cilia- and flagella-associated protein 69

Overview
Namecilia- and flagella-associated protein 69
Smed IDSMED30007581
Length (bp)3077
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 69 (SMED30007581) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 69 (SMED30007581) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 69 (SMED30007581) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 69 (SMED30007581) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007581

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007581SMESG000047535.1 SmedASXL_014496SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30007581SMESG000047535.1 dd_Smed_v4_7432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007581SMESG000047535.1 dd_Smed_v4_7432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007581SMESG000047535.1 dd_Smed_v4_7432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007581SMESG000047535.1 dd_Smed_v4_7432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30007581SMESG000047535.1 dd_Smed_v4_7432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007581SMESG000047535.1 dd_Smed_v6_7432_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007581SMESG000047535.1 dd_Smed_v4_7432_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30007581SMESG000047535.1 dd_Smed_v4_7432_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Human
Match: CFAP69 (cilia and flagella associated protein 69 [Source:HGNC Symbol;Acc:HGNC:26107])

HSP 1 Score: 494.967 bits (1273), Expect = 8.326e-159
Identity = 326/957 (34.06%), Postives = 548/957 (57.26%), Query Frame = 3
Query:  120 NSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG----TQGAMEKFGI 2975
            +S+   IPVV   +  ED   ++ + K +DL ++I+LL       L E+ L  +KKL +  +NG  ++D   + K+LN+C+ +    P+F +E   +I+++C  PFLK+K SD + Y +   + ++ +G   ++ + ++R+Q+CK + D Y  +  K  +     +  +Y   + E   +++ ++QS +++EN L  KL +  +L+ L+     C   + +  +   C T + + D S  LLFRS  I+WNL+E   + ++ +Q + LE +  L++ F +   +G+S YDRQLRNDILV+ T++A+ NP AP +E GF K + L ATF E+KS N LVK LK++ ++EDFELKKLL N++V+L  +   + ++ DG+++LALF                  T   K  +     W  A  EELQLHA+++L+ + P ++ ++    G  R+L  +EWC ++D  FS +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN++  ++G I  +I I  N++ K N+   +I LEIQ D+L IL+ LCE    RKE+FG +GV + +  +K           T+P   +       G+  L+ +  D+IW CI+GCY +E  FL++ G F++LD+L +   +    ILG +V+  +N K   H++ W+G   KD                 A LL ++WR+EE  + V+R +   ++D   PL  S Q+ E     L AN  S ++++++E++RA +Y++  +L + + PGL  +D +TL II  YL+FK+GE+W EI +E++ E +RP++ D +ALE I+   E  G  V+ +Q ++I++   QD   E + Y +++  H+Q+E   + +++F+ RTSN + LK AK  Q   I+ASR   + Q+   +FH+T I  +N T      + + STP +++GG    T  A++K  I
Sbjct:   21 SSSSSQIPVV--GVVTEDDEAQD-VFKPMDLNRVIKLLEETDKDGLEEKQLKFVKKLVQCYQNGLPLRDLAQIFKILNLCSGKIKNQPRF-IESAYDIIKLCGLPFLKKKVSDEITYAEDTANSIALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQQASSSYKIQMAEVGGLAKTMVQSMTLLENQLVEKLWVLKVLQHLSTSEVNCTIMMKAQAASGIC-THLNDPDPSGQLLFRSSEILWNLLEKSSKEEVIQQLSNLECLLALKEVFKNLFMRGFSHYDRQLRNDILVITTIIAQ-NPEAPMIECGFTKDLILFATFNEVKSQNLLVKGLKLSNSYEDFELKKLLFNVIVILCKDLPTVQLLIDGKVILALF------------------TYVKKPEKQKIIDWSAAQHEELQLHAIATLSSVAPLLIEEYMSCQGNARVLAFLEWCESEDPFFS-HGNSFHGTGGRGNKFAQMRYSLRLLRAVVYLEDETVNKDLCEKGTIQQMIGIFKNIISKPNEKEEAIVLEIQSDILLILSGLCENHIQRKEIFGTEGVDIVLHVMK-----------TDPRKLQ----SGLGYNVLLFSTLDSIWCCILGCYPSEDYFLEKEGIFLLLDLLALNQKKFCNLILGIMVEFCDNPKTAAHVNAWQGK--KDQ--------------TAASLLIKLWRKEEKELGVKRDKNGKIIDTKKPLFTSFQE-EQKIIPLPANCPSIAVMDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQACQDMQNEQKVYAKIQATHKQRELANKSWEDFLARTSNAKTLKKAKSLQEKAIEASRYHKRPQN--AIFHQTHIKGLNTTVPSGGVVTVESTPARLVGGPLVDTDIALKKLPI 918          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Human
Match: CFAP69 (cilia and flagella associated protein 69 [Source:HGNC Symbol;Acc:HGNC:26107])

HSP 1 Score: 478.789 bits (1231), Expect = 6.127e-153
Identity = 320/943 (33.93%), Postives = 537/943 (56.95%), Query Frame = 3
Query:  120 NSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG 2945
            +S+   IPVV   +  ED   ++ + K +DL ++I+LL       L E+ L  +KKL +  +NG  ++D   + K+LN+C+ +    P+F +E   +I+++C  PFLK+K SD + Y +   + ++ +G   ++ + ++R+Q+C      Y + S             +Y   + E   +++ ++QS +++EN L  KL +  +L+ L+     C   + +  +   C T + + D S  LLFRS  I+WNL+E   + ++ +Q + LE +  L++ F +   +G+S YDRQLRNDILV+ T++A+ NP AP +E GF K + L ATF E+KS N LVK LK++ ++EDFELKKLL N++V+L  +   + ++ DG+++LALF                  T   K  +     W  A  EELQLHA+++L+ + P ++ ++    G  R+L  +EWC ++D  FS +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN++  ++G I  +I I  N++ K N+   +I LEIQ D+L IL+ LCE    RKE+FG +GV + +  +K           T+P   +       G+  L+ +  D+IW CI+GCY +E  FL++ G F++LD+L +   +    ILG +V+  +N K   H++ W+G   KD                 A LL ++WR+EE  + V+R +   ++D   PL  S Q+ E     L AN  S ++++++E++RA +Y++  +L + + PGL  +D +TL II  YL+FK+GE+W EI +E++ E +RP++ D +ALE I+   E  G  V+ +Q ++I++   QD   E + Y +++  H+Q+E   + +++F+ RTSN + LK AK  Q   I+ASR   + Q+   +FH+T I  +N T      + + STP +++GG
Sbjct:   21 SSSSSQIPVV--GVVTEDDEAQD-VFKPMDLNRVIKLLEETDKDGLEEKQLKFVKKLVQCYQNGLPLRDLAQIFKILNLCSGKIKNQPRF-IESAYDIIKLCGLPFLKKKVSDEITYAEDTANSIALLGDLMKIPSSELRIQIC------YQQASS------------SYKIQMAEVGGLAKTMVQSMTLLENQLVEKLWVLKVLQHLSTSEVNCTIMMKAQAASGIC-THLNDPDPSGQLLFRSSEILWNLLEKSSKEEVIQQLSNLECLLALKEVFKNLFMRGFSHYDRQLRNDILVITTIIAQ-NPEAPMIECGFTKDLILFATFNEVKSQNLLVKGLKLSNSYEDFELKKLLFNVIVILCKDLPTVQLLIDGKVILALF------------------TYVKKPEKQKIIDWSAAQHEELQLHAIATLSSVAPLLIEEYMSCQGNARVLAFLEWCESEDPFFS-HGNSFHGTGGRGNKFAQMRYSLRLLRAVVYLEDETVNKDLCEKGTIQQMIGIFKNIISKPNEKEEAIVLEIQSDILLILSGLCENHIQRKEIFGTEGVDIVLHVMK-----------TDPRKLQ----SGLGYNVLLFSTLDSIWCCILGCYPSEDYFLEKEGIFLLLDLLALNQKKFCNLILGIMVEFCDNPKTAAHVNAWQGK--KDQ--------------TAASLLIKLWRKEEKELGVKRDKNGKIIDTKKPLFTSFQE-EQKIIPLPANCPSIAVMDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQACQDMQNEQKVYAKIQATHKQRELANKSWEDFLARTSNAKTLKKAKSLQEKAIEASRYHKRPQN--AIFHQTHIKGLNTTVPSGGVVTVESTPARLVGG 886          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Human
Match: CFAP69 (cilia and flagella associated protein 69 [Source:HGNC Symbol;Acc:HGNC:26107])

HSP 1 Score: 168.703 bits (426), Expect = 4.824e-44
Identity = 95/250 (38.00%), Postives = 151/250 (60.40%), Query Frame = 3
Query: 1383 ELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRG 2129
            ELQLHA+++L+ + P ++ ++    G  R+L  +EWC ++D  FS +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN++  ++G I  +I I  N++ K N+   +I LEIQ D+L IL+ LCE    RKE+FG +GV + +  +K           T+P   +       G+  L+ +  D+IW CI+GCY +E  FL++ G F++LD+L +   +    ILG +V+  +N K   H++ W+G
Sbjct:    1 ELQLHAIATLSSVAPLLIEEYMSCQGNARVLAFLEWCESEDPFFS-HGNSFHGTGGRGNKFAQMRYSLRLLRAVVYLEDETVNKDLCEKGTIQQMIGIFKNIISKPNEKEEAIVLEIQSDILLILSGLCENHIQRKEIFGTEGVDIVLHVMK-----------TDPRKLQ----SGLGYNVLLFSTLDSIWCCILGCYPSEDYFLEKEGIFLLLDLLALNQKKFCNLILGIMVEFCDNPKTAAHVNAWQG 234          

HSP 2 Score: 126.716 bits (317), Expect = 4.911e-30
Identity = 64/172 (37.21%), Postives = 106/172 (61.63%), Query Frame = 3
Query: 2430 PGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG 2945
            PGL  +D +TL II  YL+FK+GE+W EI +E++ E +RP++ D +ALE I+   E  G  V+ +Q ++I++   QD   E + Y +++  H+Q+E   + +++F+ RTSN + LK AK  Q   I+ASR   + Q+   +FH+T I  +N T      + + STP +++GG
Sbjct:  272 PGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQACQDMQNEQKVYAKIQATHKQRELANKSWEDFLARTSNAKTLKKAKSLQEKAIEASRYHKRPQN--AIFHQTHIKGLNTTVPSGGVVTVESTPARLVGG 441          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Human
Match: CFAP69 (cilia and flagella associated protein 69 [Source:HGNC Symbol;Acc:HGNC:26107])

HSP 1 Score: 167.933 bits (424), Expect = 1.702e-43
Identity = 89/224 (39.73%), Postives = 137/224 (61.16%), Query Frame = 3
Query: 1362 WKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDML 2030
            W  A  EELQLHA+++L+ + P ++ ++    G  R+L  +EWC ++D  FS +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN++  ++G I  +I I  N++ K N+   +I LEIQ D+L IL+ LCE    RKE+FG +GV + +  +K           T+P   +       G+  L+ +  D+IW CI+GCY +E  FL++ G F++LD+L
Sbjct:  294 WSAAQHEELQLHAIATLSSVAPLLIEEYMSCQGNARVLAFLEWCESEDPFFS-HGNSFHGTGGRGNKFAQMRYSLRLLRAVVYLEDETVNKDLCEKGTIQQMIGIFKNIISKPNEKEEAIVLEIQSDILLILSGLCENHIQRKEIFGTEGVDIVLHVMK-----------TDPRKLQ----SGLGYNVLLFSTLDSIWCCILGCYPSEDYFLEKEGIFLLLDLL 501          

HSP 2 Score: 142.51 bits (358), Expect = 5.344e-35
Identity = 88/287 (30.66%), Postives = 163/287 (56.79%), Query Frame = 3
Query:  255 LYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIK 1115
            L E+ L  +KKL +  +NG  ++D   + K+LN+C+ +    P+F +E   +I+++C  PFLK+K SD + Y +   + ++ +G   ++ + ++R+Q+CK + D Y  +  K  +     +  +Y   + E   +++ ++QS +++EN L  KL +  +L+ L+     C   + +  +   C T + + D S  LLFRS  I+WNL+E   + ++ +Q + LE +  L++ F +   +G+S YDRQLRNDILV+ T++A+ NP AP +    +    +LA F  +K
Sbjct:    3 LEEKQLKFVKKLVQCYQNGLPLRDLAQIFKILNLCSGKIKNQPRF-IESAYDIIKLCGLPFLKKKVSDEITYAEDTANSIALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQQASSSYKIQMAEVGGLAKTMVQSMTLLENQLVEKLWVLKVLQHLSTSEVNCTIMMKAQAASGIC-THLNDPDPSGQLLFRSSEILWNLLEKSSKEEVIQQLSNLECLLALKEVFKNLFMRGFSHYDRQLRNDILVITTIIAQ-NPEAPMIL--LIDGKVILALFTYVK 284          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Human
Match: CFAP69 (cilia and flagella associated protein 69 [Source:HGNC Symbol;Acc:HGNC:26107])

HSP 1 Score: 93.9745 bits (232), Expect = 7.383e-21
Identity = 53/193 (27.46%), Postives = 108/193 (55.96%), Query Frame = 3
Query:  120 NSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIEN 698
            +S+   IPVV   +  ED   ++ + K +DL ++I+LL       L E+ L  +KKL +  +NG  ++D   + K+LN+C+ +    P+F +E   +I+++C  PFLK+K SD + Y +   + ++ +G   ++ + ++R+Q+CK + D Y  +  K  +     +  +Y   + E   +++ ++QS +++EN
Sbjct:   21 SSSSSQIPVV--GVVTEDDEAQD-VFKPMDLNRVIKLLEETDKDGLEEKQLKFVKKLVQCYQNGLPLRDLAQIFKILNLCSGKIKNQPRF-IESAYDIIKLCGLPFLKKKVSDEITYAEDTANSIALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQQASSSYKIQMAEVGGLAKTMVQSMTLLEN 209          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Xenopus
Match: CFAP69 (cilia and flagella associated protein 69 [Source:NCBI gene;Acc:100494509])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 353/915 (38.58%), Postives = 545/915 (59.56%), Query Frame = 3
Query:  204 VDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVLKSNDSNSSIDL-EIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG 2945
            +DL ++I+L   P S  L ER +  ++K+ KH  NG  +KD   + ++LN+CA+R     K +++P+ EI+++C  PFLKEK+SD L Y ++  + +SQ+G   R+ +  VR+Q+C++L + Y    V        P+ +NY   + E   ++E LI S +++EN L  KL+L  +L+LL+   + C     +  +   CY  + + D S  LLFRS  I+WNL+ENG + ++  Q +  E I  L+DSF+  L+ GY  YDRQLRND+LV+ATL+A+ N   P +E+GF KQ+ L ATF E+KSH+PLVK+LK+  NHEDFE+KKLL N++V+LS + S + +  DG+++LALF          N++  N   K  K +      W  A  E+LQLHA+++L+ + P +L  +    G  R+L+ +EWC + D +F G GN FH  GGRGNK AQMR+C+RL+  +V + DE VNQ+  D+G IN  + IL  ++  +  N    L EIQ D+LFIL+ LCE D HRK+LFG +GV V +  L+        N     +          G  KLI    D +W C+IGC+++E  FL++ G F+ILD+L +    +   +LG LV+  +N K + H++TWRG   K N+                 LL  +W +EE  + V++ EY  ++D   PL G  Q+ +     L AN  S +++E++E+ RA +YS+FS+LG+ + PGL + D++TL++I  YL+FK+GE+W EI+ EL+ E+I+P++ D EAL+ I +  E     V+  Q E+I+  +  +  EE + Y +++ NH+Q E  ++ +  F+ RTSNYE LK AK  Q  +I++SR   K  + S  FH T I N+N T  C + + + STP Q+ GG
Sbjct:    1 MDLNRVIKLFEDPFSRELTERQVRVLRKVAKHYCNGIPLKDLSQIIQILNLCAERIED-HKDFVDPMCEIVKLCGLPFLKEKTSDELNYAQVVAESISQLGCMMRVPSSQVRIQLCRALINFYNPDPVIQQ-----PTAVNYKVQMAEAGGLAETLILSMTLVENQLREKLSLLKVLQLLSSSPENCKLMAKAQGANSICYR-LSDPDPSGQLLFRSSEILWNLLENGPKEEIINQLSNTECIYALKDSFVRLLTNGYKHYDRQLRNDLLVIATLIAE-NSVPPLIESGFAKQLILFATFSEVKSHSPLVKSLKLLHNHEDFEMKKLLFNMIVVLSRDISAVQLFSDGKVMLALF----------NYVKANE--KPGKHD------WPAARFEDLQLHAIATLSTVAPLLLEDYMTCQGNTRILLFLEWCASQDTYF-GQGNCFHGTGGRGNKHAQMRYCLRLLRSVVSIGDETVNQDLCDQGAINQFLGILGKIVNGSAENEDATLLEIQTDILFILSTLCENDLHRKDLFGSEGVDVLLQLLR-------MNHSKYYSGL--------GHNKLIFCTLDCVWCCVIGCFSSEDYFLEKEGMFIILDLLALNMKSMNNLVLGILVEFCDNPKTIAHITTWRG---KKNE-------------TAPKLLLDMWIQEEAELGVKQDEYRRIIDAQKPLAGQLQE-DQGVTPLPANCFSFAVMEVSENTRAKIYSVFSKLGFENLPGLSVLDYVTLSVISRYLDFKVGEIWHEIRDELKEENIQPVTSDQEALDIIIKSGENTCKMVACHQTEIIENYQQMEIQEEQQKYAEIQANHKQSELVMKSWDNFVARTSNYEALKKAKQLQEKSIESSRPKAKLNNSS--FHSTQISNLNTTVPCGQLVAVESTPSQLTGG 854          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Xenopus
Match: CFAP69 (cilia and flagella associated protein 69 [Source:NCBI gene;Acc:100494509])

HSP 1 Score: 511.531 bits (1316), Expect = 4.828e-166
Identity = 336/915 (36.72%), Postives = 525/915 (57.38%), Query Frame = 3
Query:  204 VDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVLKSNDSNSSIDL-EIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG 2945
            +DL ++I+L   P S  L ER +  ++K+ KH  NG  +KD   + ++LN+CA+R     K +++P+ EI+++C  PFLKEK+SD L Y ++  + +SQ+G         V L +   ++    K          +P+ +NY   + E   ++E LI S +++EN L  KL+L  +L+LL+   + C     +  +   CY  + + D S  LLFRS  I+WNL+ENG + ++  Q +  E I  L+DSF+  L+ GY  YDRQLRND+LV+ATL+A+           +   + +      +KSH+PLVK+LK+  NHEDFE+KKLL N++V+LS + S + +  DG+++LALF          N++  N   K  K +      W  A  E+LQLHA+++L+ + P +L  +    G  R+L+ +EWC + D +F G GN FH  GGRGNK AQMR+C+RL+  +V + DE VNQ+  D+G IN  + IL  ++  +  N    L EIQ D+LFIL+ LCE D HRK+LFG +GV V +  L+        N     +          G  KLI    D +W C+IGC+++E  FL++ G F+ILD+L +    +   +LG LV+  +N K + H++TWRG   K N+                 LL  +W +EE  + V++ EY  ++D   PL G  Q+ +     L AN  S +++E++E+ RA +YS+FS+LG+ + PGL + D++TL++I  YL+FK+GE+W EI+ EL+ E+I+P++ D EAL+ I +  E     V+  Q E+I+  +  +  EE + Y +++ NH+Q E  ++ +  F+ RTSNYE LK AK  Q  +I++SR   K  + S  FH T I N+N T  C + + + STP Q+ GG
Sbjct:    1 MDLNRVIKLFEDPFSRELTERQVRVLRKVAKHYCNGIPLKDLSQIIQILNLCAERIED-HKDFVDPMCEIVKLCGLPFLKEKTSDELNYAQVVAESISQLG--------KVSLIILFQVFHFNPK-------GYWIPTAVNYKVQMAEAGGLAETLILSMTLVENQLREKLSLLKVLQLLSSSPENCKLMAKAQGANSICYR-LSDPDPSGQLLFRSSEILWNLLENGPKEEIINQLSNTECIYALKDSFVRLLTNGYKHYDRQLRNDLLVIATLIAEN--------MTYFCYVVIFLLLCLVKSHSPLVKSLKLLHNHEDFEMKKLLFNMIVVLSRDISAVQLFSDGKVMLALF----------NYVKANE--KPGKHD------WPAARFEDLQLHAIATLSTVAPLLLEDYMTCQGNTRILLFLEWCASQDTYF-GQGNCFHGTGGRGNKHAQMRYCLRLLRSVVSIGDETVNQDLCDQGAINQFLGILGKIVNGSAENEDATLLEIQTDILFILSTLCENDLHRKDLFGSEGVDVLLQLLR-------MNHSKYYSGL--------GHNKLIFCTLDCVWCCVIGCFSSEDYFLEKEGMFIILDLLALNMKSMNNLVLGILVEFCDNPKTIAHITTWRG---KKNE-------------TAPKLLLDMWIQEEAELGVKQDEYRRIIDAQKPLAGQLQE-DQGVTPLPANCFSFAVMEVSENTRAKIYSVFSKLGFENLPGLSVLDYVTLSVISRYLDFKVGEIWHEIRDELKEENIQPVTSDQEALDIIIKSGENTCKMVACHQTEIIENYQQMEIQEEQQKYAEIQANHKQSELVMKSWDNFVARTSNYEALKKAKQLQEKSIESSRPKAKLNNSS--FHSTQISNLNTTVPCGQLVAVESTPSQLTGG 837          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Mouse
Match: Cfap69 (cilia and flagella associated protein 69 [Source:MGI Symbol;Acc:MGI:2443778])

HSP 1 Score: 476.863 bits (1226), Expect = 3.840e-152
Identity = 320/953 (33.58%), Postives = 537/953 (56.35%), Query Frame = 3
Query:  132 KTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG----TQGAMEKFGI 2975
            +TIPV   ++        + I K +DL +II++L         E+ L  +KKL    +NGF ++D   + K+L++CA++    P F +EP  +I+++C  PFLK+K SD + Y +   +  + +G   ++ +  +R+Q+CK + D Y  + +K  +        +Y   +VE   +++ ++QS  ++EN L  KL +  +L+ L+     C   + +  +   C   + + D S  LLFRS  ++WNL+E   + ++ +Q + LE +  L++ F +   +G+S Y+RQLRNDILV+ T++A+ NP AP +E GF + + L ATF E+KS NPLVK+LK+   +EDFELKKLL NI+V+L  + + + ++ DG+++LALF                  T   K  ++    W  A  EELQLHA+++L+ + P ++ ++    G +R+L  +EWC ++D +F  +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN++  + G I+ LI+I   ++ +  +   +I LEIQ D L IL+ LCE    RKE+FG +GV + +  +K           T+P     N     G+  L+ +  D+IW CI+GCY +E  FL++ G F++LD+L +   +    ILG +V+  +N K   H++ WRG      K+ L +          A LL ++WR+EE  + V+R     ++D   PL  S Q+ E     L AN  S +++++ E++RA +Y++  +L + + PGL  +D +TL II  Y +FK+GE+W E+ +E++ E +R ++ D ++L  I    E  G  V+ +Q E+I+    QD   E   Y +++  H+Q+E+  + ++ F+ RTSN + LK AK  Q   I++SR T + Q+ +  FH+T I  +N T      + + STP ++LGG    T  A++K  I
Sbjct:   26 RTIPVFGVAI---PDGEMQGIFKPMDLNRIIKVLEEEDKDVSEEKQLNYIKKLIHCYQNGFPLRDLAQIFKILSLCAEKIEKQPCF-VEPASDIIKLCGLPFLKKKVSDEITYTEDTANSFALLGELMKIPSSALRIQICKCIVDFYHAEPLKKHIPGYQQVSSSYKIKMVEVGGLAKAMVQSALLLENQLVEKLWVLKVLQHLSTSGVNCTLMVKAQAASGICAH-LNDPDPSGQLLFRSSEVLWNLLEKSSKEEIIQQLSNLECLLALKEVFKNLFVRGHSHYERQLRNDILVITTIIAQ-NPGAPMIECGFTRDLILFATFNEVKSQNPLVKSLKLFNCYEDFELKKLLFNIIVILCKDLATVQLLIDGKVILALF------------------TYVKKPERLKIMEWSAAQYEELQLHAIATLSSVAPLLIEEYMSCHGNSRILAFLEWCGHEDSYFI-HGNSFHGTGGRGNKFAQMRYTLRLLRAMVYLEDETVNKDLCERGVIHQLIEIFKTMMSRPAEKEEAIALEIQSDTLLILSGLCENYIQRKEMFGTEGVDIVLHVMK-----------TDPK----NLQRGLGYNVLLFSTLDSIWCCILGCYDSEDYFLEKEGIFLLLDILALNQKKFCNLILGIMVEFCDNPKTSAHVNAWRG------KKDLTA----------ASLLIKLWRKEEKELGVKRDRNGKIVDTKRPLFTSFQE-EQKTMPLPANCPSIAVMDVAENIRAKIYAVLDKLDFENLPGLSAEDFVTLCIIHRYFDFKIGEIWNEVSEEIKLEKLRLVTTDEKSLNSIIAATENIGKMVASLQSEMIENQALQDVQNEQRVYAKIQATHKQREQANKSWENFLARTSNAKTLKKAKKLQEKAIESSRYTERPQNAT--FHQTVIKGLNTTVPSGRVVTVQSTPTRLLGGPLADTDIALKKLPI 919          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Mouse
Match: Cfap69 (cilia and flagella associated protein 69 [Source:MGI Symbol;Acc:MGI:2443778])

HSP 1 Score: 345.51 bits (885), Expect = 4.130e-106
Identity = 219/636 (34.43%), Postives = 365/636 (57.39%), Query Frame = 3
Query:  132 KTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEI 2036
            +TIPV   ++        + I K +DL +II++L         E+ L  +KKL    +NGF ++D   + K+L++CA++    P F +EP  +I+++C  PFLK+K SD + Y +   +  + +G   ++ +  +R+Q+CK + D Y  + +K  +        +Y   +VE   +++ ++QS  ++EN L  KL +  +L+ L+     C   + +  +   C   + + D S  LLFRS  ++WNL+E   + ++ +Q + LE +  L++ F +   +G+S Y+RQLRNDILV+ T++A+ NP AP +E GF + + L ATF E+KS NPLVK+LK+   +EDFELKKLL NI+V+L  + + + ++ DG+++LALF                  T   K  ++    W  A  EELQLHA+++L+ + P ++ ++    G +R+L  +EWC ++D +F  +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN++  + G I+ LI+I   ++ +  +   +I LEIQ D L IL+ LCE    RKE+FG +GV + +  +K           T+P     N     G+  L+ +  D+IW CI+GCY +E  FL++ G F++LD+L +
Sbjct:   26 RTIPVFGVAI---PDGEMQGIFKPMDLNRIIKVLEEEDKDVSEEKQLNYIKKLIHCYQNGFPLRDLAQIFKILSLCAEKIEKQPCF-VEPASDIIKLCGLPFLKKKVSDEITYTEDTANSFALLGELMKIPSSALRIQICKCIVDFYHAEPLKKHIPGYQQVSSSYKIKMVEVGGLAKAMVQSALLLENQLVEKLWVLKVLQHLSTSGVNCTLMVKAQAASGIC-AHLNDPDPSGQLLFRSSEVLWNLLEKSSKEEIIQQLSNLECLLALKEVFKNLFVRGHSHYERQLRNDILVITTIIAQ-NPGAPMIECGFTRDLILFATFNEVKSQNPLVKSLKLFNCYEDFELKKLLFNIIVILCKDLATVQLLIDGKVILALF------------------TYVKKPERLKIMEWSAAQYEELQLHAIATLSSVAPLLIEEYMSCHGNSRILAFLEWCGHEDSYFI-HGNSFHGTGGRGNKFAQMRYTLRLLRAMVYLEDETVNKDLCERGVIHQLIEIFKTMMSRPAEKEEAIALEIQSDTLLILSGLCENYIQRKEMFGTEGVDIVLHVMK-----------TDPK----NLQRGLGYNVLLFSTLDSIWCCILGCYDSEDYFLEKEGIFLLLDILAV 621          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Mouse
Match: Cfap69 (cilia and flagella associated protein 69 [Source:MGI Symbol;Acc:MGI:2443778])

HSP 1 Score: 278.485 bits (711), Expect = 5.303e-80
Identity = 174/507 (34.32%), Postives = 294/507 (57.99%), Query Frame = 3
Query:  132 KTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEG 1652
            +TIPV   ++        + I K +DL +II++L         E+ L  +KKL    +NGF ++D   + K+L++CA++    P F +EP  +I+++C  PFLK+K SD + Y +   +  + +G   ++ +  +R+Q+CK + D Y  + +K  +        +Y   +VE   +++ ++QS  ++EN L  KL +  +L+ L+     C   + +  +   C   + + D S  LLFRS  ++WNL+E   + ++ +Q + LE +  L++ F +   +G+S Y+RQLRNDILV+ T++A+ NP AP +E GF + + L ATF E+KS NPLVK+LK+   +EDFELKKLL NI+V+L  + + + ++ DG+++LALF                  T   K  ++    W  A  EELQLHA+++L+ + P ++ ++    G +R+L  +EWC ++D +F  +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN++  + G
Sbjct:   26 RTIPVFGVAI---PDGEMQGIFKPMDLNRIIKVLEEEDKDVSEEKQLNYIKKLIHCYQNGFPLRDLAQIFKILSLCAEKIEKQPCF-VEPASDIIKLCGLPFLKKKVSDEITYTEDTANSFALLGELMKIPSSALRIQICKCIVDFYHAEPLKKHIPGYQQVSSSYKIKMVEVGGLAKAMVQSALLLENQLVEKLWVLKVLQHLSTSGVNCTLMVKAQAASGICAH-LNDPDPSGQLLFRSSEVLWNLLEKSSKEEIIQQLSNLECLLALKEVFKNLFVRGHSHYERQLRNDILVITTIIAQ-NPGAPMIECGFTRDLILFATFNEVKSQNPLVKSLKLFNCYEDFELKKLLFNIIVILCKDLATVQLLIDGKVILALF------------------TYVKKPERLKIMEWSAAQYEELQLHAIATLSSVAPLLIEEYMSCHGNSRILAFLEWCGHEDSYFI-HGNSFHGTGGRGNKFAQMRYTLRLLRAMVYLEDETVNKDLCERG 507          

HSP 2 Score: 134.42 bits (337), Expect = 1.075e-31
Identity = 81/240 (33.75%), Postives = 138/240 (57.50%), Query Frame = 3
Query: 2268 LLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG----TQGAMEKFGI 2975
            L+D   PL  S Q+ E     L AN  S +++++ E++RA +Y++  +L + + PGL  +D +TL II  Y +FK+GE+W E+ +E++ E +R ++ D ++L  I    E  G  V+ +Q E+I+    QD   E   Y +++  H+Q+E+  + ++ F+ RTSN + LK AK  Q   I++SR T + Q+ +  FH+T I  +N T      + + STP ++LGG    T  A++K  I
Sbjct:  512 LIDTKRPLFTSFQE-EQKTMPLPANCPSIAVMDVAENIRAKIYAVLDKLDFENLPGLSAEDFVTLCIIHRYFDFKIGEIWNEVSEEIKLEKLRLVTTDEKSLNSIIAATENIGKMVASLQSEMIENQALQDVQNEQRVYAKIQATHKQREQANKSWENFLARTSNAKTLKKAKKLQEKAIESSRYTERPQNAT--FHQTVIKGLNTTVPSGRVVTVQSTPTRLLGGPLADTDIALKKLPI 748          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Mouse
Match: Cfap69 (cilia and flagella associated protein 69 [Source:MGI Symbol;Acc:MGI:2443778])

HSP 1 Score: 174.866 bits (442), Expect = 2.666e-46
Identity = 94/250 (37.60%), Postives = 150/250 (60.00%), Query Frame = 3
Query: 1383 ELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRG 2129
            ELQLHA+++L+ + P ++ ++    G +R+L  +EWC ++D +F  +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN++  + G I+ LI+I   ++ +  +   +I LEIQ D L IL+ LCE    RKE+FG +GV + +  +K           T+P     N     G+  L+ +  D+IW CI+GCY +E  FL++ G F++LD+L +   +    ILG +V+  +N K   H++ WRG
Sbjct:    1 ELQLHAIATLSSVAPLLIEEYMSCHGNSRILAFLEWCGHEDSYFI-HGNSFHGTGGRGNKFAQMRYTLRLLRAMVYLEDETVNKDLCERGVIHQLIEIFKTMMSRPAEKEEAIALEIQSDTLLILSGLCENYIQRKEMFGTEGVDIVLHVMK-----------TDPK----NLQRGLGYNVLLFSTLDSIWCCILGCYDSEDYFLEKEGIFLLLDILALNQKKFCNLILGIMVEFCDNPKTSAHVNAWRG 234          

HSP 2 Score: 110.538 bits (275), Expect = 8.796e-25
Identity = 61/172 (35.47%), Postives = 101/172 (58.72%), Query Frame = 3
Query: 2430 PGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG 2945
            PGL  +D +TL II  Y +FK+GE+W E+ +E++ E +R ++ D ++L  I    E  G  V+ +Q E+I+    QD   E   Y +++  H+Q+E+  + ++ F+ RTSN + LK AK  Q   I++SR T + Q+ +  FH+T I  +N T      + + STP ++LGG
Sbjct:  272 PGLSAEDFVTLCIIHRYFDFKIGEIWNEVSEEIKLEKLRLVTTDEKSLNSIIAATENIGKMVASLQSEMIENQALQDVQNEQRVYAKIQATHKQREQANKSWENFLARTSNAKTLKKAKKLQEKAIESSRYTERPQNAT--FHQTVIKGLNTTVPSGRVVTVQSTPTRLLGG 441          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Mouse
Match: Cfap69 (cilia and flagella associated protein 69 [Source:MGI Symbol;Acc:MGI:2443778])

HSP 1 Score: 163.696 bits (413), Expect = 7.107e-42
Identity = 95/264 (35.98%), Postives = 149/264 (56.44%), Query Frame = 3
Query: 1242 DGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDML 2030
            DG+++LALF                  T   K  ++    W  A  EELQLHA+++L+ + P ++ ++    G +R+L  +EWC ++D +F  +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN++  + G I+ LI+I   ++ +  +   +I LEIQ D L IL+ LCE    RKE+FG +GV + +  +K           T+P     N     G+  L+ +  D+IW CI+GCY +E  FL++ G F++LD+L
Sbjct:  333 DGKVILALF------------------TYVKKPERLKIMEWSAAQYEELQLHAIATLSSVAPLLIEEYMSCHGNSRILAFLEWCGHEDSYFI-HGNSFHGTGGRGNKFAQMRYTLRLLRAMVYLEDETVNKDLCERGVIHQLIEIFKTMMSRPAEKEEAIALEIQSDTLLILSGLCENYIQRKEMFGTEGVDIVLHVMK-----------TDPK----NLQRGLGYNVLLFSTLDSIWCCILGCYDSEDYFLEKEGIFLLLDIL 562          

HSP 2 Score: 149.058 bits (375), Expect = 4.718e-37
Identity = 98/328 (29.88%), Postives = 179/328 (54.57%), Query Frame = 3
Query:  132 KTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIK 1115
            +TIPV   ++        + I K +DL +II++L         E+ L  +KKL    +NGF ++D   + K+L++CA++    P F +EP  +I+++C  PFLK+K SD + Y +   +  + +G   ++ +  +R+Q+CK + D Y  + +K  +        +Y   +VE   +++ ++QS  ++EN L  KL +  +L+ L+     C   + +  +   C   + + D S  LLFRS  ++WNL+E   + ++ +Q + LE +  L++ F +   +G+S Y+RQLRNDILV+ T++A+ NP AP +    +    +LA F  +K
Sbjct:   26 RTIPVFGVAI---PDGEMQGIFKPMDLNRIIKVLEEEDKDVSEEKQLNYIKKLIHCYQNGFPLRDLAQIFKILSLCAEKIEKQPCF-VEPASDIIKLCGLPFLKKKVSDEITYTEDTANSFALLGELMKIPSSALRIQICKCIVDFYHAEPLKKHIPGYQQVSSSYKIKMVEVGGLAKAMVQSALLLENQLVEKLWVLKVLQHLSTSGVNCTLMVKAQAASGIC-AHLNDPDPSGQLLFRSSEVLWNLLEKSSKEEIIQQLSNLECLLALKEVFKNLFVRGHSHYERQLRNDILVITTIIAQ-NPGAPMIL--LIDGKVILALFTYVK 345          
BLAST of cilia- and flagella-associated protein 69 vs. UniProt/SwissProt
Match: sp|B0CM26|CFA69_PAPAN (Cilia- and flagella-associated protein 69 OS=Papio anubis OX=9555 GN=CFAP69 PE=3 SV=1)

HSP 1 Score: 507.294 bits (1305), Expect = 6.919e-163
Identity = 330/957 (34.48%), Postives = 548/957 (57.26%), Query Frame = 3
Query:  120 NSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG----TQGAMEKFGI 2975
            +S+   IPVV   +  ED N  + + K +DL ++I+LL       L E+ L  +KKL +  +NG  ++D   + K+LN+CA +    P+F +E   +I+++CS PFLK+K SD + Y +   + ++ +G   ++ + ++R+Q+CK + D Y  +  K  +     +  +Y   + E   +++ ++QS +++E+ L  KL +  +L+ L+  S+  C  ++   +     T + + D S  LLFRS  I+WNL+E   + ++ +Q + LE +  L++ F +   +G+S YDRQLRNDILV+ T++A+ NP AP +E GF K + L ATF E+KS N LVK LK++ ++EDFELKKLL N++V+L  +   + ++ DG+++LALF                  T   K  +     W  A  EELQLHA+++L+ + P ++ ++    G  R+L  +EWC ++D  FS +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN +  ++G I  +I I  N++ K N+   +I LEIQ D+L IL+ LCE    RKE+FG +GV + +  +K           T+P   +       G+  L+ +  D+IW CI+GCY +E  FL++ G F++LD+L +   +    ILG +V+  +N K   H++ W+G   KD                 A LL ++WR+EE  + V+R +   ++D   PL  S Q+ E     L AN  S ++++++E++RA +Y++  +L + + PGL  +D +TL +I  YL+FK+GE+W EI +E++ E +RP++ D +ALE I+   E  G  V+ +Q E+I++   QD   E + Y +++  H+Q+E   + ++ F+ RTSN + LK AK  Q   I+ASR   + Q+   VFH TDI  +N T      + + STP +++GG    T  A++K  I
Sbjct:   21 SSSSSQIPVV--GVVTED-NEAQGVFKPMDLNRVIKLLEETDKDGLEEKQLKFVKKLVQCFQNGLPLRDLAQIFKILNLCAGKIKNQPRF-VESAYDIIKLCSLPFLKKKVSDEITYAEDTANSIALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQQASSSYKIQMAEVGGLAKTMVQSITLLEHQLVEKLWVLKVLQHLST-SEVNCTIMMKAQAASGICTHLNDPDPSGQLLFRSSEILWNLLEKSSKEEVIQQLSNLECLLALKEVFTNLFMRGFSHYDRQLRNDILVITTIIAQ-NPEAPMIECGFTKDLILFATFNEVKSQNLLVKGLKLSNSYEDFELKKLLFNVIVILCKDLPTVQLLIDGKVILALF------------------TYVKKPEKQKIMGWSAAQHEELQLHAIATLSSVAPLLIEEYMSCQGNARVLAFLEWCESEDPFFS-HGNSFHGTGGRGNKFAQMRYSLRLLRAMVYLEDETVNTDLCEKGTIQQMIGIFKNIISKPNEKEEAIVLEIQSDILLILSGLCENHIQRKEIFGTEGVDIVLHVMK-----------TDPRKLQ----SGLGYNLLLFSTLDSIWCCILGCYPSEDYFLEREGIFLLLDVLALNQKKFCNLILGIMVEFCDNPKTAAHVNAWQGK--KDQ--------------TAASLLIKLWRKEEKELGVKRDKNGKIIDTKKPLFTSFQE-EHKIIPLPANCPSIAVMDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCVIHRYLDFKIGEIWNEIYEEIKLEKLRPVTIDKKALEAITTASENVGKMVASLQSEIIESQARQDVQNEQKVYAKIQATHKQRELANKSWENFLARTSNAKTLKKAKRLQEKAIEASRYHKRPQN--AVFHGTDIKGLNTTVPSGGVVTVESTPARLVGGPLADTDIALKKLPI 918          
BLAST of cilia- and flagella-associated protein 69 vs. UniProt/SwissProt
Match: sp|A5D8W1|CFA69_HUMAN (Cilia- and flagella-associated protein 69 OS=Homo sapiens OX=9606 GN=CFAP69 PE=1 SV=3)

HSP 1 Score: 494.967 bits (1273), Expect = 3.999e-158
Identity = 326/957 (34.06%), Postives = 548/957 (57.26%), Query Frame = 3
Query:  120 NSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG----TQGAMEKFGI 2975
            +S+   IPVV   +  ED   ++ + K +DL ++I+LL       L E+ L  +KKL +  +NG  ++D   + K+LN+C+ +    P+F +E   +I+++C  PFLK+K SD + Y +   + ++ +G   ++ + ++R+Q+CK + D Y  +  K  +     +  +Y   + E   +++ ++QS +++EN L  KL +  +L+ L+     C   + +  +   C T + + D S  LLFRS  I+WNL+E   + ++ +Q + LE +  L++ F +   +G+S YDRQLRNDILV+ T++A+ NP AP +E GF K + L ATF E+KS N LVK LK++ ++EDFELKKLL N++V+L  +   + ++ DG+++LALF                  T   K  +     W  A  EELQLHA+++L+ + P ++ ++    G  R+L  +EWC ++D  FS +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN++  ++G I  +I I  N++ K N+   +I LEIQ D+L IL+ LCE    RKE+FG +GV + +  +K           T+P   +       G+  L+ +  D+IW CI+GCY +E  FL++ G F++LD+L +   +    ILG +V+  +N K   H++ W+G   KD                 A LL ++WR+EE  + V+R +   ++D   PL  S Q+ E     L AN  S ++++++E++RA +Y++  +L + + PGL  +D +TL II  YL+FK+GE+W EI +E++ E +RP++ D +ALE I+   E  G  V+ +Q ++I++   QD   E + Y +++  H+Q+E   + +++F+ RTSN + LK AK  Q   I+ASR   + Q+   +FH+T I  +N T      + + STP +++GG    T  A++K  I
Sbjct:   21 SSSSSQIPVV--GVVTEDDEAQD-VFKPMDLNRVIKLLEETDKDGLEEKQLKFVKKLVQCYQNGLPLRDLAQIFKILNLCSGKIKNQPRF-IESAYDIIKLCGLPFLKKKVSDEITYAEDTANSIALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQQASSSYKIQMAEVGGLAKTMVQSMTLLENQLVEKLWVLKVLQHLSTSEVNCTIMMKAQAASGIC-THLNDPDPSGQLLFRSSEILWNLLEKSSKEEVIQQLSNLECLLALKEVFKNLFMRGFSHYDRQLRNDILVITTIIAQ-NPEAPMIECGFTKDLILFATFNEVKSQNLLVKGLKLSNSYEDFELKKLLFNVIVILCKDLPTVQLLIDGKVILALF------------------TYVKKPEKQKIIDWSAAQHEELQLHAIATLSSVAPLLIEEYMSCQGNARVLAFLEWCESEDPFFS-HGNSFHGTGGRGNKFAQMRYSLRLLRAVVYLEDETVNKDLCEKGTIQQMIGIFKNIISKPNEKEEAIVLEIQSDILLILSGLCENHIQRKEIFGTEGVDIVLHVMK-----------TDPRKLQ----SGLGYNVLLFSTLDSIWCCILGCYPSEDYFLEKEGIFLLLDLLALNQKKFCNLILGIMVEFCDNPKTAAHVNAWQGK--KDQ--------------TAASLLIKLWRKEEKELGVKRDKNGKIIDTKKPLFTSFQE-EQKIIPLPANCPSIAVMDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSDIIESQACQDMQNEQKVYAKIQATHKQRELANKSWEDFLARTSNAKTLKKAKSLQEKAIEASRYHKRPQN--AIFHQTHIKGLNTTVPSGGVVTVESTPARLVGGPLVDTDIALKKLPI 918          
BLAST of cilia- and flagella-associated protein 69 vs. UniProt/SwissProt
Match: sp|B0VXE6|CFA69_CALJA (Cilia- and flagella-associated protein 69 OS=Callithrix jacchus OX=9483 GN=CFAP69 PE=3 SV=1)

HSP 1 Score: 493.041 bits (1268), Expect = 2.244e-157
Identity = 318/926 (34.34%), Postives = 528/926 (57.02%), Query Frame = 3
Query:  171 DSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG 2945
            + +  + + K +DL  +I+LL   +   L E+ L  +KKL +  +NG  ++D   + K+LN+CA +    P+F +E   +I+++C  PFLK+K SD + Y +   + ++ +G   ++ + ++R+Q+CK + D Y  +  K  +     +  +Y   + E   +++ ++Q+ +++EN L  KL +  +L+ L+  S+  C+ ++   +       + + D S  LLFRS  I+WNL+E   + ++  Q + LE +  L++ F +   +G+S YDRQLRNDILV+ T++A+ NP AP +E GF K + L ATF E+KS N LVK LK++ ++EDFELKKLL NI+V+L  +   I ++ +G ++LALF                  T   K  +  T  W  A  EELQLHA+++L+ + P ++ ++    G  ++L  +EWC  +D  FS +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN +  ++G I  +I I  N++ K+N+   +I LEIQ D+L IL+ LCE    RKE+FG +GV + +  +K           T+P   +       G+  L+ +  D+IW CI+GCY +E  FL++ G F++LD+L +   +    ILG +V+  +N K   H++ WRG   KD                 A LL ++WR+EE  + V+R +   ++D   PL  S Q+ E     L AN  S ++++++E++RA +Y++  +L + + PGL  +D +TL II  YL+FK+GE+W EI +E++ E +RP++ D +ALE I+   E  G  V+ +Q E+I++   QD   E + Y +++  H+Q+E   + +  F+ RTSN + LK AK  Q   I ASR   + Q    +FH TDI  +N T      + + STP +++GG
Sbjct:   35 EDDEAQGVFKPMDLNHVIKLLEETNKDGLEEKQLKFVKKLVQCYQNGLPLRDLAQIFKILNLCAGKIKNQPRF-IESAYDIIKLCGLPFLKKKVSDEITYAEDTANSIALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQQACSSYKIQMAEVGGLAKTMVQAVTLLENQLVEKLWVLKVLQHLST-SEVNCSIMMKAQAASGICAHLNDPDPSGQLLFRSSEILWNLLEKSSKEEILPQLSNLECLLALKEVFKNLFMRGFSHYDRQLRNDILVITTIIAQ-NPEAPMIECGFAKDLILFATFNEVKSQNILVKGLKLSNSYEDFELKKLLFNIIVILCKDLPTIQLLIEGSVVLALF------------------TYVKKPEKQRTIDWSAAQYEELQLHAIATLSSVAPLLIEEYMSCQGNAQVLAFLEWCEIEDSFFS-HGNSFHGTGGRGNKFAQMRYSLRLLRAMVYLEDETVNTDLCEKGTIQQMIGIFKNIISKTNEKEEAIVLEIQSDILLILSGLCEHHIQRKEIFGTEGVDIVLHVMK-----------TDPRKLQ----SGLGYNVLLFSTLDSIWCCILGCYPSEDYFLEKEGIFLLLDVLALNEKKFCNLILGIMVEFCDNPKTAAHVNAWRGK--KDQ--------------TAASLLIKLWRKEEKELGVKRDKNGKIIDTKKPLFTSFQE-EQKIIPLPANCPSIAVMDVSENIRAKIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKKALEAITTASENIGKMVASLQSEIIESQACQDVQNEQKVYAKIQATHKQRELANKSWGNFLARTSNAKTLKKAKRLQEKAIKASRYHERPQ--HAIFHPTDIKGLNTTVPSGGVVTVESTPARLVGG 904          
BLAST of cilia- and flagella-associated protein 69 vs. UniProt/SwissProt
Match: sp|Q8BH53|CFA69_MOUSE (Cilia- and flagella-associated protein 69 OS=Mus musculus OX=10090 GN=Cfap69 PE=1 SV=1)

HSP 1 Score: 476.863 bits (1226), Expect = 2.686e-151
Identity = 320/953 (33.58%), Postives = 537/953 (56.35%), Query Frame = 3
Query:  132 KTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG----TQGAMEKFGI 2975
            +TIPV   ++        + I K +DL +II++L         E+ L  +KKL    +NGF ++D   + K+L++CA++    P F +EP  +I+++C  PFLK+K SD + Y +   +  + +G   ++ +  +R+Q+CK + D Y  + +K  +        +Y   +VE   +++ ++QS  ++EN L  KL +  +L+ L+     C   + +  +   C   + + D S  LLFRS  ++WNL+E   + ++ +Q + LE +  L++ F +   +G+S Y+RQLRNDILV+ T++A+ NP AP +E GF + + L ATF E+KS NPLVK+LK+   +EDFELKKLL NI+V+L  + + + ++ DG+++LALF                  T   K  ++    W  A  EELQLHA+++L+ + P ++ ++    G +R+L  +EWC ++D +F  +GNSFH  GGRGNK AQMR+ +RL+  +V + DE VN++  + G I+ LI+I   ++ +  +   +I LEIQ D L IL+ LCE    RKE+FG +GV + +  +K           T+P     N     G+  L+ +  D+IW CI+GCY +E  FL++ G F++LD+L +   +    ILG +V+  +N K   H++ WRG      K+ L +          A LL ++WR+EE  + V+R     ++D   PL  S Q+ E     L AN  S +++++ E++RA +Y++  +L + + PGL  +D +TL II  Y +FK+GE+W E+ +E++ E +R ++ D ++L  I    E  G  V+ +Q E+I+    QD   E   Y +++  H+Q+E+  + ++ F+ RTSN + LK AK  Q   I++SR T + Q+ +  FH+T I  +N T      + + STP ++LGG    T  A++K  I
Sbjct:   26 RTIPVFGVAI---PDGEMQGIFKPMDLNRIIKVLEEEDKDVSEEKQLNYIKKLIHCYQNGFPLRDLAQIFKILSLCAEKIEKQPCF-VEPASDIIKLCGLPFLKKKVSDEITYTEDTANSFALLGELMKIPSSALRIQICKCIVDFYHAEPLKKHIPGYQQVSSSYKIKMVEVGGLAKAMVQSALLLENQLVEKLWVLKVLQHLSTSGVNCTLMVKAQAASGICAH-LNDPDPSGQLLFRSSEVLWNLLEKSSKEEIIQQLSNLECLLALKEVFKNLFVRGHSHYERQLRNDILVITTIIAQ-NPGAPMIECGFTRDLILFATFNEVKSQNPLVKSLKLFNCYEDFELKKLLFNIIVILCKDLATVQLLIDGKVILALF------------------TYVKKPERLKIMEWSAAQYEELQLHAIATLSSVAPLLIEEYMSCHGNSRILAFLEWCGHEDSYFI-HGNSFHGTGGRGNKFAQMRYTLRLLRAMVYLEDETVNKDLCERGVIHQLIEIFKTMMSRPAEKEEAIALEIQSDTLLILSGLCENYIQRKEMFGTEGVDIVLHVMK-----------TDPK----NLQRGLGYNVLLFSTLDSIWCCILGCYDSEDYFLEKEGIFLLLDILALNQKKFCNLILGIMVEFCDNPKTSAHVNAWRG------KKDLTA----------ASLLIKLWRKEEKELGVKRDRNGKIVDTKRPLFTSFQE-EQKTMPLPANCPSIAVMDVAENIRAKIYAVLDKLDFENLPGLSAEDFVTLCIIHRYFDFKIGEIWNEVSEEIKLEKLRLVTTDEKSLNSIIAATENIGKMVASLQSEMIENQALQDVQNEQRVYAKIQATHKQREQANKSWENFLARTSNAKTLKKAKKLQEKAIESSRYTERPQNAT--FHQTVIKGLNTTVPSGRVVTVQSTPTRLLGGPLADTDIALKKLPI 919          
BLAST of cilia- and flagella-associated protein 69 vs. TrEMBL
Match: A0A210R3M7 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19521 PE=4 SV=1)

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 414/969 (42.72%), Postives = 619/969 (63.88%), Query Frame = 3
Query:   51 IKSIQNYNFPNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIH-KYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGGTQG 2954
            + + Q YN P  F  N + +  V S    IP+V + +  E+    +    + +++ ++++LL+ PHS  LY+RH+ A+++L +H + GF MKD + V K+LN+C+D++   P  Y   I +IL+ICS PFLKEKSSD LIY +I  + VSQ+GY  R+ + DVR Q+CK+L   YT++     +    P+ ++Y ++++E SDVSE L++S +++EN + +KLA+ ++L+  +K+S + C+++L + +     + + ++D S  LLFRSV+I+WNL+E GD  +L  Q + L  I  LRD+F+ QL++GYS YDRQLRND+LV+ATL+A   PNAPFVETGF KQ+TL ATFQE+KSHN LVK+LK+  NHEDFELKKLL NILV LS + + +P++ +G L+L+LF          +F+  N +T       +    W  A  EE+QLHA+S L  L P M+  +    G  R+L+L+EWC+  +  F G+GNS H  GGRG+K AQMR C+RL+  +V   DE+V Q+  D+G IN +I IL N + S   + ++D+E+Q DML IL+ LC+ D HRKELFG  GV V I +L    KL                +   G  +L++A  D +W  I+ CY TE  FL++ G F+++D+LE+ P  ++  ILGCL+DL EN K ++H+ TWRG    DN             A+  HL C I+R EE  + V R +   +LD   PLMG  Q+ +       AN  S++I++++E++RA +YS+F ++G+ D PGL +DDH+TLT++E YL+FKMGEVW E+  EL  E +RP++PD+EA+E ISR IE+    VS  Q+EL++A ++QD ++E EFY ++RENHRQKEK +  F +F+ RTSN+  LK A   Q ++I+ASR+ TK ++  T FH TD+  ++ T F   TI ++ST  ++ GG  G
Sbjct:    1 MAATQMYN-PVGF-SNNSMTQAVTSEKPVIPLVKHIITDEEIGLLKGSKLQPINMNRVVKLLTDPHSVMLYDRHINALQRLVRHYEKGFPMKDLVQVCKVLNVCSDKTQERP-MYETLICDILKICSLPFLKEKSSDELIYEQIVTESVSQLGYLMRVPSRDVRKQICKTLVSFYTEKPSSQEVQKHKPTSVSYNQNIIENSDVSETLVKSLALLENDIAIKLAVLDVLQHFSKNSAKNCDQMLRVGAGNRICSRMTDADPSGQLLFRSVDILWNLLEFGDGGELATQLDNLSCINQLRDAFVFQLTQGYSHYDRQLRNDLLVIATLVASKCPNAPFVETGFAKQLTLFATFQEVKSHNVLVKHLKLMKNHEDFELKKLLFNILVTLSKDSTAVPVLSEGHLMLSLF----------SFVRANENT-------MGPRDWTSAQFEEVQLHAMSCLCALCPLMIEDYMTCQGSTRILLLLEWCVGKE-DFGGHGNSIHGTGGRGSKRAQMRHCLRLLRSVVSTGDEVVVQDLADQGAINQIITILLNAIHSQRGDDAVDVEMQSDMLLILSCLCDGDMHRKELFGTTGVDVTIHYLNTDSKLL---------------SSGLGHHRLLLAAVDCVWCSIVNCYGTEDYFLEKEGVFLLIDLLEVCPKNMHNLILGCLLDLCENPKTIHHVLTWRGA---DN-------------ASAPHLFCDIFRNEERELGVRRTKDGAILDHTRPLMGVLQENQGVIPQPAANP-SQAIVDVSENMRAKIYSIFCKIGFTDLPGLTVDDHVTLTVVEKYLDFKMGEVWNEVIAELSEEQVRPVTPDLEAIEAISRAIEERVHIVSGTQQELLEAQQNQDVLDEQEFYAEIRENHRQKEKAMNDFTDFVARTSNFALLKAAGDRQELSIEASRLQTKYKESET-FHSTDLKALHTTTFSGRTIAVDSTSNRLTGGPLG 915          
BLAST of cilia- and flagella-associated protein 69 vs. TrEMBL
Match: A0A1S3JLC2 (cilia- and flagella-associated protein 69 OS=Lingula unguis OX=7574 GN=LOC106173918 PE=4 SV=1)

HSP 1 Score: 733.021 bits (1891), Expect = 0.000e+0
Identity = 407/975 (41.74%), Postives = 617/975 (63.28%), Query Frame = 3
Query:   90 LENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIH-KYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVLKSNDSNS--SIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGY--LEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGGTQGAME-KFGILHSDSLR 2996
            + +Q  +  + ++   IP+V +++  +D    +    + ++L ++ +L++ PHSS LY+RH+ A++KL KH K GF MKD + V K+LN+CADR    P  Y EP+  IL IC  PFLKEK+SD   Y +I ++ VSQ+GY  R+ + D+R ++C +L   Y +      +     + L+Y + +VE SD+SE L++S +++EN L+++L +  +L+  +K S + C+++L  D+       + + D S  LLFRSV+++WNL+E G +    EQ N +  I  LRD+FI QL++GYS YDRQLRND+L++A+L+A+  P APFVETGFV+Q+TL ATFQE+KSH+ LV++LK+  +HEDFELKKLLINIL +LS +  ++P++ +G+LLLALF  + P          N +T   +        W PA  EELQL A++SL  L+P M+  +    G  RLL+L+EWC  +   F+G GN+FH  GGRGNK AQMR C+RL+   V    E+V Q+ VD+G I+ +  IL    + NDS++  +ID+E+QCDML+IL+ LC+ D HRKELF H+GV +   +LK           T P       +   G  KL++A  D IW  I+GCY TE  FL++ G F+++D+LE+ P+ ++  ILGCL+DL+EN KA+ H++ WRG   KD+              + AHL C IWR EE  + V+R +   + D + PL G   +L+ + G   L A+  S++I++++E++RA LY+LF ++G++  PGL ++D++TL IIE Y++FK+GEVW+E+  EL+ E IRP++PD EA+E ISR I      V   Q++++ + + Q  MEE E Y ++RENHRQKEK I  F +F+ RTSNY  LK A+  Q +++DASR+  + QD  T FH+ D+ N+N T F    I I+STP+++ GG     + K G L S + +
Sbjct:   11 VSSQNPTQTLTTSKPRIPIVSHTITDDDLGILQGAKLQPMNLTRVAKLMTDPHSSMLYDRHIHALRKLPKHYKQGFLMKDLVLVVKILNVCADRLEEQP-MYTEPMCSILDICRLPFLKEKTSDETSYERIAIESVSQLGYLMRVPSNDIRKKICAALISFYCETPPPQVVQKHKANSLSYNQRIVESSDLSETLVKSLALLENDLDVRLEVLKVLQQFSKRSAKNCDQMLCADAASRLCCRLMDPDPSGELLFRSVDVLWNLLEYGQKENAIEQINDMTCISQLRDAFIQQLTQGYSHYDRQLRNDLLIIASLIAQVCPQAPFVETGFVRQLTLFATFQEVKSHSALVRHLKLMTSHEDFELKKLLINILTVLSKDPCVVPLLSEGRLLLALFSYVRP----------NENTSLPR-------DWTPAQFEELQLCAMASLATLVPFMVEDYMMCQGSTRLLLLMEWCTGEKGKFNGYGNAFHGAGGRGNKRAQMRHCLRLMRSAVSTGREVVLQDLVDQGAISEINTILRGYTE-NDSSTEDAIDVEMQCDMLYILSTLCDGDMHRKELFSHEGVDIVCKYLK-----------TNPVKL----SSGLGHHKLVLATVDCIWCAIVGCYVTEDYFLEKEGVFLLIDLLEVCPTNMHNLILGCLLDLTENPKAIPHINAWRG---KDD-------------MSAAHLFCDIWRSEEREMGVQRDQQGAIADTSLPLTG---QLQANQGVIPLPASCPSQAIVDVSENMRAKLYALFCKIGFMHLPGLTVEDYVTLAIIEKYMDFKLGEVWSEVITELDAEGIRPVTPDQEAIETISRAIVDRADSVVGTQKDMLLSQQHQSLMEEQEHYAEIRENHRQKEKAINDFADFVARTSNYSLLKAARERQELSVDASRVQNRYQDAET-FHELDLANLNTTAFSGRQIMIDSTPVELTGGPLAKYDSKKGTLKSRTFQ 931          
BLAST of cilia- and flagella-associated protein 69 vs. TrEMBL
Match: A0A3S0ZS66 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_010793 PE=4 SV=1)

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 413/938 (44.03%), Postives = 589/938 (62.79%), Query Frame = 3
Query:  123 SNHKTIPVVHYSLFKEDSNTEERIH-KYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGC------XXXXXXXXXXVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHI 2915
            S    IP+V + +  ED    E    + V+L++II+LL+ PHS  LYERH+ A+ ++ +H  NGF MKD + V K+LN+CADR  + P  Y +PI+EIL++CS PFL EKSSD L+Y +I V+ VSQ+GY  R+ + DVR Q+C +L   +T   V   +    P+ L+Y   +VE SD+SE L++S +++E  L  KL +  +L+L +K S + C+++L +D  +   + + + D S  LLFRSV+I+WNLMENGD+  L +Q N L  I  LRD+F+ QL++GYS YDRQLRND+LVLATL+A   P  PFVETGF KQ+TL ATFQE+KSHN LV++LK+  NHEDFEL+KLL NILV+LS + +++ I+ +G LLLALF          +F+  N         +     W PA  EELQL A++SL  L P ML  +    G  RLL+L+EWC+  D  F G GNSFH   GRG+K AQMR C+RL+  +V   DE + Q+  D+G             +     +  + N ++++E+Q D+LFIL+ LC+ D HRKELFG  GV + + +L+   KL                +   G  KL++A  D  W  I+GCY TE  FL++ G F++ D+LE+ P  ++  ILGCL+DL EN K +NH+ TWRG   KD                 +HLLC+IWR+EE  I V+R     + DV+ PLMG  Q  E+    + A+ +S+++ ++ E++RA +YSLF ++G+ D PGL ++DH+TLTIIE YL+FKMGEVW+E   EL+ E++RP++PD EA+E ISR IE+    V   Q EL++A ++QD ++E EFY ++RENHRQKEK I  F +F+ RTSN+  LK AK  Q I+IDASR+  K ++ S  FH TD+  +  T F  + + +
Sbjct:   19 SEKTRIPLVTHIITDEDLGICEGAKLQPVNLKRIIKLLTDPHSLMLYERHVHALSRMARHFANGFPMKDLVQVFKILNVCADRVDSNP-IYEQPILEILKLCSLPFLMEKSSDELVYEQIVVESVSQLGYLMRIPSSDVRKQICNTLLK-FTTMKVAQSVQCLKPTTLDYNNKMVEFSDISETLVKSLALLETDLPSKLKVLEILQLFSKSSAKNCDQMLFVDGGRRICSRLMDPDPSGQLLFRSVDILWNLMENGDKAVLAKQLNNLSCISQLRDAFVYQLTQGYSHYDRQLRNDLLVLATLVATQCPETPFVETGFAKQLTLFATFQEVKSHNALVRHLKLLTNHEDFELRKLLFNILVVLSKDTTVVSILSEGHLLLALF----------SFVRAND-------RKTGPREWTPAQFEELQLQAMASLCTLCPLMLEDYMTCQGSTRLLLLLEWCVGPD-EFCGQGNSFHGTSGRGSKKAQMRHCLRLMRSVVSTEDEFLLQDLADQGAINQLIDTCTKWVLNTAFTQRTEENDAVEIEMQSDILFILSCLCDGDMHRKELFGIQGVDMVVRYLRTDTKLL---------------SSGLGHHKLLLASIDCTWCAIVGCYITEDYFLEKEGVFLLFDLLEVCPKNMHNVILGCLLDLCENPKTVNHVLTWRG---KDG-------------CTASHLLCQIWRQEESEIGVKRDNEGAIYDVHKPLMGRIQA-EMGVVPMPASCVSQAVADVGENMRAKVYSLFCKMGFTDLPGLTVEDHVTLTIIEKYLDFKMGEVWSETISELQEENVRPVTPDQEAIEAISRAIEERAQIVLSTQSELLEAQRNQDILDEQEFYAEIRENHRQKEKAIADFTDFVSRTSNFALLKAAKDRQEISIDASRMRPKYKE-SEDFHNTDLPQLTTTVFSGKHVTV 903          
BLAST of cilia- and flagella-associated protein 69 vs. TrEMBL
Match: A0A2C9K4R4 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106051173 PE=4 SV=1)

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 411/937 (43.86%), Postives = 615/937 (65.64%), Query Frame = 3
Query:  132 KTIPVVHYSLFKEDSNTEE--RIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKN---SDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVL-KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINST 2924
            + IP+V + +  +D    E  ++H  V L+KI +LL+ PHSS LY+RH+  + K+  H   G  MKD + + K+LN+CADR  A+P  Y +PI++IL++CS PFL EK+SD L+Y +I V+ +SQ+GY  R+   DVR Q+C +L + +T +S  + L    P+ L + + V+E SD+SE L++S +++EN LE+KL L  +L+L +K+S + C+++L +++ +   + + ++D S  LLFRSV+I+WNL+ENG+++ L  Q N +  I  LRD+F+ Q+++G+S YDRQLRND+LV+ATL+A   P APFVETGF KQ+TL ATFQE+KSHN LV++LK+A NHEDFEL+KLL NILV+LS++K++I I+ +G LLLALF          +F+  N   +D +   L Q           EE+QLHA+++L  L PKML  +    G  RLL+L+EWC+  +  FSG+GNSFH  GGRG K +QM +C+RL+  +    DE++ Q+  D+G IN LI +LN    + ND N +I++E+Q D+LFIL+ LCE+D HRKELFG  GV + I +L+   +L                +   G  KL++   D  W   +GCY TE  FL++ G F++ D+LE+ P  ++  I+GCL+DL EN K +NH+  WRG                +   + +HLLC +WR++E++I V+R     + D+  PLMG  Q  ++    L A+ +S++I +++E++RA +YSLF ++G+ D PGL +DDH+TLTIIE YL+FKMGEVW+E   EL+ E++RP++PD EA+E ISR IE+  V V+  Q+ELI+A K+QD ++E EFY Q+RENHRQKEK I  F +F+ RTSN+++LK AK  Q I+IDASR+   N+ +   FH   + N+  T F  + + +N +
Sbjct:   22 QNIPLVTHIITDDDMGILEGAKLHP-VKLKKIFKLLTDPHSSMLYDRHVYTLNKMVLHYAKGIPMKDLVEMFKILNVCADRVEAIP-IYEKPILDILKLCSIPFLMEKTSDELVYEQIVVESISQLGYLMRIPTSDVRNQICVTLLN-FTSKSGNNDLQKFKPTSLQFNKKVIENSDISETLVKSLALVENDLEIKLKLLEILQLFSKYSAKNCDQMLHVEAGRRICSRLMDTDPSGQLLFRSVDILWNLIENGNKSDLASQLNNMACISQLRDAFVYQMTQGHSHYDRQLRNDLLVIATLVAYQCPKAPFVETGFAKQLTLFATFQEVKSHNALVRHLKLATNHEDFELRKLLFNILVVLSNDKTVISILSEGHLLLALF----------SFVRANEQKTDPRELSLAQF----------EEIQLHAMAALCTLCPKMLEDYMTCQGSTRLLLLLEWCVGPE-EFSGHGNSFHGTGGRGTKKSQMHYCLRLLRSVASTKDEIILQDMADQGAINQLIGVLNTAFTQRNDQNDAIEIEMQSDILFILSCLCEQDLHRKELFGIQGVDMVIRYLRTDTRLL---------------SSGLGHHKLLLTSIDCAWCSTVGCYVTEDYFLEKEGVFLLFDLLEVCPKNMHNIIIGCLLDLCENPKTVNHILAWRG----------------KAGTSASHLLCELWRQDEIQIGVKRDSQGAITDLRRPLMGQIQA-DLGVIPLPASCVSQAIADVSENIRAKIYSLFCKMGFSDLPGLSLDDHVTLTIIEKYLDFKMGEVWSETIGELQLENVRPVTPDQEAMEAISRAIEERAVIVAATQQELIEAQKNQDVIDEQEFYAQMRENHRQKEKAIADFTQFVARTSNFQELKAAKEKQEISIDASRMHPINK-QGDHFHDVSLPNLTSTVFSGKHVIVNES 901          
BLAST of cilia- and flagella-associated protein 69 vs. TrEMBL
Match: A0A2C9K4S3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106051173 PE=4 SV=1)

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 409/942 (43.42%), Postives = 613/942 (65.07%), Query Frame = 3
Query:  132 KTIPVVHYSLFKEDSNTEE--RIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKN---SDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXX------XXXXXVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINST 2924
            + IP+V + +  +D    E  ++H  V L+KI +LL+ PHSS LY+RH+  + K+  H   G  MKD + + K+LN+CADR  A+P  Y +PI++IL++CS PFL EK+SD L+Y +I V+ +SQ+GY  R+   DVR Q+C +L + +T +S  + L    P+ L + + V+E SD+SE L++S +++EN LE+KL L  +L+L +K+S + C+++L +++ +   + + ++D S  LLFRSV+I+WNL+ENG+++ L  Q N +  I  LRD+F+ Q+++G+S YDRQLRND+LV+ATL+A   P APFVETGF KQ+TL ATFQE+KSHN LV++LK+A NHEDFEL+KLL NILV+LS++K++I I+ +G LLLALF          +F+  N   +D +   L Q           EE+QLHA+++L  L PKML  +    G  RLL+L+EWC+  +  FSG+GNSFH  GGRG K +QM +C+RL+  +    DE++ Q+  D+G IN LI       +     + ND N +I++E+Q D+LFIL+ LCE+D HRKELFG  GV + I +L+   +L                +   G  KL++   D  W   +GCY TE  FL++ G F++ D+LE+ P  ++  I+GCL+DL EN K +NH+  WRG                +   + +HLLC +WR++E++I V+R     + D+  PLMG  Q  ++    L A+ +S++I +++E++RA +YSLF ++G+ D PGL +DDH+TLTIIE YL+FKMGEVW+E   EL+ E++RP++PD EA+E ISR IE+  V V+  Q+ELI+A K+QD ++E EFY Q+RENHRQKEK I  F +F+ RTSN+++LK AK  Q I+IDASR+   N+ +   FH   + N+  T F  + + +N +
Sbjct:   22 QNIPLVTHIITDDDMGILEGAKLHP-VKLKKIFKLLTDPHSSMLYDRHVYTLNKMVLHYAKGIPMKDLVEMFKILNVCADRVEAIP-IYEKPILDILKLCSIPFLMEKTSDELVYEQIVVESISQLGYLMRIPTSDVRNQICVTLLN-FTSKSGNNDLQKFKPTSLQFNKKVIENSDISETLVKSLALVENDLEIKLKLLEILQLFSKYSAKNCDQMLHVEAGRRICSRLMDTDPSGQLLFRSVDILWNLIENGNKSDLASQLNNMACISQLRDAFVYQMTQGHSHYDRQLRNDLLVIATLVAYQCPKAPFVETGFAKQLTLFATFQEVKSHNALVRHLKLATNHEDFELRKLLFNILVVLSNDKTVISILSEGHLLLALF----------SFVRANEQKTDPRELSLAQF----------EEIQLHAMAALCTLCPKMLEDYMTCQGSTRLLLLLEWCVGPE-EFSGHGNSFHGTGGRGTKKSQMHYCLRLLRSVASTKDEIILQDMADQGAINQLIGLCTKWVLNTAFTQRNDQNDAIEIEMQSDILFILSCLCEQDLHRKELFGIQGVDMVIRYLRTDTRLL---------------SSGLGHHKLLLTSIDCAWCSTVGCYVTEDYFLEKEGVFLLFDLLEVCPKNMHNIIIGCLLDLCENPKTVNHILAWRG----------------KAGTSASHLLCELWRQDEIQIGVKRDSQGAITDLRRPLMGQIQA-DLGVIPLPASCVSQAIADVSENIRAKIYSLFCKMGFSDLPGLSLDDHVTLTIIEKYLDFKMGEVWSETIGELQLENVRPVTPDQEAMEAISRAIEERAVIVAATQQELIEAQKNQDVIDEQEFYAQMRENHRQKEKAIADFTQFVARTSNFQELKAAKEKQEISIDASRMHPINK-QGDHFHDVSLPNLTSTVFSGKHVIVNES 906          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Cavefish
Match: CFAP69 (cilia and flagella associated protein 69 [Source:NCBI gene;Acc:103045474])

HSP 1 Score: 547.74 bits (1410), Expect = 2.566e-179
Identity = 347/936 (37.07%), Postives = 552/936 (58.97%), Query Frame = 3
Query:  198 KYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNR-LLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEAN---GWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLE--VSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGG----TQGAMEKFGI 2975
            ++ DL ++IRLL  P SS+L ERH+ A+KK+ K  + GF +KD  ++ ++LNICA+RS   P+ Y   + ++L IC  PFLKEK+SD   Y  +  D +SQ+G   R+ +  +R Q+  S+  LY+    +   D   P  L Y + +VE S ++E L  S +++EN L  K  +   L++L+  S  C   + +  + K C+  +   D S  +LFRS  I+WNL+ENG   ++  Q + ++ I +L+++F+  L  GY  YD+QLRND+LV+ TL+A+ NP+AP +E+GF KQ+ L  TF E+KSHNPL++ LK+A  +EDFE+KKLL+N++V+LS + S + + ++ +++LAL + + P  +     GK   +            W P  QEELQL AL++L  + P M+ ++   C  N  LLML+EWC   D +F G G++FH  GGRG K AQMR+C+RL+  +  +++ ++NQ+  D+G I+ L+ +L    +  +   ++ +EIQ D+L  L  LCE+D HRKELFG +GV + I +LK                   NPA+     G  +L  +  D +W+CI+GCY TE LFL++ GAF++LD L + P  +   +LG L++L +N K L H++ WRG                + +     LL ++WR+EE  + V+R ++S + DV  P++   Q+ E  VS   + AN  S ++++++E+LR+ +Y+LF RLG+ D  GL  +D+ITL+I+  YL+FK+GEVW EI  ELE E +RPI+PD EAL  I +  E     V  +Q+ ++   + ++  EE   Y ++  N +Q E  ++  Q +I +TS+YE LK +K  Q  +I++SR   K++ +  +FH T I  +  T F +  + I STP  + GG    T  A+E+  I
Sbjct:   44 RHPDLPRVIRLLEEPVSSSLKERHIFALKKVVKRCQTGFLLKDLADLFRILNICAERSKDHPE-YAPVLCDLLHICRLPFLKEKASDEPNYASVVTDSLSQLGLFMRVPDCKIREQISTSIISLYSTDKARQ-YDGVCPISLGYRQELVECSGLAETLTMSLALLENQLPAKHQVLRALQMLSSSSFNCSLILKAEGAQKICFH-MNEPDPSGQVLFRSSEILWNLLENGSREEVTSQLSNMDCIMFLKEAFLHHLLDGYRHYDQQLRNDLLVIITLIAE-NPSAPLIESGFAKQLILFVTFPELKSHNPLIRKLKLAFTNEDFEMKKLLLNLVVVLSRDLSAVQLFKESRVMLALMLLVRPSSSDSRPSGKGRRS------------WTPVQQEELQLQALATLATVAPLMIEEYIS-CQANVCLLMLLEWCTQQDGYF-GQGHAFHGAGGRGGKKAQMRYCVRLLRCMTSLSNNIINQDLCDQGAISQLLGLLRRFQEREEEEDAVCVEIQTDVLLTLTTLCEEDMHRKELFGSEGVEMVIRYLKM------------------NPAQLQSGLGHNRLFASTVDCVWSCIVGCYLTEDLFLEKEGAFLLLDFLHLSPRSMKGVLLGTLLELCDNPKTLAHVTAWRG----------------EKELTAPALLLQMWRQEEAELGVKRDQHSRITDVKKPILTRYQEEEPLVS---VPANTPSSAVIDVSENLRSKIYALFLRLGFQDLQGLTAEDYITLSIVSRYLDFKIGEVWAEISAELELEGVRPITPDAEALRTIIQASEDTAKHVCSLQQSILGQQEQEELKEEKRAYEEMSLNRKQHELTMKSRQHYIAKTSDYEILKESKRLQERSIESSR--PKDRPEGFIFHSTQIHGLQTTNFYSRVVTIESTPAALTGGPLANTDLALERVPI 922          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Sea Lamprey
Match: CFAP69 (cilia and flagella associated protein 69 [Source:HGNC Symbol;Acc:HGNC:26107])

HSP 1 Score: 349.747 bits (896), Expect = 1.667e-108
Identity = 226/654 (34.56%), Postives = 352/654 (53.82%), Query Frame = 3
Query:  969 KGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTS----VWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVLKSNDS---------NSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSE-LYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVT 2888
            +G+S YDRQLRND+LVL TL+A  +P +PF+ETG  KQ+ LLATF E+KSHNPLVKNL +   HEDFE+KKLL N+LV+LS +   I ++  G +LL+LF                    YS +++   +     W PA QEELQL AL++L  L P +   +  + G  RLL+L++WC++ D      G         G KL Q+ +C+R++  + R+ D  + Q+  D+G I  L+ +++   +S D             + LEIQ D L  L++LC+ D HRKELFG DG V+    L     L             P+         L+IA  DA+W C++GC+++E +FL+  GAF++LD+L++  +  ++   L  LV+L +N KA +H+  WRG       +    +         A LLC    EE             L     PL+ +  + E     +   Q S+++L I E+    +Y +FS++G+   PGL  +D +TL I+E Y++FK+GEVW E++ EL  E +RP +PD +ALE ++R   +    V++IQ  +++  + Q+  +E +FY +++ NH+Q+E  I+ +  ++ RTSNYE LK A+     +ID+SR            H T +  +  T
Sbjct:    1 RGFSHYDRQLRNDLLVLVTLIAH-DPASPFLETGLTKQLVLLATFTEVKSHNPLVKNLVLTSVHEDFEMKKLLFNLLVVLSRDPCNIQLLSQGHVLLSLF-------------------HYSDVHEARAASGPLTWSPAQQEELQLQALAALVTLAPALPTDYMHIQGNTRLLLLLDWCLSKDQR---QGTGVKRGAELGGKLPQLLYCIRVMRAMARLQDSSIAQDMCDQGTIGQLLGLMSGS-RSRDGELVDGGPGFTDVVSLEIQTDALLTLSSLCQTDVHRKELFGRDGTVMLTKILHAGPHLMPAGL--------PH-------SHLVIAAIDAVWCCVLGCFSSEDIFLEHEGAFLLLDLLQVPCTHAVHSLTLSVLVELLDNPKA-SHVLAWRGWGRVAEARAADGAGPRDGATAPALLLCLWREEEVELGVPRGPRGVVLPGPQLPLVDAA-RAEQPVVPVAGRQPSQAVLNITENNWVKIYIIFSKIGFQGLPGLSPEDQVTLAIVERYMDFKVGEVWQEMEAELREEGVRPTTPDRDALETVARATGEVVAGVARIQAAILEESQEQELQDERQFYAEIKANHQQEEAAIKSWNHYVARTSNYEMLKEAQRELKQSIDSSRPGEDQPGPKP--HSTTVPGLTTT 611          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Nematostella
Match: EDO44742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR1])

HSP 1 Score: 477.633 bits (1228), Expect = 2.489e-153
Identity = 332/965 (34.40%), Postives = 498/965 (51.61%), Query Frame = 3
Query:  168 EDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHRKEL-------------------------------------FGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEAN---GWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGY--LEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMA-KHNQSINIDASRITTKNQDKSTVFH-----KTDIDNINVTKFCAETIHIN 2918
            E  N +   H  V + K  +L+   HS  L ERH  A+ +LTKH   GF    + N         +R      F              PFLKEKSSD  +Y +  + L+++                                +D  VP+   +I+S +E+S ++  L++    +++       +  L       S   C+ +LS+       + +   D S  L+F SV I+WNL+E G +  +++Q N  E I  L+D F+ Q+ +GYS  DRQLRND+LV+++L+A    +APFVETGF K + L ATF E+KSHNPLV+N K+  NHEDFELKKLL+N L+LLS + +   I+ +G++LL+L   + P  N                  +S+  W PA  EELQL AL +L  + P  +  +    G  RLLML+EWC+     + G+GNS+H  GGRGNK AQMRF +RL+  +V V DE VNQ+ +D+G I+ L+ IL N   S D N  ID+E+QCDML I++ LCE D HRK                                          DG    +  L       +          + +P++ N   G  KL++A  D IW+ ++G + TE +FL+  G F +LD+LE+ PS +   +LGCLVDL EN K L H+  WRG      KQ +  SK          LL  +W++EE  + V R     + D   PL G   +L+   G   L A++ S+SI++++E++RA ++S+F ++G+   PGL   D++T+ +IE YL+FKMGEVW EI+ ELE E+IRP++PD E L  I++ +++    V+  Q +L+   K+QD +EE E Y  ++ENHRQ+EK  + F +F+ RTS+Y  LK A  ++ S  +      T  +DKS         +     +N  K+  ++I I+
Sbjct:   28 ESKNMQTLKHIPVSVAKTHKLICDKHSRGLAERHARAVHRLTKHFNRGFV---SFN---------ERQERTYWF--------------PFLKEKSSDEALYAEAIISLLTE--------------------------------MDCQVPNP-QFIKSQIEKSGIARSLVECLEFLQDLETRLEVMRVLQHYSC--SALNCDDMLSVSGAGLICSSLNLPDPSGRLVFLSVEILWNLLEQGSKQVVSDQLNCKECIGALKDGFLKQIKEGYSHADRQLRNDLLVISSLVASCCADAPFVETGFTKVLVLFATFTEVKSHNPLVRNFKLYQNHEDFELKKLLMNTLILLSHDCTASQIMSEGRVLLSLLEYVKPNDN------------------LSSPDWSPAQFEELQLQALDTLCTIGPLCIEDYMTCQGNTRLLMLLEWCVG-QADYGGHGNSYHGSGGRGNKRAQMRFVLRLLRSMVSVGDEGVNQDCIDQGAIHQLVGILLNASTSPDDNDVIDIEMQCDMLIIVSTLCEGDIHRKAAIPIDVDSTYRPLSLLLLLGPPGRYPYCCYWDLQVAIPIDVDGTSRPLSLLMLMELFGVSGVQVVIEYLKKDPSKINSPLGHHKLLLATVDCIWSAVLGSFITEQVFLESEGIFYLLDLLEVCPSTMQHLVLGCLVDLCENQKVLPHVLAWRG------KQEITVSK----------LLVNLWKKEEASMGVLRDSTGAIADPKKPLEG---RLQERQGVIPLPADRPSQSIVDVSENMRAKIFSMFCKIGFNALPGLSTADYVTIALIEKYLDFKMGEVWQEIKVELEQENIRPVTPDAECLNEITKLLDERANDVAAAQVQLMQTQKNQDLIEEEEQYEMIKENHRQEEKAYRDFCDFVTRTSDYTVLKGAGSYDSSRKLAGHGKLTLVRDKSVCRRMALQFENRYGKVNKGKYVGKSIKIS 893          
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Medaka
Match: ENSORLT00000009673.2 (cilia and flagella associated protein 69 [Source:NCBI gene;Acc:101159518])

HSP 1 Score: 372.859 bits (956), Expect = 3.333e-113
Identity = 275/937 (29.35%), Postives = 478/937 (51.01%), Query Frame = 3
Query:  117 VNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLY---------------TKQSVKSGLDSAVPSDLN---------YIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLIS-----SKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQD 2840
             +   + +PV+ +      S TE    +  +L K+I LL  P ++ L ERHL  +KKL   + NGF +++   ++++L IC  + +  P+ YL  + E L++C  PFLKE++SD L Y +   D +S +GY  R+ + +VRL V +S+   Y               TK   ++ L  +  S  +         Y   ++E SD+   L+ S + +EN   LK  L   L+ L+  S   C  IL     +     +   D S  +L  S  I+ NL+  G++ +++ Q ++L+ +  L+++F   L       D QLRND+L++ T++A+ NPN+  +E+   +Q+    T  E KS +    NL +   +E+F++KK+L+N+L+ LS + + + + ED +++L+L + + P G     L ++         Q  +  W    QEELQL AL +LT + P ML  +    G N LL+L++WC+     +     SFHA  G+ NK   M  C+R++  +     E VNQ+  D+G I+ L++IL  +      +  + +EI  D+  +L+ LCE D HRKELFG  G  +AI FL+         F +             G  KL+++  D +W+ I+GCY  E  FL++ G F++LD+L   P  ++  +L  ++DL +N   L HL +WR    +   + L+       +D  V  N                      +  ++D   PL+   Q L  S     +N+ S +++E++E+LRA +Y +F  LG+ + PGL  +D++TL+I++ YL+FK+GEVW EI +E+  E++   S D EAL  I +  E    RV + Q  +++  + +D   E  FY +++ + +Q+    + +  ++ RTS+Y+ LK  K ++    +++R   K+++
Sbjct:    7 ADGRKRDVPVISHG----GSQTEVSA-RSSELHKVISLLEDPLTANLKERHLFVLKKLLNKNNNGFLLRELTGIARVLQICTQKVNEHPE-YLLILCEALKLCRLPFLKERASDELDYAQDVTDFLSHLGYLMRVCDAEVRLNVIESVKSFYSCVPFNHQLDSMDNPTKPKSQTRLSKSCFSKYSLRFQQTSPGYRLKLLELSDLPRTLLLSMAALENQPALKPQLLRTLQTLSNSSDANCASILHARGAETICLHMNEPDPSGQVLPLSSEILCNLLGRGNKEEVSTQLSSLDCVLSLKEAFSYILQSASQQSDLQLRNDLLMIITVVAE-NPNSALMESLLAQQLVHFITLPEEKSPSCGAHNLGLTYKNENFKMKKMLLNLLIPLSKDLTALQLYEDERVMLSLLMLVRPPG----VLSEH---------QPGSCHWSSIRQEELQLQALVTLTAIAPLMLNDYMSYQGNNYLLLLLDWCVESGASYF-QSQSFHAREGKRNKKTLMLHCIRVLQSVTFQGVEFVNQDLCDQGAIHQLLEILMQMEARTYEDDEVAVEIMSDIQLLLSTLCETDLHRKELFGLQGAEMAIQFLRK----GSSKFYS-----------GLGHNKLLLSTVDCVWSGIVGCYQIEDYFLEKEGVFLLLDLLSTSPRCVHGVVLSTVLDLCDNPNTLPHLLSWRDGTGQTAPRLLLQLWREEEEDLGVSRN---------------------RHGGIVDPQRPLLNCFQ-LNESGLTFSSNKASLAVMEVSENLRAKIYFIFYYLGFQELPGLSTEDYVTLSIVKRYLDFKVGEVWEEISREVRRENVWLFSYDEEALTNICKASEDTARRVVEEQNHILEQRQKEDIRRETHFYTEIKSHRKQEALMAKSWDSYVSRTSSYKVLKEVKAHRESYSESTRPKVKDEE 885          
BLAST of cilia- and flagella-associated protein 69 vs. Planmine SMEST
Match: SMESG000047535.1 (SMESG000047535.1)

HSP 1 Score: 1867.82 bits (4837), Expect = 0.000e+0
Identity = 974/985 (98.88%), Postives = 975/985 (98.98%), Query Frame = 3
Query:   42 MALIKSIQNYNFPNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGGTQGAMEKFGILHSDSLR 2996
            MALIKSIQNYN PNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSLELKLALFNLLELLTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFELKKLLINILVLLSDNKSIIPIIEDGQLLLALFIN HPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCINLLIDILNNVLKSNDSNSSIDLEIQCDMLFILAAL        +LFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCRIWREEELRIEVERGEYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGGTQGAMEKFGILHSDSLR
Sbjct:    1 MALIKSIQNYNLPNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSLELKLALFNLLELLTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFELKKLLINILVLLSDNKSIIPIIEDGQLLLALFINFHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCINLLIDILNNVLKSNDSNSSIDLEIQCDMLFILAAL-------SKLFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCRIWREEELRIEVERGEYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGGTQGAMEKFGILHSDSLR 978          
BLAST of cilia- and flagella-associated protein 69 vs. Planmine SMEST
Match: SMESG000047535.1 (SMESG000047535.1)

HSP 1 Score: 1100.12 bits (2844), Expect = 0.000e+0
Identity = 579/581 (99.66%), Postives = 579/581 (99.66%), Query Frame = 3
Query:   42 MALIKSIQNYNFPNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHR 1784
            MALIKSIQNYN PNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSLELKLALFNLLELLTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFELKKLLINILVLLSDNKSIIPIIEDGQLLLALFIN HPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCINLLIDILNNVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHR
Sbjct:    1 MALIKSIQNYNLPNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSLELKLALFNLLELLTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFELKKLLINILVLLSDNKSIIPIIEDGQLLLALFINFHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCINLLIDILNNVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHR 581          

HSP 2 Score: 797.734 bits (2059), Expect = 0.000e+0
Identity = 402/403 (99.75%), Postives = 403/403 (100.00%), Query Frame = 3
Query: 1788 ELFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGGTQGAMEKFGILHSDSLR 2996
            +LFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCRIWREEELRIEVERGEYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGGTQGAMEKFGILHSDSLR
Sbjct:  641 KLFGHDGVVVAIGFLKNCLKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLFLDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCRIWREEELRIEVERGEYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGGTQGAMEKFGILHSDSLR 1043          
BLAST of cilia- and flagella-associated protein 69 vs. Planmine SMEST
Match: SMESG000047535.1 (SMESG000047535.1)

HSP 1 Score: 1097.42 bits (2837), Expect = 0.000e+0
Identity = 580/585 (99.15%), Postives = 580/585 (99.15%), Query Frame = 3
Query:   42 MALIKSIQNYNFPNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELF 1796
            MALIKSIQNYN PNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSLELKLALFNLLELLTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFELKKLLINILVLLSDNKSIIPIIEDGQLLLALFIN HPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCINLLIDILNNVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHR   F
Sbjct:    1 MALIKSIQNYNLPNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSLELKLALFNLLELLTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFELKKLLINILVLLSDNKSIIPIIEDGQLLLALFINFHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCINLLIDILNNVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHRSYPF 585          
BLAST of cilia- and flagella-associated protein 69 vs. Planmine SMEST
Match: SMESG000047535.1 (SMESG000047535.1)

HSP 1 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 579/581 (99.66%), Postives = 579/581 (99.66%), Query Frame = 3
Query:   42 MALIKSIQNYNFPNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSXXXXXXXXXXXXXXTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFEXXXXXXXXXXXXSDNKSIIPIIEDGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCXXXXXXXXXXVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHR 1784
            MALIKSIQNYN PNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSLELKLALFNLLELLTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFELKKLLINILVLLSDNKSIIPIIEDGQLLLALFIN HPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCINLLIDILNNVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHR
Sbjct:    1 MALIKSIQNYNLPNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEERIHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVSKLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDLVSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSVVEQSDVSEILIQSFSVIENSLELKLALFNLLELLTKHSKECCNKILSLDSVKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWLRDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITLLATFQEIKSHNPLVKNLKMALNHEDFELKKLLINILVLLSDNKSIIPIIEDGQLLLALFINFHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQLHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHAVGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCINLLIDILNNVLKSNDSNSSIDLEIQCDMLFILAALCEKDPHR 581          
BLAST of cilia- and flagella-associated protein 69 vs. Planmine SMEST
Match: SMESG000047535.1 (SMESG000047535.1)

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 328/328 (100.00%), Postives = 328/328 (100.00%), Query Frame = 3
Query: 2013 MILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCXXXXXXXXXXXXXXXXYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGGTQGAMEKFGILHSDSLR 2996
            MILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCRIWREEELRIEVERGEYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGGTQGAMEKFGILHSDSLR
Sbjct:    1 MILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILKDNKQHLISSKDTQVQANIAHLLCRIWREEELRIEVERGEYSTLLDVNYPLMGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLKIDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRCIEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQEFIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTKFCAETIHINSTPIQILGGTQGAMEKFGILHSDSLR 328          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFAP698.326e-15934.06cilia and flagella associated protein 69 [Source:H... [more]
CFAP696.127e-15333.93cilia and flagella associated protein 69 [Source:H... [more]
CFAP694.824e-4438.00cilia and flagella associated protein 69 [Source:H... [more]
CFAP691.702e-4339.73cilia and flagella associated protein 69 [Source:H... [more]
CFAP697.383e-2127.46cilia and flagella associated protein 69 [Source:H... [more]
back to top
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CFAP690.000e+038.58cilia and flagella associated protein 69 [Source:N... [more]
CFAP694.828e-16636.72cilia and flagella associated protein 69 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfap693.840e-15233.58cilia and flagella associated protein 69 [Source:M... [more]
Cfap694.130e-10634.43cilia and flagella associated protein 69 [Source:M... [more]
Cfap695.303e-8034.32cilia and flagella associated protein 69 [Source:M... [more]
Cfap692.666e-4637.60cilia and flagella associated protein 69 [Source:M... [more]
Cfap697.107e-4235.98cilia and flagella associated protein 69 [Source:M... [more]
back to top
BLAST of cilia- and flagella-associated protein 69 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|B0CM26|CFA69_PAPAN6.919e-16334.48Cilia- and flagella-associated protein 69 OS=Papio... [more]
sp|A5D8W1|CFA69_HUMAN3.999e-15834.06Cilia- and flagella-associated protein 69 OS=Homo ... [more]
sp|B0VXE6|CFA69_CALJA2.244e-15734.34Cilia- and flagella-associated protein 69 OS=Calli... [more]
sp|Q8BH53|CFA69_MOUSE2.686e-15133.58Cilia- and flagella-associated protein 69 OS=Mus m... [more]
back to top
BLAST of cilia- and flagella-associated protein 69 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210R3M70.000e+042.72Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A1S3JLC20.000e+041.74cilia- and flagella-associated protein 69 OS=Lingu... [more]
A0A3S0ZS660.000e+044.03Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A2C9K4R40.000e+043.86Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9K4S30.000e+043.42Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CFAP692.566e-17937.07cilia and flagella associated protein 69 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CFAP691.667e-10834.56cilia and flagella associated protein 69 [Source:H... [more]
back to top
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO447422.489e-15334.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cilia- and flagella-associated protein 69 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000009673.23.333e-11329.35cilia and flagella associated protein 69 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 69 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047535.10.000e+098.88SMESG000047535.1[more]
SMESG000047535.10.000e+099.66SMESG000047535.1[more]
SMESG000047535.10.000e+099.15SMESG000047535.1[more]
SMESG000047535.10.000e+099.66SMESG000047535.1[more]
SMESG000047535.10.000e+0100.00SMESG000047535.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007581 ID=SMED30007581|Name=cilia- and flagella-associated protein 69|organism=Schmidtea mediterranea sexual|type=transcript|length=3077bp
ATATAAATCTTATATGAAAATATTAGAAGAATTTTATCAATATGGCTTTA
ATTAAAAGTATACAAAATTATAATTTTCCAAATTCTTTTCTTGAGAATCA
AACATTTTCAATTGATGTTAATTCCAATCATAAAACAATTCCAGTTGTTC
ATTATTCATTATTTAAAGAAGATTCAAATACGGAAGAAAGAATACACAAA
TATGTTGATTTAGAAAAGATTATTCGTTTATTATCACATCCTCATTCGTC
AACACTATATGAACGTCATTTATTGGCAATGAAAAAACTTACTAAACATT
CTAAAAACGGATTTTTTATGAAAGATGCATTGAACGTGAGCAAATTGTTA
AACATTTGTGCCGATCGCAGTTCTGCTTTGCCAAAGTTTTATTTGGAACC
GATCATTGAAATTCTGCAAATATGCTCCAAACCATTTCTAAAAGAGAAAT
CATCAGATATTTTGATTTACCATAAAATTTATGTTGATCTGGTCTCACAA
ATCGGTTACGCTTTCCGATTGGATAACCTCGATGTGAGGCTTCAAGTGTG
CAAGTCCCTTTATGATTTATACACCAAGCAATCCGTGAAAAGCGGACTCG
ATAGCGCGGTTCCAAGCGACCTAAACTATATTAGGTCTGTAGTAGAACAA
AGTGACGTATCGGAAATATTGATACAATCATTTTCTGTCATTGAAAATTC
ACTGGAACTCAAATTGGCTTTATTTAACCTCCTGGAATTGTTAACTAAAC
ATTCAAAGGAATGTTGCAATAAAATTCTGAGCTTAGACAGTGTGAAATAT
TGTTACACAGTTATTGGTAATTCTGACAGTTCAAACAATTTGCTTTTCCG
TTCTGTGAATATTGTGTGGAATCTAATGGAAAATGGTGATGAAAACAAAC
TAAATGAACAATTCAACACATTGGAATTTATATGCTGGCTAAGGGACTCA
TTTATCAGTCAACTGTCGAAAGGTTATTCGTCTTATGATCGGCAGTTGCG
AAACGATATTCTAGTTCTGGCGACCTTATTGGCGAAAACCAATCCGAATG
CTCCATTTGTGGAGACAGGTTTTGTTAAACAGATTACATTATTAGCTACC
TTTCAAGAAATAAAAAGTCACAATCCGCTTGTTAAGAATTTAAAAATGGC
TTTGAATCATGAAGATTTTGAATTGAAAAAGTTGCTCATCAATATACTTG
TTCTGTTAAGTGATAATAAATCAATAATACCGATAATTGAAGATGGACAA
TTATTGCTGGCACTTTTTATCAATATTCATCCCATGGGAAATGGCGAAAA
CTTTCTCGGAAAAAATTCCGATACAAAATATTCTAAACTCAATCAAATAT
CAACTTCGGTTTGGAAGCCAGCATATCAAGAAGAACTGCAACTGCATGCT
CTTTCATCTTTAACAATATTGATACCGAAAATGTTGGGAAAATTCCAGGA
CTTGTGTGGAGTCAATAGACTACTAATGCTGGTTGAATGGTGTATCAATG
ACGATGTTCACTTTTCCGGAAATGGCAACAGTTTCCACGCTGTCGGCGGT
CGGGGCAACAAATTGGCTCAAATGAGATTTTGCATGAGACTGATATTGAA
GATAGTTCGGGTTAATGATGAATTAGTAAATCAAGAATTTGTCGACGAAG
GCTGCATAAATTTACTCATCGATATTCTCAACAATGTCCTCAAGAGCAAT
GATTCAAACAGTTCCATAGATTTGGAAATACAATGTGACATGCTTTTCAT
TCTTGCAGCACTGTGTGAAAAAGATCCCCATCGCAAAGAATTATTCGGCC
ATGATGGGGTAGTTGTTGCTATTGGATTCTTAAAGAATTGTTTAAAACTT
GCTTTGAAAAATTTTGTTACTGAACCTACAGCTTTCGAACCAAACCCAGC
CGAAGCAAATGGCTGGCAAAAATTAATCATAGCAGTAACGGACGCGATTT
GGGCCTGTATTATAGGCTGTTACGCAACGGAGCACCTATTTCTTGATCAA
AATGGAGCATTTATGATTTTGGATATGCTTGAGATTTTACCAAGTGAATT
ATATCCTCAAATTCTCGGTTGTTTAGTCGATCTTAGTGAAAATGCTAAAG
CTCTCAACCATTTAAGTACATGGAGAGGAACAATTCTCAAAGATAATAAG
CAGCATCTTATATCAAGCAAAGATACTCAAGTTCAAGCAAATATAGCACA
TTTACTATGTAGAATTTGGAGAGAAGAGGAACTTAGGATTGAAGTAGAAA
GAGGAGAATATTCCACATTATTAGATGTAAATTATCCTTTAATGGGCTCC
GAACAGAAATTAGAAGTTTCAGACGGATATTTAGAGGCCAATCAACTCAG
TCGATCAATTTTAGAAATAAATGAAAGTTTAAGAGCCAACTTATATTCGC
TCTTTTCGCGATTAGGATATCTAGATCATCCCGGACTAAAAATTGATGAC
CATATCACCTTAACAATCATTGAAAGTTATTTGGAGTTTAAAATGGGAGA
AGTTTGGACGGAAATTCAGAAGGAGCTAGAGGGTGAACATATTAGACCGA
TCTCTCCCGACGTGGAAGCATTGGAATGGATATCTCGATGCATTGAACAA
GAAGGGGTTAGAGTGAGTAAAATACAAGAAGAATTAATTGATGCGATGAA
ATCTCAAGACAAAATGGAAGAACTAGAATTTTATAATCAACTGCGAGAAA
ATCATAGACAAAAAGAAAAAAATATTCAACATTTTCAAGAATTCATTGAA
AGAACATCAAATTATGAGAAACTGAAGATGGCCAAGCACAACCAATCCAT
CAACATCGATGCTTCAAGAATAACCACAAAGAACCAAGATAAATCAACAG
TGTTCCACAAAACAGATATTGACAACATCAATGTCACGAAATTTTGCGCT
GAAACGATACATATCAACTCTACTCCCATTCAAATTTTGGGTGGCACCCA
AGGAGCAATGGAGAAATTTGGAATTCTCCATTCTGACAGTCTGAGATAAA
TAATTCAAACAGTTTTTCAAGCGTGAACAAAAAATAATGAAATCAATTAA
AATTTTTTATTTATATTTTAATACAAC
back to top

protein sequence of SMED30007581-orf-1

>SMED30007581-orf-1 ID=SMED30007581-orf-1|Name=SMED30007581-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=986bp
MALIKSIQNYNFPNSFLENQTFSIDVNSNHKTIPVVHYSLFKEDSNTEER
IHKYVDLEKIIRLLSHPHSSTLYERHLLAMKKLTKHSKNGFFMKDALNVS
KLLNICADRSSALPKFYLEPIIEILQICSKPFLKEKSSDILIYHKIYVDL
VSQIGYAFRLDNLDVRLQVCKSLYDLYTKQSVKSGLDSAVPSDLNYIRSV
VEQSDVSEILIQSFSVIENSLELKLALFNLLELLTKHSKECCNKILSLDS
VKYCYTVIGNSDSSNNLLFRSVNIVWNLMENGDENKLNEQFNTLEFICWL
RDSFISQLSKGYSSYDRQLRNDILVLATLLAKTNPNAPFVETGFVKQITL
LATFQEIKSHNPLVKNLKMALNHEDFELKKLLINILVLLSDNKSIIPIIE
DGQLLLALFINIHPMGNGENFLGKNSDTKYSKLNQISTSVWKPAYQEELQ
LHALSSLTILIPKMLGKFQDLCGVNRLLMLVEWCINDDVHFSGNGNSFHA
VGGRGNKLAQMRFCMRLILKIVRVNDELVNQEFVDEGCINLLIDILNNVL
KSNDSNSSIDLEIQCDMLFILAALCEKDPHRKELFGHDGVVVAIGFLKNC
LKLALKNFVTEPTAFEPNPAEANGWQKLIIAVTDAIWACIIGCYATEHLF
LDQNGAFMILDMLEILPSELYPQILGCLVDLSENAKALNHLSTWRGTILK
DNKQHLISSKDTQVQANIAHLLCRIWREEELRIEVERGEYSTLLDVNYPL
MGSEQKLEVSDGYLEANQLSRSILEINESLRANLYSLFSRLGYLDHPGLK
IDDHITLTIIESYLEFKMGEVWTEIQKELEGEHIRPISPDVEALEWISRC
IEQEGVRVSKIQEELIDAMKSQDKMEELEFYNQLRENHRQKEKNIQHFQE
FIERTSNYEKLKMAKHNQSINIDASRITTKNQDKSTVFHKTDIDNINVTK
FCAETIHINSTPIQILGGTQGAMEKFGILHSDSLR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium