey
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 97.4413 bits (241), Expect = 4.843e-23
Identity = 86/298 (28.86%), Postives = 129/298 (43.29%), Query Frame = 2
Query:  185 SNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKND-----------KNDYIVPYDSELECQE----KIVVYDGNTNSLDPSSEAVKCANVLLTNGARN---GVLILKGGYEYFSRLY-----------PFLRTQKILWMPREL-------DTY-HPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVK---VSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYE 958
            S L N RYLLL D R    Y+  H+  +  +  N                +   ++    Q      +V+ D  T  L         A V L  G       V  L+GGYE F R +           P   T   L  P  +        TY    P+E++P  LYLG++ HA  R +   + I   +N + ++   FE     LF  K   V DN +++IG +F +   FID  R+ G RVFV+ H G+SR+  I +AYLM    + L +++ +++   SV+ PN  F+ QL  +E
Sbjct:   39 SPLGNSRYLLL-DCRSFLAYSASHVRGSLNVHTNPILLRRRRRGIRATQLLPSAEARARLQAGLYAAVVLVDERTRELSALRADSTLAMVALALGRETRGTPVYFLRGGYEKFHRDFSELCLDAALTSPCKTTPPALLPPVPIRLHTAGTPTYDQGGPVEILP-FLYLGSAYHASRRELLDAIGITALLNVSADLPNHFE----GLFTYKSIPVEDNHKADIGAWFLEAIDFIDSTRRGGGRVFVHCHAGVSRSATICLAYLMKTRRLRLDEAFEFVRQRRSVISPNFNFLGQLQSFE 330          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004127.1 (pep scaffold:Pmarinus_7.0:GL482725:7128:13243:-1 gene:ENSPMAG00000003769.1 transcript:ENSPMAT00000004127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 7.995e-17
Identity = 74/287 (25.78%), Postives = 129/287 (44.95%), Query Frame = 2
Query:  209 LLLLDARIKDEYNECHI----------IMAKRMKKNDKN-----DYIVPYDSELECQEKIVV--YDGNTNSLDPSSEAVKC---ANVLLTNGAR--NGVLILKGGYEYFSRLYPFL---------RTQKILWMPRELDTYH---PFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKF 967
            LL++D R   E+N CH+          ++ +R++++  +      +     S++E    +VV  YD  +    PS+ ++      +VLL    R  + V +L GG+  F  L+P L         RT   L +P    + H     P  ++P  LYLG+ R   ++ ++ Q  I   +N +            N   V V D+    I  + D   +FI+  R  G RV V+   GISR+  + +AY+M  + +S   ++ ++K     + PN  F+ QL EYE++ 
Sbjct:   29 LLVIDGRTFAEFNSCHVRSALNVCCSKLVQRRLQQDKVSVLELVQHAATSGSQVEAGGPVVVVVYDQRS----PSAASLPPHGFVSVLLGKLRRTFSDVYLLDGGFAAFQLLFPQLCENASRVDTRTPP-LALPVSSPSLHLRDTGPTCILPY-LYLGSQRDVLNKAIRVQSGITHVLNASVGCPRPDFIPEGNFLRVPVHDSYCEKILPWLDCTANFIEGVRARGSRVLVHCLAGISRSATVAIAYVMRCKRLSSDDAYRFVKEKRPSISPNFNFLGQLLEYEREL 309          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Sea Lamprey
Match: dusp6 (dual specificity phosphatase 6 [Source:ZFIN;Acc:ZDB-GENE-030613-1])

HSP 1 Score: 71.2478 bits (173), Expect = 6.726e-14
Identity = 41/140 (29.29%), Postives = 78/140 (55.71%), Query Frame = 2
Query:  542 FPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLF-DVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYE 958
            FP+E++P  LYLG +R + +     +  I+  +N T  +   FES  + ++  + V D+   N+  +F +  +FID+ R++   V V+   GISR+  + +AYLM    +SL  ++  +++  + + PN  F+ QL ++E
Sbjct:  219 FPVEILPY-LYLGCARDSTNLAALAEHGIRYILNVTPNVPNAFESRRDFVYKQIPVPDHWSQNLSQFFPEAIAFIDEARQKKCGVLVHCLAGISRSVTVTVAYLMQTLNLSLNDAYDLVRNKKANISPNFNFMGQLLDFE 357          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Sea Lamprey
Match: dusp22b (dual specificity phosphatase 22b [Source:NCBI gene;Acc:100002272])

HSP 1 Score: 67.0106 bits (162), Expect = 8.931e-14
Identity = 42/145 (28.97%), Postives = 74/145 (51.03%), Query Frame = 2
Query:  557 IPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFD-----VKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAE 976
            + + LYLGN + + D    KQL+     +  T I  + ++  E L +     ++VSD P  N+  +F D   FI K R E K   V+   G+SR+  +++AY+M +  +   ++   +K+  +   PN GF  QL  ++ + +AE
Sbjct:    8 VLEGLYLGNIKDSADL---KQLRD----HNITHILSVHDAAREALEEMTYLCIQVSDTPSQNLTQHFKDCIQFIHKCRMEKKGCLVHCLAGVSRSVTMVVAYIMTVTSLGWEEAMVAVKTARTCANPNLGFQQQLQMFQNEQLAE 145          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Yeast
Match: SDP1 (Stress-inducible dual-specificity MAP kinase phosphatase; negatively regulates Slt2p MAP kinase by direct dephosphorylation, diffuse localization under normal conditions shifts to punctate localization after heat shock; SDP1 has a paralog, MSG5, that arose from the whole genome duplication [Source:SGD;Acc:S000001375])

HSP 1 Score: 50.447 bits (119), Expect = 7.242e-8
Identity = 35/138 (25.36%), Postives = 68/138 (49.28%), Query Frame = 2
Query:  545 PLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYE 958
            PL V+P+ +YL +     +  V++ L     IN   E N++        +     ++ +S I +    + S I     + +++ ++   G+SR+  +I+AY+M    +SL  S+  LKS +  + P+ G + QL E+E
Sbjct:   60 PLLVLPEKIYLYS-----EPTVKELLPFDVVINVAEEANDLRMQVPAVEYHHYRWEH-DSQIALDLPSLTSIIHAATTKREKILIHCQCGLSRSATLIIAYIMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWE 191          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Yeast
Match: MSG5 (Dual-specificity protein phosphatase; exists in 2 isoforms; required for maintenance of a low level of signaling through the cell integrity pathway, adaptive response to pheromone; regulates and is regulated by Slt2p; dephosphorylates Fus3p; MSG5 has a paralog, SDP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004998])

HSP 1 Score: 46.9802 bits (110), Expect = 3.375e-6
Identity = 21/66 (31.82%), Postives = 39/66 (59.09%), Query Frame = 2
Query:  758 FIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEY 955
             I     +GK++ V+   G+SR+  +I+AY+M    +SL  +++ LK ++  + PN G + QL E+
Sbjct:  304 IIHTAHSQGKKILVHCQCGVSRSASLIVAYIMRYYGLSLNDAYNKLKGVAKDISPNMGLIFQLMEW 369          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Yeast
Match: YVH1 (Dual specificity protein phosphatase; regulates growth, sporulation, and glycogen accumulation in a cAMP-dependent protein kinase cascade dependent manner; mutants are defective in 60S ribosome assembly; positively regulates pre-autophagosomal structure (PAS) formation upon nitrogen starvation or rapamycin treatment [Source:SGD;Acc:S000001465])

HSP 1 Score: 45.8246 bits (107), Expect = 5.439e-6
Identity = 29/109 (26.61%), Postives = 51/109 (46.79%), Query Frame = 2
Query:  686 NLFDVKVSDNPESNIGIYFDDVCSFID-----------------KNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEK 961
             L ++ + D+  +++  YFD+   FID                 K + +   VF +   G+SR+   I+AYLM+   +SL+ +   +K     + PN  F+ QL  +EK
Sbjct:   61 TLKNIPIDDDDVTDVLQYFDETNRFIDQCLFPNEVEYSPRLVDFKKKPQRGAVFAHCQAGLSRSVTFIVAYLMYRYGLSLSMAMHAVKRKKPSVEPNENFMEQLHLFEK 169          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Nematostella
Match: EDO47392 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLU3])

HSP 1 Score: 238.81 bits (608), Expect = 7.385e-77
Identity = 124/297 (41.75%), Postives = 186/297 (62.63%), Query Frame = 2
Query:  122 STLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSL-DPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNR-KEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKF-------VAEPTY 985
            S + L + + LY ILNQ   Y  LS+P YLLLLD R ++EYNE HII +K   +ND   + VPYD+ELE +  +VVYD NT S  D  S A+ CA +L   G+RN V ++KGGYE FS LYPFLRTQKI++ PRELDT   +P+EV+P  LY+G  + + ++ + K LK+K H+N T       E+  + +  + V D  ++++  +  +   FID ++  +G+ V ++S+LGISR+  + + YLM  ++ISL  ++S L      M+PNR F+ QLS++E++        ++EP Y
Sbjct:    4 SGVILCDSSELYNILNQASQYPRLSDPNYLLLLDTRKRNEYNESHIITSKFAPRNDIGAFTVPYDAELETKIHVVVYDSNTTSTKDKGSPALSCAKLLWEMGSRNQVKVVKGGYEEFSALYPFLRTQKIMYTPRELDTLITYPVEVLPSFLYIGTYKQSQNKAITKDLKVKAHVNVT------MEADKDQVLTIAVEDENKADLLTHMKEAVQFIDDHKTNDGRCVLIFSNLGISRSVTVAIGYLMWSKKISLKDAYSQLHKCRENMQPNRAFIEQLSQWEEQLFGKTITDISEPGY 294          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Nematostella
Match: EDO42672 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S104])

HSP 1 Score: 112.079 bits (279), Expect = 2.423e-28
Identity = 79/287 (27.53%), Postives = 143/287 (49.83%), Query Frame = 2
Query:  152 LYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKK--NDKNDYI-------VPYDSELECQEKIVVYD---GNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAE 976
            LY  LN       + +  Y+LL+D R ++ Y +CHI++A+  K    +   Y        +  ++ L     ++VY    GN N+L  S E  K    L + G      +L  G+E F   +PFL T K  +   +      +P  ++P+ LYLG    A ++ + + LKI   +N T E    F  + E L  +++ D P++ +  +F+    F+      G  V V+ ++G+SR+  + +AYL+  +  +L +++S++K   S +RPNRGF+ QL+ +E+  + +
Sbjct:    2 LYNYLNDGALSPCICDTSYMLLIDTRDRELYEKCHILLARSSKTLFTELQSYSLYGITTGINLENALNGFAFVIVYGNYVGN-NNLQESKE-YKLIRELESYGVEP--YLLAAGFEAFYTEFPFLCTDKQFYQLEDYKRIQIYPSIILPKQLYLGKGDQATNKKIMEDLKITHIVNITQEHKSAFPESIEYL-TLQLDDVPQTQLINFFEKTTKFLSDAIDGGGCVMVHCNMGVSRSSSVTLAYLIKSKRWTLGEAYSFIKERRSCVRPNRGFLKQLATWEEMILGK 283          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Nematostella
Match: EDO49250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX7])

HSP 1 Score: 92.0485 bits (227), Expect = 4.174e-21
Identity = 74/251 (29.48%), Postives = 113/251 (45.02%), Query Frame = 2
Query:  323 LECQEKIVVYDGNT---NSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYP----FLR-TQKILWMPREL------DTYHPF-----------------------PLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKK 964
            LE  + I+ YD  T     L+  S     A +L     +  +  +KGG+E FS L+     F++     L  P +L      D   PF                       P+E++P  LYLG+  HA  R V K+L I   +N +  I   FE +      + V D   ++IG++F++   FID  +  G RV V+   GISR+  I +AYL+      L +++ Y+K   SV+ PN  F+ QL  YE +
Sbjct:   61 LEEADTIIFYDDRTCDWKDLENDSTMKIVAKLLRWEKRKATLFYIKGGFERFSALFSTMCEFIKPCNSSLTSPLKLKLMTSADGRKPFSPRWDTDNKDDQLPRAHSNSVNEPVELLPH-LYLGSELHASRRDVLKRLGISAIVNVSRNIPNTFEDSF-TYKTIPVDDTYNADIGVWFEEAAGFIDSVKASGGRVLVHCQAGISRSATICLAYLISRLNFRLDEAYEYVKKRRSVISPNFNFMGQLLHYETQ 309          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Nematostella
Match: EDO37000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGZ1])

HSP 1 Score: 78.5666 bits (192), Expect = 1.319e-17
Identity = 40/132 (30.30%), Postives = 74/132 (56.06%), Query Frame = 2
Query:  569 LYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFD-VKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEK 961
            L+LG+   A D  +  +L IK  +N T      F    + ++  ++++D+ + +IG +FD+  +FID+ R  G  V V+ H G+SR+  + +AY+M    +SL +++ ++K     + PN  F+  L +YEK
Sbjct:    5 LFLGSEEGAADEDLIDRLAIKFILNLTPVCPNFFSEREDIIYKRIQINDSYQEDIGQHFDEAIAFIDEARSRGSSVLVHCHAGVSRSATVTVAYVMQHLGLSLNEAYQFVKEKRPTISPNLNFMGHLLKYEK 136          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Nematostella
Match: EDO47156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMT6])

HSP 1 Score: 76.6406 bits (187), Expect = 1.644e-16
Identity = 51/161 (31.68%), Postives = 84/161 (52.17%), Query Frame = 2
Query:  506 LWMPRELDT-YHPFPLEV---IPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAE 976
            ++  REL    H  PL     I + L+L + + A D  +  +  I   IN T E  E  +        +KV+DNP + IGI+FD V   I+  R+ G +V V+   G+SR+  +++AYLM  + ++L  +   ++    ++RPN GF  +L +YEKK   +
Sbjct:    1 MYRSRELKAAVHHSPLTAMARITEWLFLSSCQVARDEKLLLEKGITLVINATIEAPE-QDYKKVKHIRIKVNDNPGNKIGIFFDMVSDKIESVRRVGGKVLVHCIAGVSRSASLVIAYLMKYQRLNLRDAHKLVQDKRPLIRPNTGFWKELIDYEKKLFGK 160          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Medaka
Match: dusp1 (dual specificity phosphatase 1 [Source:NCBI gene;Acc:101173794])

HSP 1 Score: 98.5969 bits (244), Expect = 1.259e-22
Identity = 67/205 (32.68%), Postives = 111/205 (54.15%), Query Frame = 2
Query:  437 VLILKGGYEYFSRLYPFLRTQ----KILWMP---RELDT--YHPF---------PLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLF-DVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTED 994
            V ILKGG++ FS  YP + T+    + L +P   R  D+  Y P          P+E++P  LYLG++ HA  + + + L I   IN +      FE  +  L+  + V DN +++I  +F++   FID  R +G RVFV+   GISR+  I +AYLM    + L +++ ++K   S++ PN  F+ QL ++E + +A  T + +
Sbjct:  119 VYILKGGFDAFSTEYPDMCTKSSPPQGLSLPLSSRNPDSASYSPCNTPLYDQGGPVEILPF-LYLGSAYHASRKDMLEMLGITALINVSANCPNHFE--DSFLYKSIPVEDNYKADISSWFNEAIEFIDSVRNKGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKKRRSIISPNFSFMGQLLQFESQVLASSTCSSE 320          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Medaka
Match: dusp4 (dual specificity phosphatase 4 [Source:NCBI gene;Acc:101166402])

HSP 1 Score: 94.7449 bits (234), Expect = 3.455e-21
Identity = 83/291 (28.52%), Postives = 135/291 (46.39%), Query Frame = 2
Query:  212 LLLDAR---------IKDEYN-ECHIIMAKRMKKNDKN-DYIVPYDSELECQ------EKIVVYDGNTNSLDPSSEAVK-------CANVLLTNGARNGVLILKGGYEYFSRLYP--FLRTQKILWMPRE---------LDTYH---PFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFV 970
            LLLD R         I+   N  C+ I+ +R K +  + D I+  D E+  +        +VVYD  T    P +EAVK         N L  +       +LKGGY+ F   YP   +RT+ +  +  +           T H     P+E++P  LYLG++ HA  + V   + I   +N + +    FE   +    + V DN + +I  +F +   FID  R    RV V+   GISR+  I +AYLM  + I L +++ +++   S++ PN  F+ QL ++E + +
Sbjct:   28 LLLDCRSFLAYSAGHIRGAVNARCNTIVRRRAKGSALSLDQILAGDDEVRSRLRSGMYSAVVVYDERT----PDTEAVKEDSTMMLVLNALFRDSLGTRTYLLKGGYDRFFSEYPEFCMRTKSLPSLTSQSSIDSSCSSCGTPHNDQGGPVEILP-FLYLGSALHASKKEVLDAIGISALLNVSADCPNHFEGAYQYKC-IPVEDNHKEDISCWFLEAIEFIDSVRDSSGRVLVHCQAGISRSATICLAYLMKRKRIRLDEAFEFVRRRRSIISPNFSFMGQLLQFESQVL 312          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Medaka
Match: dusp16 (dual specificity phosphatase 16 [Source:NCBI gene;Acc:111946967])

HSP 1 Score: 92.8189 bits (229), Expect = 3.645e-20
Identity = 76/280 (27.14%), Postives = 133/280 (47.50%), Query Frame = 2
Query:  212 LLLDARIKDEYNECHIIMA------KRMKKNDKNDYI---------VPYDSELECQEKIVVYDGNTNSLDPSSEAVKC-ANVLLTNGARN--GVLILKGGYEYFSRLYPFLRTQKILWMPRE-----LDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPT 982
            +L+D+R   ++N  HI+ A      K MK+  + D +            + +L+  +++VVYD   +S DP++    C  +VLL    +N   V +L GG+  FSRL+P L   +   +P       L    P P  ++P  LYLG  R   +  + ++  I   +N +    +       +   V V+D+    I  + D    FI++ +    RV V+   GISR+  I +AY+M   ++SL +++ ++K     + PN  F+ QL ++EKK    P+
Sbjct:   23 VLIDSRPFVDFNAAHILEAVNVNCSKLMKRRLQQDKVQITELLQHSAKKELDLQAAQEVVVYD--QSSSDPAALGSDCFLSVLLVKLEKNFTSVHLLSGGFSTFSRLFPGLCEGRSALVPSCVSQPCLPISSPGPTRILPH-LYLGCQRDVLNTDLMRENDIAYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDRSVEFIERAKASNGRVLVHCLAGISRSATIAIAYIMKRMDLSLDEAYRFVKEKRPTISPNFNFLGQLLDFEKKIKTPPS 299          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Medaka
Match: dusp2 (dual specificity protein phosphatase 2 [Source:NCBI gene;Acc:101157459])

HSP 1 Score: 89.3521 bits (220), Expect = 1.103e-19
Identity = 66/228 (28.95%), Postives = 116/228 (50.88%), Query Frame = 2
Query:  341 IVVYDGNTNSL-DPSSEAVKCANVLLT---NGARNGVLILKGGYEYFSRLYPFL-----RTQKILWMP------RELDTY-HPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAE 976
            +VV D  +  L D   E+V  A++LL+   N  +  +  L+GG+E FS  +P L      +Q  L  P      R    Y    P+E++P  L+LG++ H+  R +     I   +N ++    ++E   + L  + V D   ++I   F+   +FID  ++ G RV V+   GISR+  I +AYLMH + + L +++ ++K   +V+ PN  F+ QL ++E   + +
Sbjct:   91 VVVVDERSRCLSDVKPESV--AHMLLSALQNEVQAQICFLQGGFEGFSEAFPELCHCSASSQLSLMEPEPAVTGRSTPAYDQDGPVELLP-FLFLGSAVHSSRREMLTAAGITAVLNVSSTCPNLYEGEFKYL-RLTVEDTLAADIRACFNTAIAFIDSVKQSGGRVLVHCQAGISRSATICLAYLMHTQRVRLNEAFDFVKQRRNVISPNLAFMGQLLQFETDILCQ 314          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Medaka
Match: dusp14 (dual specificity phosphatase 14 [Source:ZFIN;Acc:ZDB-GENE-041010-162])

HSP 1 Score: 80.1073 bits (196), Expect = 3.168e-17
Identity = 46/137 (33.58%), Postives = 72/137 (52.55%), Query Frame = 2
Query:  557 IPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKF 967
            I  +L+L     A +R +     I C +N T E+   F   +     V ++D P S I +YFD V   I    ++   V V+   G+SR+  + +AYLM    +SLA++ +++K+   V+RPN GF  QL EYE+K 
Sbjct:   32 ITPNLFLSRGNVASNRSLLLSKGITCVVNATIELPN-FNWPHMEYVKVPLADMPHSPISLYFDSVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWRQLIEYERKL 167          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Planmine SMEST
Match: SMESG000070767.1 (SMESG000070767.1)

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 292/295 (98.98%), Postives = 295/295 (100.00%), Query Frame = 2
Query:  119 MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTEDPFY 1003
            MSTLK+IEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACD+YVQKQLKIKCH+NCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTEDPFY
Sbjct:    1 MSTLKIIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMAKRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQSLYLGNSRHACDKYVQKQLKIKCHVNCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTEDPFY 295          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Planmine SMEST
Match: SMESG000030100.1 (SMESG000030100.1)

HSP 1 Score: 84.3445 bits (207), Expect = 6.066e-18
Identity = 65/220 (29.55%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  341 IVVYDGNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSR------LYPFLRTQKIL---WMPREL-----DTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFD---VKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLS 949
            IV+YD      D    A+K  N +    +   V +L GG+  F        L   + +QKIL     P  L     D       E+IP+ LYLGN   A D++  ++ KI   +N T+ +   FE    N+F    +  SD+ + N+  YFD+  + I+  RK   R+F++   G+SR+  I+M YLM  + + + ++  Y++    +  PN  F+ QLS
Sbjct:  115 IVIYDEKDILKDRDLFAMKLINQIQLTCSL--VQVLSGGFSEFKTYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFE----NIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQLS 328          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Planmine SMEST
Match: SMESG000063504.1 (SMESG000063504.1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.512e-13
Identity = 64/270 (23.70%), Postives = 123/270 (45.56%), Query Frame = 2
Query:  212 LLLDARIKDEYNECHIIMAKR----MKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPSSEAVKCANVLLTNGARNGVLILKGGYEYFSRL---------YPFLRTQKILWMPREL------DTYHPFPLEVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVK---VSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEY 955
             +LD R    +   HI  AK      K   K   +    S+ + ++  ++YD  ++    +S  +   + LL N  +  +  L+GGY+ F ++          P  + Q   + P  +      D  +    ++ P  +++GN R + D  + K+L+I   +N T+     F   N N+F  +     D+   N+ + +++  +FID  R    RV V+   G+SR+P I++AYL+     S+ +   +++   S++ PN  F+ QL +Y
Sbjct:   83 FILDLRDSRHFQNGHIKGAKTANCTTKLMSKKTLMDWKRSDYDNEDHYILYDQQSDLPAANSPQIVLIDYLLLNNKQ--ITYLQGGYDEFKKVCKESLIETSLPKEKLQSYNYSPTNVHINNSEDVLNATASQIFP-FIFIGNERDSSDLELLKELEITHILNVTS--TSPFYFKNLNIFQYQRLPACDSHMQNLRVLYNEAFNFIDAARFSNGRVLVHCWAGVSRSPSIVIAYLLKHSNNSVLEILKFVQGKRSIVAPNIHFLGQLEKY 347          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Planmine SMEST
Match: SMESG000078269.1 (SMESG000078269.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.083e-11
Identity = 55/198 (27.78%), Postives = 95/198 (47.98%), Query Frame = 2
Query:  431 NGVLILKGGYE----YFSRLYPFLRTQKILWMPRE-LDTYHPFPL---------------EVIPQSLYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVK---VSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEY 955
            + V  + GGYE    YFS+   F+ +     +P E +D YH  P                E++P  L+LGN   + D  V ++ KI   +N TT +        E+LF  K    +D    ++  Y+D+   FID+   +  +V V+   G+SR+  I+ AYL+   ++S+ ++  +L+S   ++ PN  F+ QL  +
Sbjct:  173 DSVYFVTGGYEEYIKYFSK--GFIESS----IPEEKIDQYHYSPTNESNRSTDVLNATISEILP-FLFLGNEMDSNDIEVLQEKKITHILNVTTNV----PFYREDLFVYKRLSATDCNRQDMRAYYDEAIQFIDEAYSKNGKVLVHCWAGVSRSATIVAAYLLKHTKLSVLQTIMFLQSKRPIVEPNFNFLGQLERF 359          
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Planmine SMEST
Match: SMESG000016231.1 (SMESG000016231.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.745e-11
Identity = 42/133 (31.58%), Postives = 66/133 (49.62%), Query Frame = 2
Query:  569 LYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNPESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEISLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKF 967
            L LG+ R A +    +Q KI   IN +T+         +N   + V DN    I  YF     F+D  R    R  V+   GISR+P + + YLM  + IS+  +++ +K   S + PN  F+ QL++YE++ 
Sbjct:  255 LLLGSQRDAMNLSCIQQHKITHVINVSTDGLVCPFIPIQNFLRIPVLDNFTDRITNYFPKAFDFLDNVRAVNGRALVHCSAGISRSPTLAIGYLMKAQNISVTDAYNIVKLSRSSVSPNFNFLGQLTDYEEEL 387          
The following BLAST results are available for this feature:
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STYXL14.127e-7841.72serine/threonine/tyrosine interacting like 1 [Sour... [more]
STYXL14.127e-7841.72serine/threonine/tyrosine interacting like 1 [Sour... [more]
STYXL14.127e-7841.72serine/threonine/tyrosine interacting like 1 [Sour... [more]
STYXL13.170e-6441.11serine/threonine/tyrosine interacting like 1 [Sour... [more]
STYXL11.070e-3938.10serine/threonine/tyrosine interacting like 1 [Sour... [more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lip-16.822e-1633.33Dual specificity protein phosphatase lip-1 [Sourc... [more]
lip-16.976e-1633.33Dual specificity protein phosphatase lip-1 [Sourc... [more]
vhp-12.223e-1425.53Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-12.223e-1425.53Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-12.535e-1425.53Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mkp32.385e-2030.67gene:FBgn0036844 transcript:FBtr0075036[more]
Mkp32.794e-1930.67gene:FBgn0036844 transcript:FBtr0333220[more]
Mkp32.794e-1930.67gene:FBgn0036844 transcript:FBtr0075035[more]
Mkp34.607e-1930.67gene:FBgn0036844 transcript:FBtr0330089[more]
puc3.059e-1532.33gene:FBgn0243512 transcript:FBtr0339722[more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
styxl15.950e-6837.84serine/threonine/tyrosine interacting-like 1 [Sour... [more]
dusp11.248e-2128.90dual specificity phosphatase 1 [Source:ZFIN;Acc:ZD... [more]
dusp41.663e-2126.96dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
dusp41.663e-2126.96dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
dusp41.663e-2126.96dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000032730.11.022e-8042.91serine/threonine/tyrosine interacting-like 1 [Sour... [more]
ibtk1.075e-2127.74inhibitor of Bruton tyrosine kinase [Source:Xenbas... [more]
pnpt14.011e-2027.87polyribonucleotide nucleotidyltransferase 1 [Sourc... [more]
pcsk11.257e-1926.25proprotein convertase subtilisin/kexin type 1 [Sou... [more]
pcsk11.660e-1926.25proprotein convertase subtilisin/kexin type 1 [Sou... [more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Styxl13.586e-7238.70serine/threonine/tyrosine interacting-like 1 [Sour... [more]
Styxl13.586e-7238.70serine/threonine/tyrosine interacting-like 1 [Sour... [more]
Styxl13.586e-7238.70serine/threonine/tyrosine interacting-like 1 [Sour... [more]
Styxl13.586e-7238.70serine/threonine/tyrosine interacting-like 1 [Sour... [more]
Styxl15.280e-4440.11serine/threonine/tyrosine interacting-like 1 [Sour... [more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y6J8|STYL1_HUMAN1.982e-7741.72Serine/threonine/tyrosine-interacting-like protein... [more]
sp|P28562|DUS1_HUMAN1.433e-2229.01Dual specificity protein phosphatase 1 OS=Homo sap... [more]
sp|Q13115|DUS4_HUMAN2.029e-2126.81Dual specificity protein phosphatase 4 OS=Homo sap... [more]
sp|P28563|DUS1_MOUSE2.070e-2128.81Dual specificity protein phosphatase 1 OS=Mus musc... [more]
sp|Q64623|DUS1_RAT3.429e-2127.65Dual specificity protein phosphatase 1 OS=Rattus n... [more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4B1173.962e-9249.32Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3HY401.064e-9047.75serine/threonine/tyrosine-interacting-like protein... [more]
A0A210QWI66.309e-8946.42Serine/threonine/tyrosine-interacting-like protein... [more]
R7TM043.213e-8846.96Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A452IS098.174e-8644.41Serine/threonine/tyrosine interacting like 1 OS=Go... [more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
styxl11.148e-6739.19serine/threonine/tyrosine interacting like 1 [Sour... [more]
dusp44.473e-2125.95dual specificity phosphatase 4 [Source:NCBI gene;A... [more]
dusp27.150e-2129.63dual specificity protein phosphatase 2 [Source:NCB... [more]
dusp28.245e-2129.63dual specificity protein phosphatase 2 [Source:NCB... [more]
dusp11.471e-2029.36dual specificity phosphatase 1 [Source:NCBI gene;A... [more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
styxl13.476e-6638.93serine/threonine/tyrosine interacting-like 1 [Sour... [more]
dusp44.843e-2328.86dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000004127.17.995e-1725.78pep scaffold:Pmarinus_7.0:GL482725:7128:13243:-1 g... [more]
dusp66.726e-1429.29dual specificity phosphatase 6 [Source:ZFIN;Acc:ZD... [more]
dusp22b8.931e-1428.97dual specificity phosphatase 22b [Source:NCBI gene... [more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SDP17.242e-825.36Stress-inducible dual-specificity MAP kinase phosp... [more]
MSG53.375e-631.82Dual-specificity protein phosphatase; exists in 2 ... [more]
YVH15.439e-626.61Dual specificity protein phosphatase; regulates gr... [more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO473927.385e-7741.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426722.423e-2827.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492504.174e-2129.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370001.319e-1730.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471561.644e-1631.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp11.259e-2232.68dual specificity phosphatase 1 [Source:NCBI gene;A... [more]
dusp43.455e-2128.52dual specificity phosphatase 4 [Source:NCBI gene;A... [more]
dusp163.645e-2027.14dual specificity phosphatase 16 [Source:NCBI gene;... [more]
dusp21.103e-1928.95dual specificity protein phosphatase 2 [Source:NCB... [more]
dusp143.168e-1733.58dual specificity phosphatase 14 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of serine/threonine/tyrosine-interacting-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070767.10.000e+098.98SMESG000070767.1[more]
SMESG000030100.16.066e-1829.55SMESG000030100.1[more]
SMESG000063504.15.512e-1323.70SMESG000063504.1[more]
SMESG000078269.11.083e-1127.78SMESG000078269.1[more]
SMESG000016231.11.745e-1131.58SMESG000016231.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007587 ID=SMED30007587|Name=serine/threonine/tyrosine-interacting-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1150bp
CTGGGATTAAATAAATTTACAATTTTGTTTAAGCTATTTTTAATACATTG
GCCTTAAGAATTCTTATTAATTAATTCTACTTGTTTTAATATTTTATTCT
CATAGAAACATAAAATAAATGAGCACTTTAAAATTAATTGAACCAACATA
TCTATATACTATTCTTAATCAATATTTATTTTACTCTAATTTAAGTAATC
CCAGATATCTTCTTCTATTAGATGCGCGAATAAAAGATGAGTATAATGAA
TGTCATATTATAATGGCGAAAAGAATGAAAAAAAATGATAAGAATGACTA
TATAGTTCCTTATGACAGTGAATTAGAATGCCAAGAAAAGATTGTTGTGT
ATGATGGAAATACAAATTCTTTGGATCCAAGCTCTGAAGCAGTTAAATGC
GCAAATGTTCTTTTAACTAACGGAGCTCGCAATGGAGTTCTGATTTTGAA
AGGTGGATATGAATATTTTTCTAGACTTTATCCTTTCTTGAGAACACAAA
AAATTCTTTGGATGCCTAGAGAATTAGACACATATCATCCTTTCCCATTG
GAAGTCATTCCACAGTCTCTTTATCTTGGCAACAGTCGACATGCCTGTGA
CAGATACGTTCAGAAACAATTGAAAATAAAATGTCATATCAATTGTACAA
CAGAGATAAATGAAATATTTGAAAGTACAAACGAAAATTTATTTGATGTA
AAAGTGTCAGATAATCCAGAAAGCAACATAGGAATCTATTTTGACGATGT
GTGCTCATTTATAGATAAGAATCGAAAGGAAGGTAAACGGGTTTTTGTTT
ATTCACATTTGGGTATTAGTCGAGCTCCAGTAATTATTATGGCATATTTA
ATGCATTTGGAAGAAATTAGTTTGGCGAAATCATGGAGTTACCTGAAAAG
TATCAGTAGCGTTATGAGACCGAATCGAGGTTTTGTGTCGCAGTTGAGTG
AATATGAGAAGAAATTCGTAGCCGAACCGACGTATACGGAAGATCCATTT
TATTAATTCACATGATGTGATCGAATTTTAAGTGAATTAAAAAATAAGAT
TACAAAATCTTTACTATGAAACATTTCATTATTATTTATTATCACTATTT
TTCATTTGATATAAATTATCGTAAATTATTTAATAACGAGCTGTAACCCG
back to top

protein sequence of SMED30007587-orf-1

>SMED30007587-orf-1 ID=SMED30007587-orf-1|Name=SMED30007587-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=296bp
MSTLKLIEPTYLYTILNQYLFYSNLSNPRYLLLLDARIKDEYNECHIIMA
KRMKKNDKNDYIVPYDSELECQEKIVVYDGNTNSLDPSSEAVKCANVLLT
NGARNGVLILKGGYEYFSRLYPFLRTQKILWMPRELDTYHPFPLEVIPQS
LYLGNSRHACDRYVQKQLKIKCHINCTTEINEIFESTNENLFDVKVSDNP
ESNIGIYFDDVCSFIDKNRKEGKRVFVYSHLGISRAPVIIMAYLMHLEEI
SLAKSWSYLKSISSVMRPNRGFVSQLSEYEKKFVAEPTYTEDPFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016311dephosphorylation
GO:0006470protein dephosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000208testis
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036873Rhodanese-like_dom_sf
IPR001763Rhodanese-like_dom
IPR020422TYR_PHOSPHATASE_DUAL_dom
IPR000340Dual-sp_phosphatase_cat-dom
IPR029021Prot-tyrosine_phosphatase-like
Vocabulary: molecular function
TermDefinition
GO:0008138protein tyrosine/serine/threonine phosphatase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020422Dual specificity protein phosphatase domainSMARTSM00195dsp_5coord: 142..282
e-value: 3.3E-23
score: 93.1
IPR020422Dual specificity protein phosphatase domainPROSITEPS50054TYR_PHOSPHATASE_DUALcoord: 147..284
score: 30.282
IPR001763Rhodanese-like domainSMARTSM00450rhod_4coord: 17..123
e-value: 0.0033
score: 26.7
IPR001763Rhodanese-like domainPFAMPF00581Rhodanesecoord: 22..118
e-value: 5.4E-7
score: 30.1
IPR001763Rhodanese-like domainPROSITEPS50206RHODANESE_3coord: 27..125
score: 8.611
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 151..281
e-value: 1.5E-29
score: 102.5
IPR036873Rhodanese-like domain superfamilyGENE3DG3DSA:3.40.250.10coord: 12..129
e-value: 2.1E-9
score: 39.6
IPR036873Rhodanese-like domain superfamilySUPERFAMILYSSF52821Rhodanese/Cell cycle control phosphatasecoord: 5..134
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 139..290
e-value: 2.4E-36
score: 126.6
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 125..286
NoneNo IPR availablePANTHERPTHR46659FAMILY NOT NAMEDcoord: 1..287
NoneNo IPR availableCDDcd14517DSP_STYXL1coord: 133..282
e-value: 4.02737E-62
score: 191.721