Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase

Overview
NameDol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase
Smed IDSMED30007572
Length (bp)1300
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase (SMED30007572) t-SNE clustered cells

Violin plots show distribution of expression levels for Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase (SMED30007572) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase (SMED30007572) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase (SMED30007572) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007572

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30007572h1SMcG0014512 dd_Smed_v4_10223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Human
Match: ALG3 (ALG3 alpha-1,3- mannosyltransferase [Source:HGNC Symbol;Acc:HGNC:23056])

HSP 1 Score: 320.472 bits (820), Expect = 8.044e-106
Identity = 181/343 (52.77%), Postives = 237/343 (69.10%), Query Frame = 1
Query:  184 KNTEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXR-----------KFMRNQSLKSISVTANKTN-LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPN--ISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            ++TEIDW AYM EVEG INGT DY +LQG TGPLVYPAGFVY +  LY+ T +GT+I  AQ IF   Y+ TL L+F IY+Q   +P +VF FMCC SYR+HSI++LRLFNDP+AM+ L+ +IN  ++ R+ WG   FS+ VS+KMN+LLFAPGLL + L   GF   +  L  C  +Q+VLG+PFL+ N + YL+R+F+  RQFL+ WTVNWR +PE+ FL+R FHL LL  HL LLL+                +R+ S + +       N +   +F SNFIGI  SRSLHYQFY+WY+HTLP +LW++P   ++ + RLL++GLIEL WNTYPST  SS 
Sbjct:   25 EDTEIDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIRMAQNIFAVLYLATLLLVFLIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMVLLFLSINLLLAQRWGWGCCFFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLGICAGLQVVLGLPFLLENPSGYLSRSFDLGRQFLFHWTVNWRFLPEALFLHRAFHLALLTAHLTLLLLFALCRWHRTGESILSLLRDPSKRKVPPQPLTPNQIVSTLFTSNFIGICFSRSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSCSSA 367          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Human
Match: ALG3 (ALG3 alpha-1,3- mannosyltransferase [Source:HGNC Symbol;Acc:HGNC:23056])

HSP 1 Score: 320.087 bits (819), Expect = 9.019e-106
Identity = 181/342 (52.92%), Postives = 236/342 (69.01%), Query Frame = 1
Query:  187 NTEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXR-----------KFMRNQSLKSISVTANKTN-LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPN--ISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            +TEIDW AYM EVEG INGT DY +LQG TGPLVYPAGFVY +  LY+ T +GT+I  AQ IF   Y+ TL L+F IY+Q   +P +VF FMCC SYR+HSI++LRLFNDP+AM+ L+ +IN  ++ R+ WG   FS+ VS+KMN+LLFAPGLL + L   GF   +  L  C  +Q+VLG+PFL+ N + YL+R+F+  RQFL+ WTVNWR +PE+ FL+R FHL LL  HL LLL+                +R+ S + +       N +   +F SNFIGI  SRSLHYQFY+WY+HTLP +LW++P   ++ + RLL++GLIEL WNTYPST  SS 
Sbjct:   18 DTEIDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIRMAQNIFAVLYLATLLLVFLIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMVLLFLSINLLLAQRWGWGCCFFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLGICAGLQVVLGLPFLLENPSGYLSRSFDLGRQFLFHWTVNWRFLPEALFLHRAFHLALLTAHLTLLLLFALCRWHRTGESILSLLRDPSKRKVPPQPLTPNQIVSTLFTSNFIGICFSRSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSCSSA 359          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Human
Match: ALG3 (ALG3 alpha-1,3- mannosyltransferase [Source:HGNC Symbol;Acc:HGNC:23056])

HSP 1 Score: 319.316 bits (817), Expect = 8.261e-105
Identity = 181/341 (53.08%), Postives = 235/341 (68.91%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXR-----------KFMRNQSLKSISVTANKTN-LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPN--ISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            TEIDW AYM EVEG INGT DY +LQG TGPLVYPAGFVY +  LY+ T +GT+I  AQ IF   Y+ TL L+F IY+Q   +P +VF FMCC SYR+HSI++LRLFNDP+AM+ L+ +IN  ++ R+ WG   FS+ VS+KMN+LLFAPGLL + L   GF   +  L  C  +Q+VLG+PFL+ N + YL+R+F+  RQFL+ WTVNWR +PE+ FL+R FHL LL  HL LLL+                +R+ S + +       N +   +F SNFIGI  SRSLHYQFY+WY+HTLP +LW++P   ++ + RLL++GLIEL WNTYPST  SS 
Sbjct:   67 TEIDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIRMAQNIFAVLYLATLLLVFLIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMVLLFLSINLLLAQRWGWGCCFFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLGICAGLQVVLGLPFLLENPSGYLSRSFDLGRQFLFHWTVNWRFLPEALFLHRAFHLALLTAHLTLLLLFALCRWHRTGESILSLLRDPSKRKVPPQPLTPNQIVSTLFTSNFIGICFSRSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSCSSA 407          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Human
Match: ALG3 (ALG3 alpha-1,3- mannosyltransferase [Source:HGNC Symbol;Acc:HGNC:23056])

HSP 1 Score: 219.164 bits (557), Expect = 1.869e-67
Identity = 130/261 (49.81%), Postives = 176/261 (67.43%), Query Frame = 1
Query:  430 THIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXR-----------KFMRNQSLKSISVTANKTN-LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPN--ISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
              +P +VF FMCC SYR+HSI++LRLFNDP+AM+ L+ +IN  ++ R+ WG   FS+ VS+KMN+LLFAPGLL + L   GF   +  L  C  +Q+VLG+PFL+ N + YL+R+F+  RQFL+ WTVNWR +PE+ FL+R FHL LL  HL LLL+                +R+ S + +       N +   +F SNFIGI  SRSLHYQFY+WY+HTLP +LW++P   ++ + RLL++GLIEL WNTYPST  SS 
Sbjct:   51 AEVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMVLLFLSINLLLAQRWGWGCCFFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLGICAGLQVVLGLPFLLENPSGYLSRSFDLGRQFLFHWTVNWRFLPEALFLHRAFHLALLTAHLTLLLLFALCRWHRTGESILSLLRDPSKRKVPPQPLTPNQIVSTLFTSNFIGICFSRSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSCSSA 311          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Celegans
Match: algn-3 (pep chromosome:WBcel235:II:14127687:14132833:-1 gene:WBGene00010720.1 transcript:K09E4.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:algn-3)

HSP 1 Score: 278.1 bits (710), Expect = 5.490e-87
Identity = 152/349 (43.55%), Postives = 216/349 (61.89%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFIN-GTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXRK--FMRNQSLKS---------ISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILW-SLPNISSI---------WRLLIMGLIELCWNTYPSTIYSSG 1170
            TEIDW  YMQ+VE ++N G L+Y ++ G TGP VYPAG ++ +  L++ T  G NI  AQ IF GFY+  L ++FRI ++   IP  V + +  T YRIHSI++LRLFNDP+AMM  Y A++ F+  ++  G + +S+ VSIKMN+LLFAP L    L N  +  T+G+L+ CG +QL +G PFL+++   YL ++F+  R F++KWTVNWR +PE FFL++ FH  LL  HL  L V      F R   L++         I+ T            SN IGIA SRSLHYQFY WY+H +P +L+   P+++S+         W++ ++  +EL WN YPST +SS 
Sbjct:   45 TEIDWSTYMQQVECYVNKGILNYTQIGGDTGPCVYPAGHLFVFRLLHFFTSSGRNIRAAQHIFQGFYMFNLFMVFRILHKTMRIPPIVLLLVSITGYRIHSIFVLRLFNDPLAMMLFYVAMDRFLEQKWLVGCVFYSLAVSIKMNVLLFAPALFFTLLLNNSYMATLGYLTVCGLIQLYVGGPFLLYDWKSYLQQSFDLGRVFMFKWTVNWRFLPEEFFLDKRFHAALLVGHLTFLAVFASYMWFRRLNGLRTSVYLRLFEGITTTTGAVETYYAFCTSNLIGIAFSRSLHYQFYSWYFHQIPFLLFCDYPHVASVSTIPWRQFLWKVPLLAAVELSWNVYPSTWWSSA 393          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Celegans
Match: algn-3 (pep chromosome:WBcel235:II:14127687:14131752:-1 gene:WBGene00010720.1 transcript:K09E4.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:algn-3)

HSP 1 Score: 263.848 bits (673), Expect = 4.512e-82
Identity = 146/341 (42.82%), Postives = 210/341 (61.58%), Query Frame = 1
Query:  214 MQEVEGFIN-GTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXRK--FMRNQSLKS---------ISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILW-SLPNISSI---------WRLLIMGLIELCWNTYPSTIYSSG 1170
            MQ+VE ++N G L+Y ++ G TGP VYPAG ++ +  L++ T  G NI  AQ IF GFY+  L ++FRI ++   IP  V + +  T YRIHSI++LRLFNDP+AMM  Y A++ F+  ++  G + +S+ VSIKMN+LLFAP L    L N  +  T+G+L+ CG +QL +G PFL+++   YL ++F+  R F++KWTVNWR +PE FFL++ FH  LL  HL  L V      F R   L++         I+ T            SN IGIA SRSLHYQFY WY+H +P +L+   P+++S+         W++ ++  +EL WN YPST +SS 
Sbjct:    1 MQQVECYVNKGILNYTQIGGDTGPCVYPAGHLFVFRLLHFFTSSGRNIRAAQHIFQGFYMFNLFMVFRILHKTMRIPPIVLLLVSITGYRIHSIFVLRLFNDPLAMMLFYVAMDRFLEQKWLVGCVFYSLAVSIKMNVLLFAPALFFTLLLNNSYMATLGYLTVCGLIQLYVGGPFLLYDWKSYLQQSFDLGRVFMFKWTVNWRFLPEEFFLDKRFHAALLVGHLTFLAVFASYMWFRRLNGLRTSVYLRLFEGITTTTGAVETYYAFCTSNLIGIAFSRSLHYQFYSWYFHQIPFLLFCDYPHVASVSTIPWRQFLWKVPLLAAVELSWNVYPSTWWSSA 341          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Fly
Match: Alg3 (gene:FBgn0011297 transcript:FBtr0072095)

HSP 1 Score: 238.81 bits (608), Expect = 3.856e-73
Identity = 125/232 (53.88%), Postives = 164/232 (70.69%), Query Frame = 1
Query:  163 IVLFYYTKNTEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYF 858
            +V+      TEIDW+AYMQE EGF+NGT +Y  L+G TGPLVYPA FVY YSALY++T  GTN+  AQ+IF G Y++ L L+ R+Y++   +P YV V    TSYRIHSIY+LRLFNDP+A++ LYAA+N F+  R++ GS  FS+ V +KMNILLFAP LLL YL N G   T+  L+ CG +QL+LG PFL+ +  +YL  +F+  R F +KWTVN+R +    F NR F
Sbjct:   61 VVVIQRVPYTEIDWVAYMQECEGFLNGTTNYSLLRGDTGPLVYPAAFVYIYSALYYVTSHGTNVRLAQYIFAGIYLLQLALVLRLYSKSRKVPPYVLVLSAFTSYRIHSIYVLRLFNDPVAVLLLYAALNLFLDRRWTLGSTFFSLAVGVKMNILLFAPALLLFYLANLGLLRTILQLAVCGVIQLLLGAPFLLTHPVEYLRGSFDLGRIFEHKWTVNYRFLSRDLFENRTF 292          

HSP 2 Score: 91.6633 bits (226), Expect = 1.356e-19
Identity = 43/71 (60.56%), Postives = 54/71 (76.06%), Query Frame = 1
Query:  961 TNLALV-MFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            T LAL+  F+ N +G+ACSRSLHYQFY+WY+H+LP + WS P    + R LI+GLIE CWNTYPST +SS 
Sbjct:  402 TQLALLPFFLCNLVGVACSRSLHYQFYVWYFHSLPYLAWSTPYSLGV-RCLILGLIEYCWNTYPSTNFSSA 471          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Zebrafish
Match: alg3 (ALG3 alpha-1,3- mannosyltransferase [Source:ZFIN;Acc:ZDB-GENE-050522-334])

HSP 1 Score: 369.392 bits (947), Expect = 1.075e-124
Identity = 193/340 (56.76%), Postives = 249/340 (73.24%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXX-XXRKFMRNQS-----LKSIS---VTANKTN---LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWS--LPNISSIWRLLIMGLIELCWNTYPSTIYSS 1167
            TEIDW AYM EVEG INGT DY +L+G TGPLVYPAGFVY ++ LY+LTD G NI   Q++F  FY+I L L+ RIY++   +P YVF F+CC SYRIHSI+ILRLFNDP+AMM  + AIN F+  R++ G  L+S+ VS+KMN+LLFAPGLL + L   G W+T+  L+ C  +QLVLG+PFL+ N   Y++RAF+  RQFL+KWTVNWR +PE  FLNRYFHL LL  H+  LL+  ++++ R+ S     LK  S    TA+K N   + L++F SNFIG+  SRSLHYQFY+WY+HTLP +LWS  +  ++ + R+LI+GLIEL WNTYPST YSS
Sbjct:   61 TEIDWKAYMDEVEGVINGTYDYTQLKGDTGPLVYPAGFVYIFTGLYYLTDHGHNIRLGQYVFAVFYLINLLLVMRIYHRTKKVPPYVFFFICCASYRIHSIFILRLFNDPVAMMLCFGAINLFLDGRWTLGCALYSLAVSVKMNVLLFAPGLLFLLLCEFGLWKTLPRLALCAVIQLVLGLPFLLVNPVGYVSRAFDLGRQFLFKWTVNWRFLPEDVFLNRYFHLALLLAHITTLLLFALKRWKRSGSSIWTILKDPSERKETAHKVNADQMVLILFTSNFIGMCFSRSLHYQFYVWYFHTLPYLLWSGGVKKLAHLLRVLILGLIELSWNTYPSTNYSS 400          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Zebrafish
Match: alg3 (ALG3 alpha-1,3- mannosyltransferase [Source:ZFIN;Acc:ZDB-GENE-050522-334])

HSP 1 Score: 118.242 bits (295), Expect = 2.426e-31
Identity = 72/132 (54.55%), Postives = 94/132 (71.21%), Query Frame = 1
Query:  718 LVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXX-XXRKFMRNQS-----LKSIS---VTANKTN---LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWS 1077
            LVLG+PFL+ N   Y++RAF+  RQFL+KWTVNWR +PE  FLNRYFHL LL  H+  LL+  ++++ R+ S     LK  S    TA+K N   + L++F SNFIG+  SRSLHYQFY+WY+HTLP +LWS
Sbjct:    1 LVLGLPFLLVNPVGYVSRAFDLGRQFLFKWTVNWRFLPEDVFLNRYFHLALLLAHITTLLLFALKRWKRSGSSIWTILKDPSERKETAHKVNADQMVLILFTSNFIGMCFSRSLHYQFYVWYFHTLPYLLWS 132          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Xenopus
Match: gcn1 (GCN1, eIF2 alpha kinase activator homolog [Source:Xenbase;Acc:XB-GENE-5926092])

HSP 1 Score: 306.22 bits (783), Expect = 1.027e-99
Identity = 177/346 (51.16%), Postives = 235/346 (67.92%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXX--XXRKFMRNQSL------------KSISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWS-----LPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            TEIDW AYM EVEG +NGT DY +L+G+TGPLVYPAGFVY +S  Y+LT++G+NI  AQ+IF   Y++TL  +FRIY     +P YVF FMCC SYR+HSI++LRLFNDP+AM+ L+ +IN  + + ++     +S+ VS+KMN+LL APGLL + L   G   ++  L  C  +Q++LG+PFL+ N   YL R+F+F RQFL++WTVNWR +PE  F +R FHL LL  HL  LL+  + R     QSL             S  +TANK  +  V+F SNF+G+  SRSLHYQFY+WY+H+LP +LW      LP ++ I   LI+GLIEL WNT+PST  SSG
Sbjct:   69 TEIDWKAYMDEVEGVLNGTYDYTQLKGETGPLVYPAGFVYIFSIFYYLTEQGSNIRLAQYIFAALYLLTLFFVFRIYVVTKKVPPYVFFFMCCASYRVHSIFLLRLFNDPVAMVILFFSINLLLQDHWNSACFFYSLAVSVKMNVLLLAPGLLYLLLCRFGLLHSIPKLCICAVLQVLLGLPFLLENPTGYLIRSFDFGRQFLFQWTVNWRFLPEFVFQHRAFHLALLTAHLATLLLFCVHRWPRSGQSLLALLKDPAQRKPSSHRLTANK--IIFVLFSSNFLGVMFSRSLHYQFYVWYFHSLPYLLWCTGTRILPGLAKI---LILGLIELSWNTFPSTALSSG 409          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Xenopus
Match: gcn1 (GCN1, eIF2 alpha kinase activator homolog [Source:Xenbase;Acc:XB-GENE-5926092])

HSP 1 Score: 304.679 bits (779), Expect = 1.242e-99
Identity = 177/346 (51.16%), Postives = 235/346 (67.92%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXX--XXRKFMRNQSL------------KSISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWS-----LPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            TEIDW AYM EVEG +NGT DY +L+G+TGPLVYPAGFVY +S  Y+LT++G+NI  AQ+IF   Y++TL  +FRIY     +P YVF FMCC SYR+HSI++LRLFNDP+AM+ L+ +IN  + + ++     +S+ VS+KMN+LL APGLL + L   G   ++  L  C  +Q++LG+PFL+ N   YL R+F+F RQFL++WTVNWR +PE  F +R FHL LL  HL  LL+  + R     QSL             S  +TANK  +  V+F SNF+G+  SRSLHYQFY+WY+H+LP +LW      LP ++ I   LI+GLIEL WNT+PST  SSG
Sbjct:   24 TEIDWKAYMDEVEGVLNGTYDYTQLKGETGPLVYPAGFVYIFSIFYYLTEQGSNIRLAQYIFAALYLLTLFFVFRIYVVTKKVPPYVFFFMCCASYRVHSIFLLRLFNDPVAMVILFFSINLLLQDHWNSACFFYSLAVSVKMNVLLLAPGLLYLLLCRFGLLHSIPKLCICAVLQVLLGLPFLLENPTGYLIRSFDFGRQFLFQWTVNWRFLPEFVFQHRAFHLALLTAHLATLLLFCVHRWPRSGQSLLALLKDPAQRKPSSHRLTANK--IIFVLFSSNFLGVMFSRSLHYQFYVWYFHSLPYLLWCTGTRILPGLAKI---LILGLIELSWNTFPSTALSSG 364          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Xenopus
Match: gcn1 (GCN1, eIF2 alpha kinase activator homolog [Source:Xenbase;Acc:XB-GENE-5926092])

HSP 1 Score: 305.449 bits (781), Expect = 1.833e-99
Identity = 177/346 (51.16%), Postives = 235/346 (67.92%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXX--XXRKFMRNQSL------------KSISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWS-----LPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            TEIDW AYM EVEG +NGT DY +L+G+TGPLVYPAGFVY +S  Y+LT++G+NI  AQ+IF   Y++TL  +FRIY     +P YVF FMCC SYR+HSI++LRLFNDP+AM+ L+ +IN  + + ++     +S+ VS+KMN+LL APGLL + L   G   ++  L  C  +Q++LG+PFL+ N   YL R+F+F RQFL++WTVNWR +PE  F +R FHL LL  HL  LL+  + R     QSL             S  +TANK  +  V+F SNF+G+  SRSLHYQFY+WY+H+LP +LW      LP ++ I   LI+GLIEL WNT+PST  SSG
Sbjct:   69 TEIDWKAYMDEVEGVLNGTYDYTQLKGETGPLVYPAGFVYIFSIFYYLTEQGSNIRLAQYIFAALYLLTLFFVFRIYVVTKKVPPYVFFFMCCASYRVHSIFLLRLFNDPVAMVILFFSINLLLQDHWNSACFFYSLAVSVKMNVLLLAPGLLYLLLCRFGLLHSIPKLCICAVLQVLLGLPFLLENPTGYLIRSFDFGRQFLFQWTVNWRFLPEFVFQHRAFHLALLTAHLATLLLFCVHRWPRSGQSLLALLKDPAQRKPSSHRLTANK--IIFVLFSSNFLGVMFSRSLHYQFYVWYFHSLPYLLWCTGTRILPGLAKI---LILGLIELSWNTFPSTALSSG 409          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Xenopus
Match: gcn1 (GCN1, eIF2 alpha kinase activator homolog [Source:Xenbase;Acc:XB-GENE-5926092])

HSP 1 Score: 305.449 bits (781), Expect = 2.047e-99
Identity = 177/346 (51.16%), Postives = 235/346 (67.92%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXX--XXRKFMRNQSL------------KSISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWS-----LPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            TEIDW AYM EVEG +NGT DY +L+G+TGPLVYPAGFVY +S  Y+LT++G+NI  AQ+IF   Y++TL  +FRIY     +P YVF FMCC SYR+HSI++LRLFNDP+AM+ L+ +IN  + + ++     +S+ VS+KMN+LL APGLL + L   G   ++  L  C  +Q++LG+PFL+ N   YL R+F+F RQFL++WTVNWR +PE  F +R FHL LL  HL  LL+  + R     QSL             S  +TANK  +  V+F SNF+G+  SRSLHYQFY+WY+H+LP +LW      LP ++ I   LI+GLIEL WNT+PST  SSG
Sbjct:   69 TEIDWKAYMDEVEGVLNGTYDYTQLKGETGPLVYPAGFVYIFSIFYYLTEQGSNIRLAQYIFAALYLLTLFFVFRIYVVTKKVPPYVFFFMCCASYRVHSIFLLRLFNDPVAMVILFFSINLLLQDHWNSACFFYSLAVSVKMNVLLLAPGLLYLLLCRFGLLHSIPKLCICAVLQVLLGLPFLLENPTGYLIRSFDFGRQFLFQWTVNWRFLPEFVFQHRAFHLALLTAHLATLLLFCVHRWPRSGQSLLALLKDPAQRKPSSHRLTANK--IIFVLFSSNFLGVMFSRSLHYQFYVWYFHSLPYLLWCTGTRILPGLAKI---LILGLIELSWNTFPSTALSSG 409          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Mouse
Match: Alg3 (asparagine-linked glycosylation 3 (alpha-1,3-mannosyltransferase) [Source:MGI Symbol;Acc:MGI:1098592])

HSP 1 Score: 321.242 bits (822), Expect = 1.050e-105
Identity = 182/341 (53.37%), Postives = 245/341 (71.85%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXR-----------KFMRNQSLKSISVTANKTN-LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPN--ISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            TEIDW AYM +VEGFINGT DY +LQG TGPLVYPAGF+Y ++ L++ TD+GT+I  AQ IF   Y++TL L+F IY+Q + +P +VF FMCC SYR+HSI++LRLFNDP+AM  L+ +IN F++  +SWG   FS+ VS+KMN+LLFAPGLL + L   GF   +  L+ C  +Q+VLG+PFL+ N   YL+R+F+  RQFL++WTVNWR +PE+ FL+R FHL LLA HL LLL+                +++ S + +   A   N +  ++F SNFIGI  SRSLHYQFY+WY+HTLP +LW++P   ++ + RLL++GLIEL WNTYPST +SS 
Sbjct:   67 TEIDWKAYMAQVEGFINGTYDYTQLQGDTGPLVYPAGFLYIFTGLFYATDRGTDIPMAQNIFAVLYLVTLVLVFLIYHQTSKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMALLFLSINLFLAQCWSWGCCCFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLAICAALQVVLGLPFLLENPIGYLSRSFDLGRQFLFQWTVNWRFLPETIFLHRAFHLALLAAHLSLLLLFALCRWHRTGESILALLKDPSKRKVPPQALTPNQIVSILFTSNFIGICFSRSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSFSSA 407          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Mouse
Match: Alg3 (asparagine-linked glycosylation 3 (alpha-1,3-mannosyltransferase) [Source:MGI Symbol;Acc:MGI:1098592])

HSP 1 Score: 306.605 bits (784), Expect = 4.709e-101
Identity = 175/333 (52.55%), Postives = 238/333 (71.47%), Query Frame = 1
Query:  214 MQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXR-----------KFMRNQSLKSISVTANKTN-LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPN--ISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            M +VEGFINGT DY +LQG TGPLVYPAGF+Y ++ L++ TD+GT+I  AQ IF   Y++TL L+F IY+Q + +P +VF FMCC SYR+HSI++LRLFNDP+AM  L+ +IN F++  +SWG   FS+ VS+KMN+LLFAPGLL + L   GF   +  L+ C  +Q+VLG+PFL+ N   YL+R+F+  RQFL++WTVNWR +PE+ FL+R FHL LLA HL LLL+                +++ S + +   A   N +  ++F SNFIGI  SRSLHYQFY+WY+HTLP +LW++P   ++ + RLL++GLIEL WNTYPST +SS 
Sbjct:    1 MAQVEGFINGTYDYTQLQGDTGPLVYPAGFLYIFTGLFYATDRGTDIPMAQNIFAVLYLVTLVLVFLIYHQTSKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMALLFLSINLFLAQCWSWGCCCFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLAICAALQVVLGLPFLLENPIGYLSRSFDLGRQFLFQWTVNWRFLPETIFLHRAFHLALLAAHLSLLLLFALCRWHRTGESILALLKDPSKRKVPPQALTPNQIVSILFTSNFIGICFSRSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSFSSA 333          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Mouse
Match: Alg3 (asparagine-linked glycosylation 3 (alpha-1,3-mannosyltransferase) [Source:MGI Symbol;Acc:MGI:1098592])

HSP 1 Score: 236.498 bits (602), Expect = 2.100e-74
Identity = 144/284 (50.70%), Postives = 198/284 (69.72%), Query Frame = 1
Query:  361 AQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXR-----------KFMRNQSLKSISVTANKTN-LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPN--ISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            AQ IF   Y++TL L+F IY+Q + +P +VF FMCC SYR+HSI++LRLFNDP+AM  L+ +IN F++  +SWG   FS+ VS+KMN+LLFAPGLL + L   GF   +  L+ C  +Q+VLG+PFL+ N   YL+R+F+  RQFL++WTVNWR +PE+ FL+R FHL LLA HL LLL+                +++ S + +   A   N +  ++F SNFIGI  SRSLHYQFY+WY+HTLP +LW++P   ++ + RLL++GLIEL WNTYPST +SS 
Sbjct:    2 AQNIFAVLYLVTLVLVFLIYHQTSKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMALLFLSINLFLAQCWSWGCCCFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLAICAALQVVLGLPFLLENPIGYLSRSFDLGRQFLFQWTVNWRFLPETIFLHRAFHLALLAAHLSLLLLFALCRWHRTGESILALLKDPSKRKVPPQALTPNQIVSILFTSNFIGICFSRSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSFSSA 285          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Mouse
Match: Alg3 (asparagine-linked glycosylation 3 (alpha-1,3-mannosyltransferase) [Source:MGI Symbol;Acc:MGI:1098592])

HSP 1 Score: 203.371 bits (516), Expect = 3.172e-62
Identity = 100/176 (56.82%), Postives = 132/176 (75.00%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQ 717
            TEIDW AYM +VEGFINGT DY +LQG TGPLVYPAGF+Y ++ L++ TD+GT+I  AQ IF   Y++TL L+F IY+Q + +P +VF FMCC SYR+HSI++LRLFNDP+AM  L+ +IN F++  +SWG   FS+ VS+KMN+LLFAPGLL + L   GF   +  L+ C  +Q
Sbjct:   67 TEIDWKAYMAQVEGFINGTYDYTQLQGDTGPLVYPAGFLYIFTGLFYATDRGTDIPMAQNIFAVLYLVTLVLVFLIYHQTSKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMALLFLSINLFLAQCWSWGCCCFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLAICAALQ 242          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Mouse
Match: Alg3 (asparagine-linked glycosylation 3 (alpha-1,3-mannosyltransferase) [Source:MGI Symbol;Acc:MGI:1098592])

HSP 1 Score: 179.489 bits (454), Expect = 2.506e-53
Identity = 88/164 (53.66%), Postives = 122/164 (74.39%), Query Frame = 1
Query:  361 AQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNR 852
            AQ IF   Y++TL L+F IY+Q + +P +VF FMCC SYR+HSI++LRLFNDP+AM  L+ +IN F++  +SWG   FS+ VS+KMN+LLFAPGLL + L   GF   +  L+ C  +Q+VLG+PFL+ N   YL+R+F+  RQFL++WTVNWR +PE+ FL+R
Sbjct:    2 AQNIFAVLYLVTLVLVFLIYHQTSKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMALLFLSINLFLAQCWSWGCCCFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLAICAALQVVLGLPFLLENPIGYLSRSFDLGRQFLFQWTVNWRFLPETIFLHR 165          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. UniProt/SwissProt
Match: sp|Q8K2A8|ALG3_MOUSE (Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg3 PE=1 SV=2)

HSP 1 Score: 321.242 bits (822), Expect = 7.341e-105
Identity = 182/341 (53.37%), Postives = 245/341 (71.85%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXR-----------KFMRNQSLKSISVTANKTN-LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPN--ISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            TEIDW AYM +VEGFINGT DY +LQG TGPLVYPAGF+Y ++ L++ TD+GT+I  AQ IF   Y++TL L+F IY+Q + +P +VF FMCC SYR+HSI++LRLFNDP+AM  L+ +IN F++  +SWG   FS+ VS+KMN+LLFAPGLL + L   GF   +  L+ C  +Q+VLG+PFL+ N   YL+R+F+  RQFL++WTVNWR +PE+ FL+R FHL LLA HL LLL+                +++ S + +   A   N +  ++F SNFIGI  SRSLHYQFY+WY+HTLP +LW++P   ++ + RLL++GLIEL WNTYPST +SS 
Sbjct:   67 TEIDWKAYMAQVEGFINGTYDYTQLQGDTGPLVYPAGFLYIFTGLFYATDRGTDIPMAQNIFAVLYLVTLVLVFLIYHQTSKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMALLFLSINLFLAQCWSWGCCCFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLAICAALQVVLGLPFLLENPIGYLSRSFDLGRQFLFQWTVNWRFLPETIFLHRAFHLALLAAHLSLLLLFALCRWHRTGESILALLKDPSKRKVPPQALTPNQIVSILFTSNFIGICFSRSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSFSSA 407          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. UniProt/SwissProt
Match: sp|Q92685|ALG3_HUMAN (Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG3 PE=1 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 3.967e-104
Identity = 181/341 (53.08%), Postives = 235/341 (68.91%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXR-----------KFMRNQSLKSISVTANKTN-LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPN--ISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            TEIDW AYM EVEG INGT DY +LQG TGPLVYPAGFVY +  LY+ T +GT+I  AQ IF   Y+ TL L+F IY+Q   +P +VF FMCC SYR+HSI++LRLFNDP+AM+ L+ +IN  ++ R+ WG   FS+ VS+KMN+LLFAPGLL + L   GF   +  L  C  +Q+VLG+PFL+ N + YL+R+F+  RQFL+ WTVNWR +PE+ FL+R FHL LL  HL LLL+                +R+ S + +       N +   +F SNFIGI  SRSLHYQFY+WY+HTLP +LW++P   ++ + RLL++GLIEL WNTYPST  SS 
Sbjct:   67 TEIDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIRMAQNIFAVLYLATLLLVFLIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMVLLFLSINLLLAQRWGWGCCFFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLGICAGLQVVLGLPFLLENPSGYLSRSFDLGRQFLFHWTVNWRFLPEALFLHRAFHLALLTAHLTLLLLFALCRWHRTGESILSLLRDPSKRKVPPQPLTPNQIVSTLFTSNFIGICFSRSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSCSSA 407          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. UniProt/SwissProt
Match: sp|Q55F69|ALG3_DICDI (Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.701e-89
Identity = 162/375 (43.20%), Postives = 225/375 (60.00%), Query Frame = 1
Query:  166 VLFYYTKNTEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQ------------------------------FTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXRKFMRNQS------LKSISVTANKTNLA-----LVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSS 1167
            ++  Y K TEIDW  Y+Q+VE F+ G  DY K++G TGP VYPAG +Y +S LY LT+ G NIL AQ+IF   Y++   ++F IY +                              F  IP Y+ +F+C  S RIHSI+ LR+FND I+M+  Y ++   +  R++ G + FS  VS+KMN+LL++P LL + L   G W T+  L  CG VQ++L +PFL+ N   YL RAFEF RQFLYKWTVNWR +PE  FLN+ + L LL++HL+ +++   K+++ +       LK  S+  N   L+     L+MF  N IG+  SRSLHYQFY+WY+HTLP +LWS  N +   ++  M + E  WNTYPST  SS
Sbjct:   35 IIIDYVKYTEIDWSTYVQQVEVFLKGIYDYTKIEGDTGPCVYPAGHLYVFSLLYNLTENGLNILKAQYIFAAIYILLTFIVFSIYGESIKESIKQITNKSNNNNNNNNNNNNNNNNVFLKIPFYIIIFLCL-SKRIHSIFALRMFNDCISMLLFYISLYLIIKGRWNLGCLFFSCSVSVKMNVLLYSPALLFLLLSTFGIWRTIPKLMICGLVQVLLAIPFLMVNPQGYLLRAFEFSRQFLYKWTVNWRFLPEHLFLNKSWALFLLSIHLLFIILFFIKYIKKEQGGISNILKRGSINQNPKLLSVNYILLIMFTINLIGVTFSRSLHYQFYLWYFHTLPFLLWS-TNYNLFLKIGFMCITEYAWNTYPSTSTSS 407          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. UniProt/SwissProt
Match: sp|P82149|NT53_DROME (Lethal(2)neighbour of tid protein 2 OS=Drosophila melanogaster OX=7227 GN=l(2)not2 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.569e-72
Identity = 125/232 (53.88%), Postives = 164/232 (70.69%), Query Frame = 1
Query:  163 IVLFYYTKNTEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYF 858
            +V+      TEIDW+AYMQE EGF+NGT +Y  L+G TGPLVYPA FVY YSALY++T  GTN+  AQ+IF G Y++ L L+ R+Y++   +P YV V    TSYRIHSIY+LRLFNDP+A++ LYAA+N F+  R++ GS  FS+ V +KMNILLFAP LLL YL N G   T+  L+ CG +QL+LG PFL+ +  +YL  +F+  R F +KWTVN+R +    F NR F
Sbjct:   61 VVVIQRVPYTEIDWVAYMQECEGFLNGTTNYSLLRGDTGPLVYPAAFVYIYSALYYVTSHGTNVRLAQYIFAGIYLLQLALVLRLYSKSRKVPPYVLVLSAFTSYRIHSIYVLRLFNDPVAVLLLYAALNLFLDRRWTLGSTFFSLAVGVKMNILLFAPALLLFYLANLGLLRTILQLAVCGVIQLLLGAPFLLTHPVEYLRGSFDLGRIFEHKWTVNYRFLSRDVFENRTF 292          

HSP 2 Score: 91.6633 bits (226), Expect = 1.299e-18
Identity = 43/71 (60.56%), Postives = 54/71 (76.06%), Query Frame = 1
Query:  961 TNLALV-MFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            T LAL+  F+ N +G+ACSRSLHYQFY+WY+H+LP + WS P    + R LI+GLIE CWNTYPST +SS 
Sbjct:  402 TQLALLPFFLCNLVGVACSRSLHYQFYVWYFHSLPYLAWSTPYSLGV-RCLILGLIEYCWNTYPSTNFSSA 471          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. UniProt/SwissProt
Match: sp|Q27333|NT56_DROME (Lethal(2)neighbour of tid protein OS=Drosophila melanogaster OX=7227 GN=l(2)not PE=1 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 4.119e-72
Identity = 125/232 (53.88%), Postives = 164/232 (70.69%), Query Frame = 1
Query:  163 IVLFYYTKNTEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYF 858
            +V+      TEIDW+AYMQE EGF+NGT +Y  L+G TGPLVYPA FVY YSALY++T  GTN+  AQ+IF G Y++ L L+ R+Y++   +P YV V    TSYRIHSIY+LRLFNDP+A++ LYAA+N F+  R++ GS  FS+ V +KMNILLFAP LLL YL N G   T+  L+ CG +QL+LG PFL+ +  +YL  +F+  R F +KWTVN+R +    F NR F
Sbjct:   61 VVVIQRVPYTEIDWVAYMQECEGFLNGTTNYSLLRGDTGPLVYPAAFVYIYSALYYVTSHGTNVRLAQYIFAGIYLLQLALVLRLYSKSRKVPPYVLVLSAFTSYRIHSIYVLRLFNDPVAVLLLYAALNLFLDRRWTLGSTFFSLAVGVKMNILLFAPALLLFYLANLGLLRTILQLAVCGVIQLLLGAPFLLTHPVEYLRGSFDLGRIFEHKWTVNYRFLSRDVFENRTF 292          

HSP 2 Score: 91.6633 bits (226), Expect = 1.334e-18
Identity = 43/71 (60.56%), Postives = 54/71 (76.06%), Query Frame = 1
Query:  961 TNLALV-MFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            T LAL+  F+ N +G+ACSRSLHYQFY+WY+H+LP + WS P    + R LI+GLIE CWNTYPST +SS 
Sbjct:  402 TQLALLPFFLCNLVGVACSRSLHYQFYVWYFHSLPYLAWSTPYSLGV-RCLILGLIEYCWNTYPSTNFSSA 471          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. TrEMBL
Match: A0A419QE81 (Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1 OS=Clonorchis sinensis OX=79923 GN=ALG3 PE=4 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 3.088e-128
Identity = 198/339 (58.41%), Postives = 248/339 (73.16%), Query Frame = 1
Query:  184 KNTEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXRK----------FMRNQSLKSISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            ++TEIDWIAYMQEVEGF+NGTLDY+KL+GQTGP VYPAGF+Y Y  LY +T +GT I  AQ+IF+GFY++TL L+F IY     +P YVFVFMC  SYRIHSIY+LRLFNDP+AM+ LY  +N  +  +++   I FS+GVSIKMNILLFAPGL LI L+  G  ET GHL EC  VQLVLG PFL HN   Y++RAF F RQF+YKWTVNWR+IPE  FL+R FH +LL +H   L++L+ K          F++ Q         + + +   MF+SNFIG+  SRSLHYQFY+WY+HT+P +LW+    SS  +LLI GLIE+CWNTYPST++SSG
Sbjct:   14 QDTEIDWIAYMQEVEGFVNGTLDYDKLEGQTGPCVYPAGFLYIYWMLYQITSRGTLIYLAQYIFIGFYLLTLVLVFNIYRLSCQVPPYVFVFMCVISYRIHSIYVLRLFNDPLAMIALYTCVNFLLYGKFTLACIFFSLGVSIKMNILLFAPGLFLILLYYRGILETAGHLCECIIVQLVLGAPFLFHNYEAYISRAFNFGRQFMYKWTVNWRIIPEDVFLDRRFHAVLLGLHTAFLILLLFKWIRYRGGFSEFLKLQIPPDRDPRKDISGIIYPMFLSNFIGVTFSRSLHYQFYVWYFHTIPYLLWTTCLPSSPLKLLIFGLIEVCWNTYPSTVFSSG 352          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. TrEMBL
Match: A0A4V3SEY5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005350 PE=4 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 9.607e-127
Identity = 196/340 (57.65%), Postives = 247/340 (72.65%), Query Frame = 1
Query:  181 TKNTEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXX----------RKFMRNQSLKSISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
             K TEIDWIAYMQEVEGF+NGTLDY+KL+GQTGP VYPAGF+Y Y  LY +T +GT I  AQ+IF+G Y++TL L+F IY     +P YVFVFMC  SYRIHSIY+LRLFNDP+AM+ LYA +N  +  +++   I FS+GVS+KMNILLFAPGL LI L+  G  ET GHL EC  VQLVLG PFL HN   Y++RAF F RQF+YKWTVNWR+IPE  FL+R FH +LL +H   L++L+           +F++ Q         + + +   MF+SNFIG+  SRSLHYQFY+WY+HT+P +LW+    S+  +LLI GLIE+CWNTYPST++SSG
Sbjct:   42 VKYTEIDWIAYMQEVEGFVNGTLDYDKLEGQTGPCVYPAGFLYIYWMLYQITSRGTLIHLAQYIFIGLYLLTLVLVFNIYRLSCQVPPYVFVFMCVISYRIHSIYVLRLFNDPLAMIALYACVNFLLYGKFTLACIFFSLGVSVKMNILLFAPGLFLILLYYRGILETAGHLCECIIVQLVLGAPFLFHNYEAYISRAFNFGRQFMYKWTVNWRIIPEDVFLDRRFHAVLLGLHAAFLIILLFRWIRYRGGFSQFLKLQIPPDRDPRKDMSGVIYPMFLSNFIGVTFSRSLHYQFYVWYFHTIPYLLWTTSLPSNPLKLLIFGLIEVCWNTYPSTVFSSG 381          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. TrEMBL
Match: A0A504YLI2 (Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase OS=Fasciola gigantica OX=46835 GN=FGIG_02728 PE=4 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 3.826e-125
Identity = 190/339 (56.05%), Postives = 250/339 (73.75%), Query Frame = 1
Query:  181 TKNTEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXRKFMRNQ-------SLKSISVTANKTNLALV--MFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
             K TEIDW+AYMQEVE F+NGTLDY++++GQTGP VYPAGF+Y YS LY +T  G NIL +Q+IF+ FY++TL L+F IY   + +P Y  VFMC  SYRIHSIYILRLFNDP+AM+ +YA+IN  +  +++  SIL S+GVSIKMN+LLF PG LL+ L + G  +TVGHL ECG VQLVLG PFL HN   Y+  AF F RQF+Y+WTVNWR+IPE  FL+R FH++L+ +HL  + + + +F+R++       SL     T      +++  +F+ NF+G+A SRSLHYQFY+WY+HTL  +LWS   + +  R L++GLIELCWNTYPST+YSSG
Sbjct:   42 VKYTEIDWVAYMQEVEHFLNGTLDYDQIKGQTGPCVYPAGFLYIYSLLYKITGGGANILLSQYIFMFFYILTLLLVFNIYRISSRVPPYALVFMCIISYRIHSIYILRLFNDPLAMIAVYASINALLYGQFTLASILMSLGVSIKMNVLLFFPGFLLVILLHRGILQTVGHLCECGIVQLVLGAPFLFHNPESYVTSAFNFGRQFMYQWTVNWRIIPEYLFLDRRFHMMLMVLHLFFVALTLFRFIRSRGGLTRFLSLHKPKCTTRPDAASVLYPLFVCNFVGVAFSRSLHYQFYVWYFHTLLYLLWSNGQLPTPVRFLLLGLIELCWNTYPSTVYSSG 380          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. TrEMBL
Match: A0A074ZDK6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_08463 PE=4 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 3.459e-124
Identity = 196/344 (56.98%), Postives = 247/344 (71.80%), Query Frame = 1
Query:  184 KNTEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVY-----PAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXRK----------FMRNQSLKSISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            ++TEIDWIAYMQEVEGF+NGTLDY+KL+GQTGP VY     PAGF+Y Y  LY +T +GT I  AQ+IF+G Y++TL L+F IY     +P YVFVFMC  SYRIHSIY+LRLFNDP+AM+ LYA +N  +  +++   I FS+GVS+KMNILLFAPGL LI L+  G  ET GHL EC  VQLV+G PFL HN   Y++RAF F RQF+YKWTVNWR+IPE  FL+R FH +LL +H   L++L+ K          F+  Q         + + +   MF+SNFIG+  SRSLHYQFY+WY+HT+P +LW+    SS  +LLI GLIE+CWNTYPST++SSG
Sbjct:   58 QDTEIDWIAYMQEVEGFVNGTLDYDKLEGQTGPCVYVRRLYPAGFLYIYWMLYQITSRGTLIHLAQYIFIGLYLLTLVLVFNIYRLSCQVPPYVFVFMCVISYRIHSIYVLRLFNDPLAMIALYACVNFLLYGKFTLACIFFSLGVSVKMNILLFAPGLFLILLYYRGILETAGHLCECIIVQLVVGAPFLFHNYEAYISRAFNFGRQFMYKWTVNWRIIPEDVFLDRRFHAVLLGLHATFLIILLFKWVRYRGGFSEFLELQVPPDRDPRKDMSGVIYPMFISNFIGVTFSRSLHYQFYVWYFHTIPYLLWTTSLPSSPLKLLIFGLIEVCWNTYPSTVFSSG 401          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. TrEMBL
Match: A0A4Z2CND4 (Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase OS=Schistosoma japonicum OX=6182 GN=EWB00_009220 PE=4 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 3.869e-124
Identity = 200/336 (59.52%), Postives = 250/336 (74.40%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXRKFMRNQS-----LKSISVTAN-KTNLALV---MFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            TEIDWIAYMQ+V GF+NGTLDY+KL+GQTGP VYPAG +Y Y+ L+W+TD G+ I  AQF+FLG Y+ITL L+F IY      P Y   FMC  SYRIHSIY+LRLFNDP+AM FLYA+IN F+ NR++  SILFS+GVS+KMNILLF P  L++ +++ G  ET+GHL EC  VQL +G PFL HNS  YL+ AF F RQF+YKWTVNWR +PES FL+R FHL+LL  HL LLL+   KF+R++      L       N K + A V   MF+ NF+G+  SRSLHYQFYIWY+HT+P +LW + + S+  +LLI+GLIE+ WNTYPSTI+SSG
Sbjct:   45 TEIDWIAYMQQVSGFLNGTLDYDKLEGQTGPCVYPAGHLYVYTFLHWITDGGSVIKTAQFVFLGLYIITLMLVFNIYRLSFQAPPYSLFFMCIVSYRIHSIYLLRLFNDPVAMFFLYASINAFLYNRFTVASILFSLGVSVKMNILLFLPAFLIVLVWHKGLLETIGHLCECFVVQLAVGTPFLFHNSWAYLSSAFNFSRQFMYKWTVNWRFLPESIFLDRQFHLILLIFHLCLLLIFFVKFIRSRGGLWNYLCIFDPERNPKFDPAAVLYPMFVCNFVGVVVSRSLHYQFYIWYFHTIPYLLWCVKSFSTPVKLLILGLIEISWNTYPSTIWSSG 380          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Cavefish
Match: alg3 (ALG3 alpha-1,3- mannosyltransferase [Source:NCBI gene;Acc:103037087])

HSP 1 Score: 343.199 bits (879), Expect = 1.052e-114
Identity = 184/340 (54.12%), Postives = 242/340 (71.18%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXX-XXXRKFMRNQS-----------LKSISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWS--LPNISSIWRLLIMGLIELCWNTYPSTIYSS 1167
            TEIDW AYM EVEG INGT DY +L+G TGPLVYPAGFVY ++ALY++TD+G NI   Q++F  FY+ITL L+FRIY++   +P YVF F+CC SYRIHSI++LRLFNDP+AMM L+ A+N F+   ++ G  L+S+ VS+KMN++LFAPGLL + L   G  +T+  L  C  +QL+LG+PFL+ N   Y++RAF+  RQFL+KWTVNWR +PE  FL+RYFHL LL  HL  L+   +R++ R  S            K  +   N   +  V+F SNFIG+   RSLHYQFY+WY+HTLP +LWS  +  ++ + R+LI+GLIEL WNTYPST YSS
Sbjct:   61 TEIDWKAYMDEVEGVINGTYDYTELKGDTGPLVYPAGFVYIFTALYYITDRGLNIRLGQYVFAVFYLITLLLVFRIYHRTKKVPPYVFFFVCCASYRIHSIFVLRLFNDPVAMMLLFGAVNLFLDAHWTLGCALYSLAVSVKMNVMLFAPGLLFLLLSEFGLIKTLPRLMLCAVIQLLLGLPFLLVNPVGYMSRAFDLGRQFLFKWTVNWRFLPEEIFLSRYFHLALLLAHLTTLVFFALRRWKRPGSSIWALLKEPSERKETAQKLNSDQIITVLFTSNFIGMCFCRSLHYQFYVWYFHTLPYLLWSGGVKKLAHLLRVLILGLIELSWNTYPSTNYSS 400          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Cavefish
Match: alg3 (ALG3 alpha-1,3- mannosyltransferase [Source:NCBI gene;Acc:103037087])

HSP 1 Score: 342.043 bits (876), Expect = 4.113e-114
Identity = 184/340 (54.12%), Postives = 242/340 (71.18%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXX-XXXRKFMRNQS-----------LKSISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWS--LPNISSIWRLLIMGLIELCWNTYPSTIYSS 1167
            TEIDW AYM EVEG INGT DY +L+G TGPLVYPAGFVY ++ALY++TD+G NI   Q++F  FY+ITL L+FRIY++   +P YVF F+CC SYRIHSI++LRLFNDP+AMM L+ A+N F+   ++ G  L+S+ VS+KMN++LFAPGLL + L   G  +T+  L  C  +QL+LG+PFL+ N   Y++RAF+  RQFL+KWTVNWR +PE  FL+RYFHL LL  HL  L+   +R++ R  S            K  +   N   +  V+F SNFIG+   RSLHYQFY+WY+HTLP +LWS  +  ++ + R+LI+GLIEL WNTYPST YSS
Sbjct:   61 TEIDWKAYMDEVEGVINGTYDYTELKGDTGPLVYPAGFVYIFTALYYITDRGLNIRLGQYVFAVFYLITLLLVFRIYHRTKKVPPYVFFFVCCASYRIHSIFVLRLFNDPVAMMLLFGAVNLFLDAHWTLGCALYSLAVSVKMNVMLFAPGLLFLLLSEFGLIKTLPRLMLCAVIQLLLGLPFLLVNPVGYMSRAFDLGRQFLFKWTVNWRFLPEEIFLSRYFHLALLLAHLTTLVFFALRRWKRPGSSIWALLKEPSERKETAQKLNSDQIITVLFTSNFIGMCFCRSLHYQFYVWYFHTLPYLLWSGGVKKLAHLLRVLILGLIELSWNTYPSTNYSS 400          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Cavefish
Match: alg3 (ALG3 alpha-1,3- mannosyltransferase [Source:NCBI gene;Acc:103037087])

HSP 1 Score: 339.347 bits (869), Expect = 3.666e-113
Identity = 181/330 (54.85%), Postives = 241/330 (73.03%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXRKFMRNQSLKSISVTANK--TNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWS--LPNISSIWRLLIMGLIELCWNTYPSTIYSS 1167
            TEIDW AYM EVEG INGT DY +L+G TGPLVYPAGFVY ++ALY++TD+G NI   Q++F  FY+ITL L+FRIY++   +P YVF F+CC SYRIHSI++LRLFNDP+AMM L+ A+N F+   ++ G  L+S+ VS+KMN++LFAPGLL + L   G  +T+  L  C  +QL+LG+PFL+ N   Y++RAF+  RQFL+KWTVNWR +PE  FL+RYFHL LL  HL  L+    +  ++ +L  + V      + +  V+F SNFIG+   RSLHYQFY+WY+HTLP +LWS  +  ++ + R+LI+GLIEL WNTYPST YSS
Sbjct:   61 TEIDWKAYMDEVEGVINGTYDYTELKGDTGPLVYPAGFVYIFTALYYITDRGLNIRLGQYVFAVFYLITLLLVFRIYHRTKKVPPYVFFFVCCASYRIHSIFVLRLFNDPVAMMLLFGAVNLFLDAHWTLGCALYSLAVSVKMNVMLFAPGLLFLLLSEFGLIKTLPRLMLCAVIQLLLGLPFLLVNPVGYMSRAFDLGRQFLFKWTVNWRFLPEEIFLSRYFHLALLLAHLTTLVFFALRRWKSHALFLLCVFLFNWLSQIITVLFTSNFIGMCFCRSLHYQFYVWYFHTLPYLLWSGGVKKLAHLLRVLILGLIELSWNTYPSTNYSS 390          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Sea Lamprey
Match: alg3 (ALG3 alpha-1,3- mannosyltransferase [Source:ZFIN;Acc:ZDB-GENE-050522-334])

HSP 1 Score: 286.189 bits (731), Expect = 4.593e-94
Identity = 156/319 (48.90%), Postives = 212/319 (66.46%), Query Frame = 1
Query:  259 KLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXRKFMRNQS------LKSISVTANKTN------LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSI----WRLLIMGLIELCWNTYPSTIYSS 1167
            KLQG TGPLVYPAGFVY YS LY +T++G ++  AQ+IF   Y++TL L+FRIY +   +P Y   FMCC SYR+HSI++LRLFNDP+AM  L+A++N  +  R++ G ++FS+ VS+KMN+LLFAPGLL + L   G    V  L+ C  +Q+VLG+PFL+ N   Y  RAF+  R FL++WTVNWRL+PE  FL+R FH  LLA HL +LL+   +            LK+ +    +        +A V+F SN +G+  +RSLHYQFY+WY+H+LP +LW  P  S       R+L++G+IEL WNTYPST  SS
Sbjct:    2 KLQGGTGPLVYPAGFVYVYSLLYHVTERGADVRRAQYIFAVLYLVTLVLVFRIYARVRRVPPYALFFMCCASYRVHSIFVLRLFNDPVAMAILFASVNLLLDRRWTLGCLVFSLAVSVKMNVLLFAPGLLFVLLRELGPARAVPRLAACAALQVVLGLPFLLANPLGYATRAFDLGRSFLFEWTVNWRLLPEWLFLHRGFHAALLAAHLAVLLLYAHRHWSRPGEGLLGLLKAPTKKKKRDPMTDDHIMAFVLFSSNLVGVCFARSLHYQFYVWYFHSLPFLLWCCPLGSMAPLLRHRVLVLGVIELAWNTYPSTKISS 320          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Yeast
Match: ALG3 (Dolichol-P-Man dependent alpha(1-3) mannosyltransferase; involved in synthesis of dolichol-linked oligosaccharide donor for N-linked glycosylation of proteins; G353A missense mutation in human ortholog ALG3 implicated in carbohydrate deficient glycoprotein syndrome type IV, which is characterized by microcephaly, severe epilepsy, minimal psychomotor development, partial deficiency of sialic acids in serum glycoproteins; wild-type human ALG3 can complement yeast alg3 mutant [Source:SGD;Acc:S000000178])

HSP 1 Score: 179.874 bits (455), Expect = 3.885e-52
Identity = 134/356 (37.64%), Postives = 193/356 (54.21%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGF-INGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAI-------NCFMSNRYSWG-----SILFSIGVSIKMNILLFAPGLL--LIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXX-XRKFMR----------NQSLKSISVTANKTN-LALVMFMSNFIGIACSRSLHYQFYIWYYHTLP-LILWS-LP-NISSIWRLLIMGLIELCWNTYPSTIYSS 1167
            TEID+ AYM+++E   ++G LDY ++ G TGPLVYPAG V  Y  +YWLT+   ++   Q  F   Y++TL L    Y    H+P +  V + C S R+HSIY+LRLFND    +F+   +        C    +         S  +S+ VSIKMN LL+ P ++  L  L +     T+  L      Q+ + +PFL     QYL+ AF F R+F+Y+W++NW+++ E  F ++ FHL LL  HL+ L  L V ++ R          +   K+  + AN    +  V+  SNFIG+  SRSLHYQF  WY+ TLP LI WS +P  +  IW +    L E CWN+YP    +S
Sbjct:   68 TEIDYKAYMEQIEMIQLDGMLDYSQVSGGTGPLVYPAGHVLIYKMMYWLTEGMDHVERGQVFFRYLYLLTLALQMACY-YLLHLPPWCVV-LACLSKRLHSIYVLRLFNDCFTTLFMVVTVLGAIVASRCHQRPKLKKSLALVISATYSMAVSIKMNALLYFPAMMISLFILNDANVILTLLDLVAMIAWQVAVAVPFLRSFPQQYLHCAFNFGRKFMYQWSINWQMMDEEAFNDKRFHLALLISHLIALTTLFVTRYPRILPDLWSSLCHPLRKNAVLNANPAKTIPFVLIASNFIGVLFSRSLHYQFLSWYHWTLPILIFWSGMPFFVGPIWYV----LHEWCWNSYPPNSQAS 417          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Nematostella
Match: EDO46580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ4])

HSP 1 Score: 355.14 bits (910), Expect = 1.803e-120
Identity = 190/340 (55.88%), Postives = 246/340 (72.35%), Query Frame = 1
Query:  163 IVLFYYTKNTEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXRKFMRNQ---SLKSISVTANKTN--LALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSS 1167
            I + +  K TEIDW AYM EVEGF+NGT DY KLQG TGPLVYPAGFVY +S LY LT KGTNI  AQ++F   Y++TL  +F IYN+   +P YVF FMCC SYRIHSI+ILRLFNDP+AM+FLY ++N F++N ++ G +LFS GVS+KMN+LLFAPGLL + L   G W T+  L+ CG  Q++LG+PFL+ N   Y++R+F   RQF + WTVNWR +PE  FLNRYFH  LL +HL+ L        R +   +L+S+  +   +N  L  ++F SNF+G+  SRSLHYQFY+WY+HT+P +LW+    +S  R+LI+G+IELCWNTYPSTI SS
Sbjct:   24 IAVIWKIKYTEIDWEAYMSEVEGFLNGTYDYTKLQGATGPLVYPAGFVYIFSGLYHLTSKGTNIRMAQYLFAALYLLTLISVFSIYNKTKKVPPYVFFFMCCASYRIHSIFILRLFNDPVAMIFLYCSVNAFLANNWNLGCLLFSFGVSVKMNVLLFAPGLLFLLLKKFGAWRTIPKLAICGVPQVLLGLPFLMDNPVGYISRSFNLGRQFFFIWTVNWRFLPEWLFLNRYFHAALLLLHLLTLFCFYLYKWRGKRLYALRSLKKSGAHSNDLLVTILFTSNFLGMVFSRSLHYQFYVWYFHTIPYLLWTTRLWTSA-RILILGVIELCWNTYPSTIASS 362          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Medaka
Match: alg3 (ALG3 alpha-1,3- mannosyltransferase [Source:NCBI gene;Acc:101167399])

HSP 1 Score: 342.428 bits (877), Expect = 4.976e-114
Identity = 194/335 (57.91%), Postives = 245/335 (73.13%), Query Frame = 1
Query:  190 TEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXX--XRKFMRNQS----LKSISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWS--LPNISSIWRLLIMGLIELCWNTYPSTIYSSG 1170
            TEIDW AYM EVEG INGT DY +L+G TGPLVYPAGFVY ++ALY++T+ GTNI   Q+IF  FY+ITL L+FRIYN+   +P YVF F+CC SYRIHSI++LRLFNDP+AMM L+A+IN F+   ++ G  L+S+ VS+KMN+LLFAPGLL + L+  G   T+ +LS C  +QL+LG+PFL+ N   Y++RAF+  RQFL+KWTVNWR +PE  FLNRYFHL LLA HL+ LL+    R     QS    LK  S         LV+F SNFIG+  SRSLHYQFY+WY+HTLP +LWS  +  ++ + R+LI+GLIEL WNTYPST  SS 
Sbjct:   80 TEIDWKAYMDEVEGVINGTYDYTQLKGDTGPLVYPAGFVYVFTALYYITNHGTNIRLGQYIFAVFYLITLLLVFRIYNRTKKVPPYVFFFVCCASYRIHSIFVLRLFNDPVAMMLLFASINLFIDGYWTVGCGLYSLAVSVKMNVLLFAPGLLFLLLWEFGLMRTIPNLSLCAGIQLLLGLPFLLENPVGYVSRAFDLGRQFLFKWTVNWRFLPEWLFLNRYFHLALLAAHLLALLLFALTRWKRPGQSVFELLKEPSKRKVPAQKILVLFTSNFIGMCFSRSLHYQFYVWYFHTLPYLLWSGGVEKLAHLLRVLILGLIELSWNTYPSTNSSSA 414          
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Planmine SMEST
Match: SMESG000008818.1 (SMESG000008818.1)

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 362/366 (98.91%), Postives = 364/366 (99.45%), Query Frame = 1
Query:  181 TKNTEIDWIAYMQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFXXXXXXXXXXXXXXXXRKFMRNQSLKSISVTANKTNLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSSGXXXXXXXXXXXXXXKGNGFNYITSMVAISETKQKLK 1278
             K TEIDWIAYMQEVEGF+NGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFHLLLLAVHLVLLLVLVRKFMRNQSLKSISVTANKTNLALVMFMSNFIGIACSRSLHYQFY+WYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSSGLLHLCHLFVLFHWLKGNGFNYITSMVAISETKQKLK
Sbjct:   40 VKYTEIDWIAYMQEVEGFLNGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFAQFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFNDPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLFNCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTVNWRLIPESFFLNRYFHLLLLAVHLVLLLVLVRKFMRNQSLKSISVTANKTNLALVMFMSNFIGIACSRSLHYQFYVWYYHTLPLILWSLPNISSIWRLLIMGLIELCWNTYPSTIYSSGLLHLCHLFVLFHWLKGNGFNYITSMVAISETKQKLK 405          

HSP 2 Score: 55.0694 bits (131), Expect = 5.574e-8
Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 2
Query:   71 MSSFCEKLEWIFYNKSWKRTXXXXXXXXXXXXSYFIILKIQ 193
            MSSFCEKLEWIFYNKSWKRTLMLLLLFLEAGLSYFIILK++
Sbjct:    1 MSSFCEKLEWIFYNKSWKRTLMLLLLFLEAGLSYFIILKVK 41          
The following BLAST results are available for this feature:
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ALG38.044e-10652.77ALG3 alpha-1,3- mannosyltransferase [Source:HGNC S... [more]
ALG39.019e-10652.92ALG3 alpha-1,3- mannosyltransferase [Source:HGNC S... [more]
ALG38.261e-10553.08ALG3 alpha-1,3- mannosyltransferase [Source:HGNC S... [more]
ALG31.869e-6749.81ALG3 alpha-1,3- mannosyltransferase [Source:HGNC S... [more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
algn-35.490e-8743.55pep chromosome:WBcel235:II:14127687:14132833:-1 ge... [more]
algn-34.512e-8242.82pep chromosome:WBcel235:II:14127687:14131752:-1 ge... [more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Alg33.856e-7353.88gene:FBgn0011297 transcript:FBtr0072095[more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
alg31.075e-12456.76ALG3 alpha-1,3- mannosyltransferase [Source:ZFIN;A... [more]
alg32.426e-3154.55ALG3 alpha-1,3- mannosyltransferase [Source:ZFIN;A... [more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gcn11.027e-9951.16GCN1, eIF2 alpha kinase activator homolog [Source:... [more]
gcn11.242e-9951.16GCN1, eIF2 alpha kinase activator homolog [Source:... [more]
gcn11.833e-9951.16GCN1, eIF2 alpha kinase activator homolog [Source:... [more]
gcn12.047e-9951.16GCN1, eIF2 alpha kinase activator homolog [Source:... [more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Alg31.050e-10553.37asparagine-linked glycosylation 3 (alpha-1,3-manno... [more]
Alg34.709e-10152.55asparagine-linked glycosylation 3 (alpha-1,3-manno... [more]
Alg32.100e-7450.70asparagine-linked glycosylation 3 (alpha-1,3-manno... [more]
Alg33.172e-6256.82asparagine-linked glycosylation 3 (alpha-1,3-manno... [more]
Alg32.506e-5353.66asparagine-linked glycosylation 3 (alpha-1,3-manno... [more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K2A8|ALG3_MOUSE7.341e-10553.37Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosy... [more]
sp|Q92685|ALG3_HUMAN3.967e-10453.08Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosy... [more]
sp|Q55F69|ALG3_DICDI1.701e-8943.20Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,... [more]
sp|P82149|NT53_DROME3.569e-7253.88Lethal(2)neighbour of tid protein 2 OS=Drosophila ... [more]
sp|Q27333|NT56_DROME4.119e-7253.88Lethal(2)neighbour of tid protein OS=Drosophila me... [more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419QE813.088e-12858.41Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1 OS=Clonor... [more]
A0A4V3SEY59.607e-12757.65Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A504YLI23.826e-12556.05Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosy... [more]
A0A074ZDK63.459e-12456.98Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4Z2CND43.869e-12459.52Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannos... [more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
alg31.052e-11454.12ALG3 alpha-1,3- mannosyltransferase [Source:NCBI g... [more]
alg34.113e-11454.12ALG3 alpha-1,3- mannosyltransferase [Source:NCBI g... [more]
alg33.666e-11354.85ALG3 alpha-1,3- mannosyltransferase [Source:NCBI g... [more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
alg34.593e-9448.90ALG3 alpha-1,3- mannosyltransferase [Source:ZFIN;A... [more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ALG33.885e-5237.64Dolichol-P-Man dependent alpha(1-3) mannosyltransf... [more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO465801.803e-12055.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
alg34.976e-11457.91ALG3 alpha-1,3- mannosyltransferase [Source:NCBI g... [more]
back to top
BLAST of Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000008818.15.574e-898.91SMESG000008818.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007572 ID=SMED30007572|Name=Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1, 3-mannosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1300bp
TTTTAATATTAAACAAATAATTGTCTTTTATCCTTAAATTTTTCATTAAA
TCGAAAATCATTTTAGCTTAATGAGTTCTTTTTGCGAAAAGTTAGAATGG
ATATTCTATAATAAATCCTGGAAAAGAACTTTGATGCTTCTTTTACTTTT
TCTAGAAGCTGGATTGTCTTATTTTATTATACTAAAAATACAGAAATTGA
TTGGATTGCATACATGCAAGAAGTAGAAGGATTTATTAATGGAACTTTAG
ATTATGAAAAATTACAGGGACAAACTGGTCCGTTAGTATATCCCGCAGGA
TTTGTATACTTTTATAGTGCTTTATATTGGTTAACTGACAAAGGAACAAA
TATTTTATTTGCACAGTTTATATTTTTAGGATTTTATGTAATAACGTTAG
GATTAATATTTCGAATATATAATCAATTTACACATATCCCAAACTATGTT
TTCGTATTCATGTGTTGCACGTCATATAGAATTCATTCAATCTATATTCT
ACGTTTATTTAATGACCCAATTGCGATGATGTTTCTTTATGCAGCTATAA
ATTGCTTCATGAGTAACAGATATAGTTGGGGTTCAATTTTGTTTAGTATT
GGAGTTTCTATTAAAATGAATATTTTATTATTCGCTCCCGGATTATTATT
GATTTATCTATTTAATTGCGGGTTCTGGGAGACCGTCGGTCACCTATCTG
AGTGTGGAACTGTACAACTCGTTCTAGGAATGCCGTTCTTGATTCACAAT
TCTGCGCAATACCTAAACCGTGCGTTTGAATTCAAACGGCAATTTCTCTA
TAAATGGACCGTCAATTGGCGATTAATTCCGGAATCATTCTTTCTCAATC
GATATTTCCACCTTTTACTACTAGCTGTTCATTTGGTACTGCTATTAGTG
CTGGTGAGAAAGTTTATGAGGAACCAATCTCTGAAAAGCATTTCTGTCAC
GGCTAACAAAACAAATCTCGCGTTAGTTATGTTCATGAGTAATTTTATCG
GAATAGCTTGCAGTCGATCTCTCCACTATCAATTTTATATCTGGTATTAC
CATACCTTGCCCTTGATACTATGGTCATTACCGAATATTTCATCAATCTG
GCGATTGCTAATAATGGGTCTGATTGAACTATGCTGGAATACATATCCGT
CGACAATTTATAGCAGTGGGCTTTTACACTTGTGCCATCTTTTTGTTTTA
TTTCATTGGTTGAAAGGAAACGGTTTCAACTATATTACTAGTATGGTTGC
TATTAGTGAAACCAAGCAGAAACTTAAATAAAAATCATTCTTTTTTGTTG
back to top

protein sequence of SMED30007572-orf-1

>SMED30007572-orf-1 ID=SMED30007572-orf-1|Name=SMED30007572-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=356bp
MQEVEGFINGTLDYEKLQGQTGPLVYPAGFVYFYSALYWLTDKGTNILFA
QFIFLGFYVITLGLIFRIYNQFTHIPNYVFVFMCCTSYRIHSIYILRLFN
DPIAMMFLYAAINCFMSNRYSWGSILFSIGVSIKMNILLFAPGLLLIYLF
NCGFWETVGHLSECGTVQLVLGMPFLIHNSAQYLNRAFEFKRQFLYKWTV
NWRLIPESFFLNRYFHLLLLAVHLVLLLVLVRKFMRNQSLKSISVTANKT
NLALVMFMSNFIGIACSRSLHYQFYIWYYHTLPLILWSLPNISSIWRLLI
MGLIELCWNTYPSTIYSSGLLHLCHLFVLFHWLKGNGFNYITSMVAISET
KQKLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000030mannosyltransferase activity
GO:0016758transferase activity, transferring hexosyl groups
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: cellular component
TermDefinition
GO:0030176integral component of endoplasmic reticulum membrane
GO:0016021integral component of membrane
GO:0005783endoplasmic reticulum
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0097502mannosylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR007873Glycosyltransferase_ALG3
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007873Glycosyltransferase, ALG3PFAMPF05208ALG3coord: 1..318
e-value: 9.9E-124
score: 413.4
IPR007873Glycosyltransferase, ALG3PANTHERPTHR12646NOT56 - RELATEDcoord: 1..335
NoneNo IPR availablePANTHERPTHR12646:SF0DOL-P-MAN:MAN(5)GLCNAC(2)-PP-DOL ALPHA-1,3-MANNOSYLTRANSFERASEcoord: 1..335
NoneNo IPR availableTMHMMTMhelixcoord: 24..41
NoneNo IPR availableTMHMMTMhelixcoord: 311..333
NoneNo IPR availableTMHMMTMhelixcoord: 90..112
NoneNo IPR availableTMHMMTMhelixcoord: 48..70
NoneNo IPR availableTMHMMTMhelixcoord: 209..231
NoneNo IPR availableTMHMMTMhelixcoord: 125..147
NoneNo IPR availableTMHMMTMhelixcoord: 274..296