Lysosomal trafficking regulator

Overview
NameLysosomal trafficking regulator
Smed IDSMED30007567
Length (bp)10951
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysosomal trafficking regulator (SMED30007567) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysosomal trafficking regulator (SMED30007567) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysosomal trafficking regulator (SMED30007567) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysosomal trafficking regulator (SMED30007567) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007567

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 53

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007567SMESG000069984.1 SMESG000069981.1 SmedASXL_018810SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007567SMESG000069984.1 SMESG000069981.1 SmedASXL_018810SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007567SMESG000069984.1 SMESG000069981.1 Contig34872uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007567SMESG000069984.1 SMESG000069981.1 Contig34872newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007567SMESG000069984.1 SMESG000069981.1 Contig42028newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007567SMESG000069984.1 SMESG000069981.1 Contig42028uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 fluorescence in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 fluorescence in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 fluorescence in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 fluorescence in situ hybridization evidence
blastomereSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 DQ186986smed_ncbi_20200123PMID:16311336
Reddien et al., 2005
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30007567SMESG000069981.1 SMESG000069984.1 DN303300ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30007567SMESG000069981.1 SMESG000069984.1 DN303300ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
neoblastSMED30007567SMESG000069981.1 SMESG000069984.1 DN303300ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
pharynx musculatureSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30007567SMESG000069984.1 SMESG000069981.1 isotig05155be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 dd_Smed_v6_756_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 SmWIOct06_100030GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 SmWIOct06_100032GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30007567SMESG000069984.1 SMESG000069981.1 SmWIOct06_100031GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysosomal trafficking regulator vs. Ensembl Human
Match: LYST (lysosomal trafficking regulator [Source:HGNC Symbol;Acc:HGNC:1968])

HSP 1 Score: 385.956 bits (990), Expect = 2.851e-106
Identity = 297/984 (30.18%), Postives = 482/984 (48.98%), Query Frame = 1
Query: 7444 VFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEEFIKSLSQLLFA--------ISPDFS-----VEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGE----SLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFH-TMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF--INKSFPAKKINWRNIKNTAPRNI----QHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSKMT--SKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWD 10317
            +   CKE  +  LG LL+ +     +   R +  + V    N   ++R CL  +      L+L + +++ +    G  TEE + +   L+ A        I P  S     ++ + E+ +    +E   K  A++K   +   +  Q  D +  ++S ++        + ++ N + + I +I+     +      W+ LI   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+  S +     L++LFE     DK         +     E I+++  CI V  S    GE  +GK  + F+ED  ++   E   L   L+   F +W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD +   I     PN      +  +   W  G+++NF+YLT LN  AGRS+ND+MQYPVFPFIL +Y S TLDL     YR+LSKPI++Q     ++ ++ +    +EY++  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH T  +    S  S++ +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES YVS  +  W+DLVFG+KQ GKA+++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF   + S P  K+N   I+   P  +    Q +F   +                E +K ++      + L+ + G++WG++VGSP ++   +    +      G+L  LPT  +   S+    ++   +   V  +  T+      + +  A N  R++        P  N +Q            S Q  V S A    S ++F G + G+IT Y       + +   ++   H    L GH  EI  L +C  +++L S        IWD
Sbjct: 2732 ILWSCKETFRMQLGRLLVHILSPAHAAQERKQIFEIVHE-PNHQEILRDCLSPSLQHGAKLVLYLSELIHN--HQGELTEEELGTAELLMNALKLCGHKCIPPSASTKADLIKMIKEEQKKYETEEGVNK-AAWQKTVNNNQQSLFQRLDSKSKDIS-KIAADITQAVSLSQGNERKKVIQHIRGMYKVDLSASRHWQELIQQLTHDRAVWYDPIYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LRDRQKSEDVVKPPLSYLFE-----DKTHSSFSSTVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDTV-ESSSLQGELEPASF-SWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKVRDDVYHNILTNNLPNLLEYGNITALTNLWYTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILADYVSETLDLNDLLIYRNLSKPIAVQYKEKEDRYVDTYKYLEEEYRKGAR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDYVSQNICQWIDLVFGYKQKGKASVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLFHMAHVSRPGAKLN---IEGELPAAVGLLVQFAFRETR----------------EQVKEITYP----SPLSWIKGLKWGEYVGSP-SAPVPVVCFSQPHGERFGSLQALPTRAICGLSRNFCLLMTYSKEQGVRSMNSTDIQWSAILSWGYADNILRLKSKQ---SEPPVNFIQ-----------SSQQYQVTSCAWVPDSCQLFTGSKCGVITAYTNRFTSSTPSEIEMETQIH----LYGHTEEITSLFVCKPYSILISVSRDGTCIIWD 3644          

HSP 2 Score: 63.5438 bits (153), Expect = 1.044e-8
Identity = 64/238 (26.89%), Postives = 114/238 (47.90%), Query Frame = 1
Query: 5020 SVDSAIENLGGISIMIFWLAKVVE-SGDEVSTRYXXXXXXXXXRKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQHMIYED------PTKSKLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQ---EPFEALEHPLPVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHP 5703
            ++   +  +GG  I +F  A+VVE S  E +    L++IL LI+ +    H+     G S++ Q+    K  +GF I+  L++    ED        + KL +  N+ + +D ++L ELL+ WKI        SK E  + E         LL  +  L+  D+   + N   L    ++   L++CQ   E  E    P+P  +C+  ++II  ++ +P D+ ++T + N +L +HP
Sbjct: 1800 TIQGILHEIGGTGIFVFLFARVVELSSCEETQALALRVILSLIKYNQQRVHELENCNGLSMIHQVLIKQKCIVGFYILKTLLEGCCGEDIIYMNENGEFKLDVDSNA-IIQDVKLLEELLLDWKIW-------SKAEQGVWET--------LLAALEVLIRADHHQQMFNIKQLLKAQVVHHFLLTCQVLQEYKEGQLTPMPREVCRSFVKIIAEVLGSPPDLELLTIIFNFLLAVHP 2021          
BLAST of Lysosomal trafficking regulator vs. Ensembl Human
Match: WDFY3 (WD repeat and FYVE domain containing 3 [Source:HGNC Symbol;Acc:HGNC:20751])

HSP 1 Score: 278.1 bits (710), Expect = 5.711e-79
Identity = 156/407 (38.33%), Postives = 233/407 (57.25%), Query Frame = 1
Query: 8470 DIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILP-------------PNAN--RKPRLID-------IQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDK 9621
            DI+ V +RR+ L+  A+E+   DGRN L+A    + R+++      ++P             PN +  +   L+        + + W  G++SNF YL  LNT AGRSYND+MQYPVFP+IL +Y S  +DLT   T+R+L+KP+  Q             E+  +Y+++ +  +  N          P YHY + YS++  V  Y++R+ PFTQ F++ Q G FD  DRMFH++  +W+ ++      +KE+IPEFFYLPE   NS +F+ G + NGTK+ DVILP W+ GD R F  +HR +LE  YVS  L+ W+DL+FG+KQ G AA+EA+N+FH   Y   +    I + ++ +A    I N+GQIPKQLF  K  P K++  R   + A  ++    +SDK
Sbjct:  216 DIKEVHKRRYLLQPIAVEVFSGDGRNYLLAFQKGI-RNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEEVDLTNPKTFRNLAKPMGAQT-----------DERLAQYKKRYKDWEDPNG-------ETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVILPPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLF-KKPHPPKRVRSRLNGDNAGISVLPGSTSDK 602          
BLAST of Lysosomal trafficking regulator vs. Ensembl Human
Match: WDFY3 (WD repeat and FYVE domain containing 3 [Source:HGNC Symbol;Acc:HGNC:20751])

HSP 1 Score: 279.256 bits (713), Expect = 5.589e-74
Identity = 158/420 (37.62%), Postives = 239/420 (56.90%), Query Frame = 1
Query: 8470 DIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILP-------------PNANRK------PRLI---DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDK-GYQDTDQMKDSI 9657
            DI+ V +RR+ L+  A+E+   DGRN L+A    + R+++      ++P             PN + +        L+    + + W  G++SNF YL  LNT AGRSYND+MQYPVFP+IL +Y S  +DLT   T+R+L+KP+  Q             E+  +Y+++ +  +  N          P YHY + YS++  V  Y++R+ PFTQ F++ Q G FD  DRMFH++  +W+ ++      +KE+IPEFFYLPE   NS +F+ G + NGTK+ DVILP W+ GD R F  +HR +LE  YVS  L+ W+DL+FG+KQ G AA+EA+N+FH   Y   +    I + ++ +A    I N+GQIPKQLF  K  P K++  R   + A  ++    +SDK  +   D ++ S+
Sbjct: 2613 DIKEVHKRRYLLQPIAVEVFSGDGRNYLLAFQKGI-RNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEEVDLTNPKTFRNLAKPMGAQT-----------DERLAQYKKRYKDWEDPNG-------ETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVILPPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLF-KKPHPPKRVRSRLNGDNAGISVLPGSTSDKIFFHHLDNLRPSL 3012          
BLAST of Lysosomal trafficking regulator vs. Ensembl Human
Match: NBEA (neurobeachin [Source:HGNC Symbol;Acc:HGNC:7648])

HSP 1 Score: 251.521 bits (641), Expect = 4.464e-69
Identity = 147/375 (39.20%), Postives = 215/375 (57.33%), Query Frame = 1
Query: 8464 LNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILP------PNANR----KPRLI----DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFP 9546
             ++I  V  RR+ L++ ALE+ M +  + +          +++  +  +        P A R     PR +    ++ + W   ++SNF+YL FLNT AGR+YND+ QYPVFP++LT Y S  LDLT    +RDLSKPI    G L  K    + E+ + ++            D+ S    PPYHY++ YS + + L +++RI PFT  F+   DG+FD PDR F ++A SW  S    S +KE+IPEF+YLPE+FVNS  +N G R +   V+DV LP W+      F  I+R +LES +VS QL+ W+DL+FG+KQ G  A+ A+N+FH  TY  ++  D IT+ + R A+E  I+N+GQ P QL I    P
Sbjct:    2 FSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLYKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLPGNFRDLSKPI----GALNPKRAVFYAERYETWE------------DDQS----PPYHYNTHYSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAK-KPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPP 355          
BLAST of Lysosomal trafficking regulator vs. Ensembl Human
Match: NBEAL1 (neurobeachin like 1 [Source:HGNC Symbol;Acc:HGNC:20681])

HSP 1 Score: 259.225 bits (661), Expect = 5.098e-68
Identity = 159/395 (40.25%), Postives = 225/395 (56.96%), Query Frame = 1
Query: 8374 GFLEDRVNNLYSEYDELPNYLKDFGF-INWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNA---NRKPRLI----DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTK--VDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF 9528
            G LE    ++Y  YD         GF   W  + I  +  RR+ LR  ALE+   D  N  +     + R++I S + ++  PN+   +R P+ +     + ++W   ++SNFDYL  +NT AGR+YND+ QYPVFP+IL +YTS  LDL   + +RDLSKPI + N    EK      EK + ++            D M    +  +HY + YSNSA V++Y+IR+ PFT   IQ Q G FD  DR FH++ ++W     +   +KE+IPEFFY PE   N   FN G RL  +K  V+DVILP+W+   A  F   HR +LES YVS  L+ W+DL+FG+KQ G AA+EA+N+F+  +Y  A+  D +T+E  R A+E MI N+GQ P QL 
Sbjct: 1905 GRLEITTQHIYF-YDGSIEKEDGVGFDFKWPHSQIREIHLRRYNLRRSALEIFHVDQSNYFLNFKKEV-RNKIYSRLLSLHSPNSYYGSRSPQELFKASGLTQKWVNREISNFDYLIQINTMAGRTYNDLAQYPVFPWILQDYTSEELDLNNPAVFRDLSKPIGVVN----EKNAKAMREKYENFE------------DPMG--TIDKFHYGTHYSNSAGVMHYLIRVEPFTTLHIQLQSGRFDCADRQFHSIPATWQALMDNPYDVKELIPEFFYFPEFLENQNQFNLG-RLQISKELVNDVILPKWAKS-AEDFIYKHRKALESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYCSYEGAVDLDALTDEKERKALEGMINNFGQTPCQLL 2277          
BLAST of Lysosomal trafficking regulator vs. Ensembl Celegans
Match: sel-2 (Putative neurobeachin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19317])

HSP 1 Score: 274.633 bits (701), Expect = 3.887e-73
Identity = 187/540 (34.63%), Postives = 272/540 (50.37%), Query Frame = 1
Query: 8038 DDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQ-------VDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDEL-PNYLKDFGFI---------NWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNS-------TLERDRILSFIENILPPNANRKPRLI---------DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKI 9558
            DDS   +Q ++LD  E  SR R+R +   +    +  N     +N + + S  E +  + +  +          ++V E+ ID    K  +++  +      C S   K     G    G L    N+L+ + +E  PNY K    +          W+L +I  +  RR+ L++ ALE+ +      + A +S         +  R+   ++  LP   +RK  L+         D+  +W + ++SNFDYL FLNT AGR++ND+ QYPVFP+ILT YTS TLDL+  S +RDLSKPI    G L E     F    D Y        TS + D+     VP +HY + YS  A  L +++R+ PF   FI   DG+FD PDR+ H++  SW         +KE+IPE FYLPE+F NS  FN G R +GT VDDV+LP W+      F L+HR +LES  VS QLN W+DL+FG+KQ G  A+ A N+F+  TY   + P       + +A+EQ I ++GQ P QL      P   I
Sbjct: 1598 DDSKSGTQFWKLDVWEDDSRRRKRFVPNAYGSRHEEANLPEGEKNEEPEISEQEKIRKVLKGLFSKRQNSSGSHELVDESDID----KWAQEVDPTPSSQSACFSTTAK-LIAPGVVVPGTLSVTANDLFFDANESDPNYKKQCAQVLRYCEALHARWNLQEIRAIFLRRYLLQNTALELFLASRTAIMFAFDSEDAVKKVVYQLPRVGVGVKYGLP--QSRKTSLMTPRQLFKHSDMCAKWQKREISNFDYLMFLNTVAGRTFNDLSQYPVFPWILTNYTSDTLDLSVASNFRDLSKPI----GALSEARRKFFN---DRY--------TSWDDDQ-----VPAFHYGTHYSTPAFTLNWLLRVEPFASMFINLHDGKFDHPDRITHSIKDSWDRCQRDSHDVKELIPELFYLPEMFRNSSKFNLGRRADGTPVDDVVLPPWAESPEH-FVLMHRQALESDLVSCQLNQWIDLIFGYKQRGAEAVRATNVFYHLTYEGTVTPKMAETPGQVAAIEQQILSFGQTPSQLLTEAHPPRHSI 2109          
BLAST of Lysosomal trafficking regulator vs. Ensembl Celegans
Match: wdfy-3 (WD40 and FYVE domain protein [Source:UniProtKB/TrEMBL;Acc:H2FLM2])

HSP 1 Score: 270.781 bits (691), Expect = 8.017e-72
Identity = 150/392 (38.27%), Postives = 215/392 (54.85%), Query Frame = 1
Query: 8467 NDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFI-------------------ENILPPNANRKPRLID-------IQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKIN 9561
            N I  V +RR+ L+  ALE+   DGRN L+A    + RDR+   +                    N+      R   L+        + + W  G +SNF YL  LNT AGR YND+ QYP+FP++L +YTSS LD    ST+RD SKP+  Q+    E+ +  F E  D                       PPY Y + YS++  V+ Y++R+ PFTQ+F+  Q G FD  DRMFH++  +W  ++ +    +KE+IPEFF LPE+F N+  F+ G + NG  V+DV+LP W  GD R F  +HR +LES YVS+ L+ W+DL+FG+KQ G+ A++  NLFH   Y  ++  + I + + R+A    + N+GQIP QLF  K  P KK+N
Sbjct: 2501 NMIREVHKRRYLLQPIALEVFSSDGRNYLLAFPKKI-RDRVFDKLTSMAINLSSGGSDSLGGQKANVAIETTGRGASLLSSLIGQQSVTQRWLSGNISNFQYLMHLNTLAGRCYNDLSQYPIFPWVLADYTSSQLDFNNISTFRDFSKPMGAQSPDRLEQFLKRFREWDDPSGE------------------TPPYMYGTHYSSAMIVVSYLVRLEPFTQQFLSLQGGHFDLADRMFHSVGDAWTSASRNNMADVKELIPEFFTLPEMFTNTNHFDLGVKQNGIHVNDVLLPAWCHGDPREFIRLHRQALESDYVSSHLHEWIDLIFGYKQNGEEAVKNSNLFHHLFYEGSVDFERIDDPLTRNATIGFVNNFGQIPTQLF-KKPHPQKKVN 2872          
BLAST of Lysosomal trafficking regulator vs. Ensembl Celegans
Match: wdfy-3 (WD40 and FYVE domain protein [Source:UniProtKB/TrEMBL;Acc:H2FLM2])

HSP 1 Score: 270.781 bits (691), Expect = 8.499e-72
Identity = 150/392 (38.27%), Postives = 215/392 (54.85%), Query Frame = 1
Query: 8467 NDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFI-------------------ENILPPNANRKPRLID-------IQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKIN 9561
            N I  V +RR+ L+  ALE+   DGRN L+A    + RDR+   +                    N+      R   L+        + + W  G +SNF YL  LNT AGR YND+ QYP+FP++L +YTSS LD    ST+RD SKP+  Q+    E+ +  F E  D                       PPY Y + YS++  V+ Y++R+ PFTQ+F+  Q G FD  DRMFH++  +W  ++ +    +KE+IPEFF LPE+F N+  F+ G + NG  V+DV+LP W  GD R F  +HR +LES YVS+ L+ W+DL+FG+KQ G+ A++  NLFH   Y  ++  + I + + R+A    + N+GQIP QLF  K  P KK+N
Sbjct: 2499 NMIREVHKRRYLLQPIALEVFSSDGRNYLLAFPKKI-RDRVFDKLTSMAINLSSGGSDSLGGQKANVAIETTGRGASLLSSLIGQQSVTQRWLSGNISNFQYLMHLNTLAGRCYNDLSQYPIFPWVLADYTSSQLDFNNISTFRDFSKPMGAQSPDRLEQFLKRFREWDDPSGE------------------TPPYMYGTHYSSAMIVVSYLVRLEPFTQQFLSLQGGHFDLADRMFHSVGDAWTSASRNNMADVKELIPEFFTLPEMFTNTNHFDLGVKQNGIHVNDVLLPAWCHGDPREFIRLHRQALESDYVSSHLHEWIDLIFGYKQNGEEAVKNSNLFHHLFYEGSVDFERIDDPLTRNATIGFVNNFGQIPTQLF-KKPHPQKKVN 2870          
BLAST of Lysosomal trafficking regulator vs. Ensembl Celegans
Match: wdfy-3 (WD40 and FYVE domain protein [Source:UniProtKB/TrEMBL;Acc:H2FLM2])

HSP 1 Score: 270.781 bits (691), Expect = 8.506e-72
Identity = 150/392 (38.27%), Postives = 215/392 (54.85%), Query Frame = 1
Query: 8467 NDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFI-------------------ENILPPNANRKPRLID-------IQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKIN 9561
            N I  V +RR+ L+  ALE+   DGRN L+A    + RDR+   +                    N+      R   L+        + + W  G +SNF YL  LNT AGR YND+ QYP+FP++L +YTSS LD    ST+RD SKP+  Q+    E+ +  F E  D                       PPY Y + YS++  V+ Y++R+ PFTQ+F+  Q G FD  DRMFH++  +W  ++ +    +KE+IPEFF LPE+F N+  F+ G + NG  V+DV+LP W  GD R F  +HR +LES YVS+ L+ W+DL+FG+KQ G+ A++  NLFH   Y  ++  + I + + R+A    + N+GQIP QLF  K  P KK+N
Sbjct: 2503 NMIREVHKRRYLLQPIALEVFSSDGRNYLLAFPKKI-RDRVFDKLTSMAINLSSGGSDSLGGQKANVAIETTGRGASLLSSLIGQQSVTQRWLSGNISNFQYLMHLNTLAGRCYNDLSQYPIFPWVLADYTSSQLDFNNISTFRDFSKPMGAQSPDRLEQFLKRFREWDDPSGE------------------TPPYMYGTHYSSAMIVVSYLVRLEPFTQQFLSLQGGHFDLADRMFHSVGDAWTSASRNNMADVKELIPEFFTLPEMFTNTNHFDLGVKQNGIHVNDVLLPAWCHGDPREFIRLHRQALESDYVSSHLHEWIDLIFGYKQNGEEAVKNSNLFHHLFYEGSVDFERIDDPLTRNATIGFVNNFGQIPTQLF-KKPHPQKKVN 2874          
BLAST of Lysosomal trafficking regulator vs. Ensembl Celegans
Match: wdfy-3 (WD40 and FYVE domain protein [Source:UniProtKB/TrEMBL;Acc:H2FLM2])

HSP 1 Score: 270.781 bits (691), Expect = 8.574e-72
Identity = 150/392 (38.27%), Postives = 215/392 (54.85%), Query Frame = 1
Query: 8467 NDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFI-------------------ENILPPNANRKPRLID-------IQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKIN 9561
            N I  V +RR+ L+  ALE+   DGRN L+A    + RDR+   +                    N+      R   L+        + + W  G +SNF YL  LNT AGR YND+ QYP+FP++L +YTSS LD    ST+RD SKP+  Q+    E+ +  F E  D                       PPY Y + YS++  V+ Y++R+ PFTQ+F+  Q G FD  DRMFH++  +W  ++ +    +KE+IPEFF LPE+F N+  F+ G + NG  V+DV+LP W  GD R F  +HR +LES YVS+ L+ W+DL+FG+KQ G+ A++  NLFH   Y  ++  + I + + R+A    + N+GQIP QLF  K  P KK+N
Sbjct: 2501 NMIREVHKRRYLLQPIALEVFSSDGRNYLLAFPKKI-RDRVFDKLTSMAINLSSGGSDSLGGQKANVAIETTGRGASLLSSLIGQQSVTQRWLSGNISNFQYLMHLNTLAGRCYNDLSQYPIFPWVLADYTSSQLDFNNISTFRDFSKPMGAQSPDRLEQFLKRFREWDDPSGE------------------TPPYMYGTHYSSAMIVVSYLVRLEPFTQQFLSLQGGHFDLADRMFHSVGDAWTSASRNNMADVKELIPEFFTLPEMFTNTNHFDLGVKQNGIHVNDVLLPAWCHGDPREFIRLHRQALESDYVSSHLHEWIDLIFGYKQNGEEAVKNSNLFHHLFYEGSVDFERIDDPLTRNATIGFVNNFGQIPTQLF-KKPHPQKKVN 2872          
BLAST of Lysosomal trafficking regulator vs. Ensembl Fly
Match: mv (gene:FBgn0265988 transcript:FBtr0304060)

HSP 1 Score: 300.827 bits (769), Expect = 7.825e-81
Identity = 180/538 (33.46%), Postives = 285/538 (52.97%), Query Frame = 1
Query: 7978 YRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYF-NPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISC--------PCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILS--FIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKK 9555
            Y    W  +I   T E   W  + +    + LD  EGPSR+  R+ +    I+ ++F N   P +                   ++ D   Y  P+D  +    + + IS             +   G  +GE  +   ++ FL                Y   +  +N  + +I  +  +R++ ++ A E+++   ++   ++ +  +  +I+   F + I+      K  +I I ++W EG ++N++YL  LN  +GR+YND+MQYPVFP++L  Y S  LDL +   +R L +PI++Q             E    Y      + ++N    M    + PYHYSS YSNS TVL++++R+PPFT  F+++QD +FD PDR FH + ++W L++      +KE+IPEFF LPE+F N + F FG R NG +V+DV LP WS  D+RLF LIHR +LES  V NQ++ W+DL+FG+KQ+G++A+EAIN+FHP T Y      EI++ I R AV+ M++ YGQ+P+QLF     PA K
Sbjct: 2595 YTYTKWLEIIRRMTHEGAPWHSAERAECSWELDDTEGPSRVHTRLRRCHLDIDRRFFMNEYRPGQG------------------HREDLEPYVRPLDYLIASYDQQLNISLNSQILYNFAAKFLPVDGEIEGEIIITDLKLYFLA--------------TYRCRYFNVNCDIANITEIWLKRYQHQETAFEILLDTNKSLFFSLQNA-DDWKIMREVFCDKIVATPDQSK--VIAITQQWREGLLTNWEYLMTLNQISGRTYNDLMQYPVFPWVLANYNSEVLDLREGHNFRRLGRPIAVQ-----------VEENEKHYISNYTYIDSTNTT--MGSLILKPYHYSSHYSNSGTVLHFLVRVPPFTSYFLRYQDNDFDLPDRTFHALNTTWLLASRDSPTDVKELIPEFFCLPEMFENFERFKFGCRQNGERVEDVSLPPWSQRDSRLFVLIHRQALESELVRNQIHNWIDLIFGYKQSGESAVEAINVFHPAT-YAVFLDSEISDPIEREAVKTMVKTYGQMPRQLF-KSPHPASK 3082          
BLAST of Lysosomal trafficking regulator vs. Ensembl Fly
Match: CG43367 (gene:FBgn0263110 transcript:FBtr0307309)

HSP 1 Score: 270.396 bits (690), Expect = 1.115e-71
Identity = 203/619 (32.79%), Postives = 295/619 (47.66%), Query Frame = 1
Query: 7765 NLWVKENEFKLNAYKK-KFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYAR---KNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYEN----------------PIDCQLLK--CIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPN----ANRKP----RLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGE-RLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF 9528
            +LW   N F    Y+  K  SK    NQ  +RR  +  I M           R     LQH+ I +         + R  WK         +  W       + ++L   E  +R+R ++          Y N    A N++D ++S      + E    +   V  +                 ID Q  +   +E + +S  C L+      KG   V +    F++     L    ++   Y  DF F     N I  V  R++ LR  ALE+ + D  +  +   +T  R+++ + I  +  PN    + R P    R   + + W   ++SNF+YL +LNT AGRSYND+ QYPVFP+IL +YTS  LDLT   ++RDLSKPI   N P  E  +     K D +              E    A+P +HY + YSNSA VL+Y++R+ PFT   I  Q G FD  DR FH++  +W L   + + +KE+IPEFFY PE   N   F+ G  ++   KVDDVILP W++     F  IHR +LES YVS  L++W+DL+FG+KQ G  A EA+N+F+  +Y  A+  D+IT  + R AVE MI N+GQ+P QL 
Sbjct: 1771 HLWEPINRFWAECYEACKAASKQRATNQAENRRLFQQKIYMPWKVRQVEEMQRLQAAALQHKTIDS---------HIRKRWKTAKRFLYGPRGPWYTGEVDEEFWKLSQHENVARMRLKLEPQL------YPNKHENAANLRDNATSAYDTKEISEFDSTIKNAVVRDFLADDESSQLEEELRQLIDTQAQQDVALEKLVMSQDCELITLMTKVKGRIEVNQSVFTFVD-----LSPPTEDGSKY--DFRFST---NKIREVHLRKYNLRRSALEIFLVDQTSYFLNF-TTKTRNKVFTKIVGLPLPNILYGSGRSPAELLRASGLTQRWINREISNFEYLMYLNTIAGRSYNDLSQYPVFPWILADYTSDVLDLTDPKSFRDLSKPIGCIN-PKNEAEVR---GKYDSF--------------EDPSGAIPKFHYGTHYSNSAGVLHYLLRVEPFTSLHIDLQSGRFDVADRQFHSIPQTWKLLMDNPNDVKELIPEFFYFPEFLKNMNKFDLGHLQITKEKVDDVILPAWATTPEE-FIAIHRRALESEYVSQHLHHWIDLIFGYKQKGPKAAEALNVFYYCSYEGAVDLDKITNPVEREAVEGMINNFGQVPSQLL 2344          
BLAST of Lysosomal trafficking regulator vs. Ensembl Fly
Match: CG43367 (gene:FBgn0263110 transcript:FBtr0307310)

HSP 1 Score: 270.011 bits (689), Expect = 1.335e-71
Identity = 203/619 (32.79%), Postives = 295/619 (47.66%), Query Frame = 1
Query: 7765 NLWVKENEFKLNAYKK-KFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYAR---KNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYEN----------------PIDCQLLK--CIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPN----ANRKP----RLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGE-RLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF 9528
            +LW   N F    Y+  K  SK    NQ  +RR  +  I M           R     LQH+ I +         + R  WK         +  W       + ++L   E  +R+R ++          Y N    A N++D ++S      + E    +   V  +                 ID Q  +   +E + +S  C L+      KG   V +    F++     L    ++   Y  DF F     N I  V  R++ LR  ALE+ + D  +  +   +T  R+++ + I  +  PN    + R P    R   + + W   ++SNF+YL +LNT AGRSYND+ QYPVFP+IL +YTS  LDLT   ++RDLSKPI   N P  E  +     K D +              E    A+P +HY + YSNSA VL+Y++R+ PFT   I  Q G FD  DR FH++  +W L   + + +KE+IPEFFY PE   N   F+ G  ++   KVDDVILP W++     F  IHR +LES YVS  L++W+DL+FG+KQ G  A EA+N+F+  +Y  A+  D+IT  + R AVE MI N+GQ+P QL 
Sbjct: 1729 HLWEPINRFWAECYEACKAASKQRATNQAENRRLFQQKIYMPWKVRQVEEMQRLQAAALQHKTIDS---------HIRKRWKTAKRFLYGPRGPWYTGEVDEEFWKLSQHENVARMRLKLEPQL------YPNKHENAANLRDNATSAYDTKEISEFDSTIKNAVVRDFLADDESSQLEEELRQLIDTQAQQDVALEKLVMSQDCELITLMTKVKGRIEVNQSVFTFVD-----LSPPTEDGSKY--DFRFST---NKIREVHLRKYNLRRSALEIFLVDQTSYFLNF-TTKTRNKVFTKIVGLPLPNILYGSGRSPAELLRASGLTQRWINREISNFEYLMYLNTIAGRSYNDLSQYPVFPWILADYTSDVLDLTDPKSFRDLSKPIGCIN-PKNEAEVR---GKYDSF--------------EDPSGAIPKFHYGTHYSNSAGVLHYLLRVEPFTSLHIDLQSGRFDVADRQFHSIPQTWKLLMDNPNDVKELIPEFFYFPEFLKNMNKFDLGHLQITKEKVDDVILPAWATTPEE-FIAIHRRALESEYVSQHLHHWIDLIFGYKQKGPKAAEALNVFYYCSYEGAVDLDKITNPVEREAVEGMINNFGQVPSQLL 2302          
BLAST of Lysosomal trafficking regulator vs. Ensembl Fly
Match: CG43367 (gene:FBgn0263110 transcript:FBtr0307312)

HSP 1 Score: 270.011 bits (689), Expect = 1.385e-71
Identity = 203/619 (32.79%), Postives = 295/619 (47.66%), Query Frame = 1
Query: 7765 NLWVKENEFKLNAYKK-KFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYAR---KNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYEN----------------PIDCQLLK--CIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPN----ANRKP----RLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGE-RLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF 9528
            +LW   N F    Y+  K  SK    NQ  +RR  +  I M           R     LQH+ I +         + R  WK         +  W       + ++L   E  +R+R ++          Y N    A N++D ++S      + E    +   V  +                 ID Q  +   +E + +S  C L+      KG   V +    F++     L    ++   Y  DF F     N I  V  R++ LR  ALE+ + D  +  +   +T  R+++ + I  +  PN    + R P    R   + + W   ++SNF+YL +LNT AGRSYND+ QYPVFP+IL +YTS  LDLT   ++RDLSKPI   N P  E  +     K D +              E    A+P +HY + YSNSA VL+Y++R+ PFT   I  Q G FD  DR FH++  +W L   + + +KE+IPEFFY PE   N   F+ G  ++   KVDDVILP W++     F  IHR +LES YVS  L++W+DL+FG+KQ G  A EA+N+F+  +Y  A+  D+IT  + R AVE MI N+GQ+P QL 
Sbjct: 1571 HLWEPINRFWAECYEACKAASKQRATNQAENRRLFQQKIYMPWKVRQVEEMQRLQAAALQHKTIDS---------HIRKRWKTAKRFLYGPRGPWYTGEVDEEFWKLSQHENVARMRLKLEPQL------YPNKHENAANLRDNATSAYDTKEISEFDSTIKNAVVRDFLADDESSQLEEELRQLIDTQAQQDVALEKLVMSQDCELITLMTKVKGRIEVNQSVFTFVD-----LSPPTEDGSKY--DFRFST---NKIREVHLRKYNLRRSALEIFLVDQTSYFLNF-TTKTRNKVFTKIVGLPLPNILYGSGRSPAELLRASGLTQRWINREISNFEYLMYLNTIAGRSYNDLSQYPVFPWILADYTSDVLDLTDPKSFRDLSKPIGCIN-PKNEAEVR---GKYDSF--------------EDPSGAIPKFHYGTHYSNSAGVLHYLLRVEPFTSLHIDLQSGRFDVADRQFHSIPQTWKLLMDNPNDVKELIPEFFYFPEFLKNMNKFDLGHLQITKEKVDDVILPAWATTPEE-FIAIHRRALESEYVSQHLHHWIDLIFGYKQKGPKAAEALNVFYYCSYEGAVDLDKITNPVEREAVEGMINNFGQVPSQLL 2144          
BLAST of Lysosomal trafficking regulator vs. Ensembl Fly
Match: CG43367 (gene:FBgn0263110 transcript:FBtr0307311)

HSP 1 Score: 270.011 bits (689), Expect = 1.385e-71
Identity = 203/619 (32.79%), Postives = 295/619 (47.66%), Query Frame = 1
Query: 7765 NLWVKENEFKLNAYKK-KFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYAR---KNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYEN----------------PIDCQLLK--CIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPN----ANRKP----RLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGE-RLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF 9528
            +LW   N F    Y+  K  SK    NQ  +RR  +  I M           R     LQH+ I +         + R  WK         +  W       + ++L   E  +R+R ++          Y N    A N++D ++S      + E    +   V  +                 ID Q  +   +E + +S  C L+      KG   V +    F++     L    ++   Y  DF F     N I  V  R++ LR  ALE+ + D  +  +   +T  R+++ + I  +  PN    + R P    R   + + W   ++SNF+YL +LNT AGRSYND+ QYPVFP+IL +YTS  LDLT   ++RDLSKPI   N P  E  +     K D +              E    A+P +HY + YSNSA VL+Y++R+ PFT   I  Q G FD  DR FH++  +W L   + + +KE+IPEFFY PE   N   F+ G  ++   KVDDVILP W++     F  IHR +LES YVS  L++W+DL+FG+KQ G  A EA+N+F+  +Y  A+  D+IT  + R AVE MI N+GQ+P QL 
Sbjct: 1571 HLWEPINRFWAECYEACKAASKQRATNQAENRRLFQQKIYMPWKVRQVEEMQRLQAAALQHKTIDS---------HIRKRWKTAKRFLYGPRGPWYTGEVDEEFWKLSQHENVARMRLKLEPQL------YPNKHENAANLRDNATSAYDTKEISEFDSTIKNAVVRDFLADDESSQLEEELRQLIDTQAQQDVALEKLVMSQDCELITLMTKVKGRIEVNQSVFTFVD-----LSPPTEDGSKY--DFRFST---NKIREVHLRKYNLRRSALEIFLVDQTSYFLNF-TTKTRNKVFTKIVGLPLPNILYGSGRSPAELLRASGLTQRWINREISNFEYLMYLNTIAGRSYNDLSQYPVFPWILADYTSDVLDLTDPKSFRDLSKPIGCIN-PKNEAEVR---GKYDSF--------------EDPSGAIPKFHYGTHYSNSAGVLHYLLRVEPFTSLHIDLQSGRFDVADRQFHSIPQTWKLLMDNPNDVKELIPEFFYFPEFLKNMNKFDLGHLQITKEKVDDVILPAWATTPEE-FIAIHRRALESEYVSQHLHHWIDLIFGYKQKGPKAAEALNVFYYCSYEGAVDLDKITNPVEREAVEGMINNFGQVPSQLL 2144          
BLAST of Lysosomal trafficking regulator vs. Ensembl Zebrafish
Match: lyst (lysosomal trafficking regulator [Source:ZFIN;Acc:ZDB-GENE-070702-1])

HSP 1 Score: 376.711 bits (966), Expect = 7.456e-104
Identity = 253/797 (31.74%), Postives = 413/797 (51.82%), Query Frame = 1
Query: 7444 VFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEE-----FIKSLS---------------QLLFAISPD-FSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFES-TYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPN 9765
            +   C++  +  +G +L+     +L L  R EA++ V    N+  ++R  L         L L + ++L   K + ++ E+     F+ +L                 LL AI  +    E     ++  W K    KL+  ++    +LD  +++  +   +++  +       R    ++++  + +++ A R         W+ L+   T ++ +W D +     ++LDP EGP+R RRR+ +    I +KY       R + D  S    L FLFE  T+    IV +           E I+ +  C+ V  S    GE  +GK  + F+E+ V   +   ++ P+   +    +W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD +   I     PN      +  +   W+ G+++NF+YLT LN  AGRS+ND+MQYPVFPFIL +YT+ TLDL + S YR+LSKPI++Q+    ++ ++ +    +EY++  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R N  +V+ V LP W+  D RLF LIHR +LES  VS  L  W+DLVFG KQ GKAA++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QL     F A  I+    K  +    +    +  G       ++S E          +D    + L  + G++WG++VGSP+
Sbjct: 1592 ILWSCRDTFRVQIGRMLVHTLSPELPLEDRKEALEFVHE-QNYSEILRESLSPGLEHGPKLALYLYELLHDHKDALSREEQAAGNTFMTALKLCGHRCIPPSAPAKPDLLKAIKEEQLKYESEARTSKGAWEK----KLSNTQRSLLQRLDGKSKDISKIAADITQNVSLRQGMERKKVMQHIRGLYKTDLSASR--------HWQELVQQLTHDRAVWYDQSSYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--LKDRRKLDD--SIKAPLAFLFEDKTHSSSSIVKDKATS-------EPIRFTRRCVSVAPSRETAGELLLGKSGMYFVEENVPETHD--NQSPHGETEPASFSWTYEEIKEVHKRWWQLRDNAMEIFLTNGRTLLLAFDNTKFRDDVYHNILTSDLPNLLEYGNISALTHLWSSGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILKDYTNETLDLQEASIYRNLSKPIAVQSKEKEDRYVDNYRYLEEEYKKGKR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRLPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNSERVNHVNLPPWARNDPRLFILIHRQALESDQVSQTLCQWIDLVFGLKQKGKAAVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQL-----FSASHISRAGTKLLS----EAELPAAMGLLVQLAFRESREQ--------PRDSGYPSPLPWIKGLKWGEYVGSPS 2336          
BLAST of Lysosomal trafficking regulator vs. Ensembl Zebrafish
Match: lyst (lysosomal trafficking regulator [Source:ZFIN;Acc:ZDB-GENE-070702-1])

HSP 1 Score: 374.4 bits (960), Expect = 3.309e-103
Identity = 252/797 (31.62%), Postives = 413/797 (51.82%), Query Frame = 1
Query: 7444 VFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEE-----FIKSLS---------------QLLFAISPD-FSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFES-TYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPN 9765
            +   C++  +  +G +L+     +L L  R EA++ V    ++  ++R  L         L L + ++L   K + ++ E+     F+ +L                 LL AI  +    E     ++  W K    KL+  ++    +LD  +++  +   +++  +       R    ++++  + +++ A R         W+ L+   T ++ +W D +     ++LDP EGP+R RRR+ +    I +KY       R + D  S    L FLFE  T+    IV +           E I+ +  C+ V  S    GE  +GK  + F+E+ V   +   ++ P+   +    +W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD +   I     PN      +  +   W+ G+++NF+YLT LN  AGRS+ND+MQYPVFPFIL +YT+ TLDL + S YR+LSKPI++Q+    ++ ++ +    +EY++  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R N  +V+ V LP W+  D RLF LIHR +LES  VS  L  W+DLVFG KQ GKAA++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QL     F A  I+    K  +    +    +  G       ++S E          +D    + L  + G++WG++VGSP+
Sbjct: 1598 ILWSCRDTFRVQIGRMLVHTLSPELPLEDRKEALEFVHE-QSYSEILRESLSPGLEHGPKLALYLYELLHDHKDALSREEQAAGNTFMTALKLCGHRCIPPSAPAKPDLLKAIKEEQLKYESEARTSKGAWEK----KLSNTQRSLLQRLDGKSKDISKIAADITQNVSLRQGMERKKVMQHIRGLYKTDLSASR--------HWQELVQQLTHDRAVWYDQSSYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--LKDRRKLDD--SIKAPLAFLFEDKTHSSSSIVKDKATS-------EPIRFTRRCVSVAPSRETAGELLLGKSGMYFVEENVPETHD--NQSPHGETEPASFSWTYEEIKEVHKRWWQLRDNAMEIFLTNGRTLLLAFDNTKFRDDVYHNILTSDLPNLLEYGNISALTHLWSSGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILKDYTNETLDLQEASIYRNLSKPIAVQSKEKEDRYVDNYRYLEEEYKKGKR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRLPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNSERVNHVNLPPWARNDPRLFILIHRQALESDQVSQTLCQWIDLVFGLKQKGKAAVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQL-----FSASHISRAGTKLLS----EAELPAAMGLLVQLAFRESREQ--------PRDSGYPSPLPWIKGLKWGEYVGSPS 2342          
BLAST of Lysosomal trafficking regulator vs. Ensembl Zebrafish
Match: wdfy4 (WDFY family member 4 [Source:ZFIN;Acc:ZDB-GENE-090313-322])

HSP 1 Score: 266.929 bits (681), Expect = 4.426e-75
Identity = 144/382 (37.70%), Postives = 221/382 (57.85%), Query Frame = 1
Query: 8458 WHLNDIEWVLRRRFKLRDYALEMIMKDG-----------------RNCLIAMNSTLERDRILS-------FIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF 9528
            W  +DI+     RF L D ALE+ +K+G                 R C +  +     + +L+       F++     +A  K  LI    +W  G++SNF+YL  LNT AGR+YND+MQYP+FP+++ +Y S TLDL+  +T+RDLSKP+  Q    +EK I              R ++  NN  ++S       HY + YS++  V  Y++R+ PF+Q F+Q Q G FD P+RMFH++ + W  ++      ++E+IPEFFYLP+  VNS  F+FG   +GT ++DV+LP W+ GD + F  +HR +LES YVS++L+ W+DL+FG++Q G  A+EA+N FHPY Y        + + + +S +   I N+GQ+PKQ+F
Sbjct:   13 WSYDDIKEANFMRFLLEDNALEIFLKNGTSVFLVFFNNDHVNAYKRLCSVVSSLKGRGETVLNVSRSGLLFVKTRRKTSAVEKTVLI----KWQRGEISNFEYLMHLNTLAGRTYNDLMQYPIFPWVIADYESETLDLSSPATFRDLSKPMGAQTEKRKEKFIQ-------------RYLEVENNDGDLSAQC----HYCTHYSSAIIVASYLVRMEPFSQTFLQLQGGTFDVPERMFHSIQNEWESASKDNMSDVRELIPEFFYLPDFLVNSNQFDFGCMQDGTPLNDVVLPPWAKGDPQEFIRVHREALESDYVSSRLHLWIDLIFGYRQQGMPAVEALNTFHPYFYTDKHDRASMKDPVMKSTMLGYINNFGQMPKQIF 373          
BLAST of Lysosomal trafficking regulator vs. Ensembl Zebrafish
Match: wdfy3 (WD repeat and FYVE domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-070705-153])

HSP 1 Score: 272.322 bits (695), Expect = 5.033e-72
Identity = 149/386 (38.60%), Postives = 221/386 (57.25%), Query Frame = 1
Query: 8470 DIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNAN-------RKPR------------LI---DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKI 9558
            DI  V +RR+ L+  A E+   DGRN L+A    + R+++      ++P  A+       ++P             L+    + + W  G++SNF YL  LNT AGRSYND+MQYPVFP+IL ++ S  LDL    T+R+LSKP+  Q             ++  +Y+++ +  +  N          P YHY + YS++  V  Y++R+ PFTQ F++ Q G FD  DRMFH++  +W  ++      +KE+IPEFFYLPE  +NS +F+ G + NGTK+ DVILP W+ GD R F  +HR +LE  YVS  L+ W+DL+FG+KQ G  A+EA+N+FH   Y   +    I + ++ +A    I N+GQIPKQLF  K  P K++
Sbjct: 2598 DIREVHKRRYLLQPMAAEVFSGDGRNYLLAFQKGV-RNKVYQRFLAVVPSLADSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADFDSEELDLNNPKTFRNLSKPMGAQT-----------DDRLIQYKKRFKDWEDPNG-------ETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWLSASKHNMADVKELIPEFFYLPEFLLNSNNFDLGSKQNGTKLGDVILPPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPPAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLF-KKPHPPKRV 2963          
BLAST of Lysosomal trafficking regulator vs. Ensembl Zebrafish
Match: nbeal1 (neurobeachin-like 1 [Source:ZFIN;Acc:ZDB-GENE-130530-544])

HSP 1 Score: 262.307 bits (669), Expect = 3.739e-69
Identity = 179/533 (33.58%), Postives = 275/533 (51.59%), Query Frame = 1
Query: 7993 WKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVD---------KIVYENPI-----DCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRI--LSFIENILPPNANRKPRLI----DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGE-RLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF 9528
            W+        E+  W D   K   ++L   E  SR+R ++++  +    +  +       VQ +  + ESL  L E+  QV          +++ E+P      D +     E + IS  C LV     + G   +    I F +       S  ++     +DF    W L+ I  +  RR+ LR  ALE+ + D  N  +     + R+ +     +   L  +A   P+ +     + ++W   ++SNFDYL  LNT AGR+YND+ QYPVFP+IL++YTS  LDL+    +RDLSKP+++QN    E+      EK + ++        +  ID         +HY + YSN+A V++Y+IR+ PFT   IQ Q G FD  DR FH++ ++W     + + +KE+IPEFFY PE   N   F+ G  +++  +V+DVILP+W+      F   HR +LES +VS  L+ W+DL+FG+KQ G AA+EA+N+F+  TY  A+  D IT+E  R AVE MI N+GQ P QL 
Sbjct: 1360 WRAARRGLFCERGPWVDKQLKDIHWKLSSAENYSRMRLKLVRNYNFDTHREASALRDNLGVQHQQVNAESL--LLEAVKQVKVSDLEDDILELLEEDPASANQADSEEAGQKEKLVISEDCELVTVVDVYPGRLELTTQHIYFYD-------SSAEKEEGVGQDF---KWPLSQIREIHLRRYNLRRSALEIFLIDQTNYFLNFKKEV-RNTVYSRMLLLRSLSLHATHSPQELLKSSGLTQKWVNREISNFDYLMQLNTIAGRTYNDLAQYPVFPWILSDYTSEELDLSDPRVFRDLSKPVAVQN----ERNAKAVREKYESFE------DPTGTIDR--------FHYGTHYSNAAGVMHYLIRVEPFTSLHIQLQSGRFDCADRQFHSIPATWQTLMDNPNDVKELIPEFFYFPEFLENQNGFDLGRLQISKERVNDVILPKWAKSPED-FIYKHRKALESEFVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYCTYEGAVDLDAITDEKERKAVEGMISNFGQTPCQLL 1860          
BLAST of Lysosomal trafficking regulator vs. Ensembl Xenopus
Match: LYST (lysosomal trafficking regulator [Source:NCBI gene;Acc:779601])

HSP 1 Score: 350.517 bits (898), Expect = 1.253e-95
Identity = 245/794 (30.86%), Postives = 402/794 (50.63%), Query Frame = 1
Query: 7441 SVFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEEFIKSLSQLLFAIS------------PDFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGES----LTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF--INKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPN 9765
            ++   CK+  +  LG LL+ L      L +R +A+  V +      ++R CL         L L + +++   K    + E+    L      ++            PD  ++ ++E+ +    +ENE ++ A++K   +      Q  D R  ++S +         + ++   + + I +I++    +      W+ L+   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+    E+    L++LFE     DK         +     E I+++  CI V  S    GE  +                           +     W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD I   I N   PN      +  +   W  G+++NF+YLT LN  AGRS++D+MQYPVFPFIL++Y + TLDL+  + YR+L+KPI++Q+    ++ I+ +    DEY +  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES  VS  + +W+DLVFG+KQ G+AA++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF   + S P  K+            ++    +  G       +DS        +  S+D    + L  + G++WG++VGSP+
Sbjct: 2634 TILWSCKDTFRVQLGRLLVHLLSPSQPLEVRKQALDIV-QEPKHQEILRDCLSPGLQHGPKLALYLYELMHDHKEELTKEEQVAGGLFMNALKLTGYRCIPPSAPPKPDL-IKAISEEQKKYENEENENRV-AWRKTIINNQQKLFQRLDARSKDLS-KTAGDITQSVSLSQGMERKKVIQHIRSMYKVDLSASRHWQELVQQLTHDRAVWYDPESYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LRDRQKPEETVKPPLSYLFE-----DKTHSSFSSTVKDKAASERIRVTQRCINVAPSRETFGELLL---------------------------EAASFAWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKIRDDIYHNILNNNLPNLLEYGNITALTHLWCTGQITNFEYLTHLNKHAGRSFSDLMQYPVFPFILSDYFNETLDLSDSAIYRNLAKPIAVQSKEKEDRYIDNYKYLEDEYCKGDR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMKTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGLRQNGERVNHVNLPPWARNDPRLFILIHRQALESDNVSQTICHWIDLVFGYKQKGRAAVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLFHSAHVSRPGSKL-----------LMEGELPAAMGLLVQLAFRDS--------RDTSRDVGHPSPLPWIKGLKWGEYVGSPS 3355          
BLAST of Lysosomal trafficking regulator vs. Ensembl Xenopus
Match: LYST (lysosomal trafficking regulator [Source:NCBI gene;Acc:779601])

HSP 1 Score: 350.517 bits (898), Expect = 1.326e-95
Identity = 245/794 (30.86%), Postives = 402/794 (50.63%), Query Frame = 1
Query: 7441 SVFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEEFIKSLSQLLFAIS------------PDFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGES----LTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF--INKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPN 9765
            ++   CK+  +  LG LL+ L      L +R +A+  V +      ++R CL         L L + +++   K    + E+    L      ++            PD  ++ ++E+ +    +ENE ++ A++K   +      Q  D R  ++S +         + ++   + + I +I++    +      W+ L+   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+    E+    L++LFE     DK         +     E I+++  CI V  S    GE  +                           +     W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD I   I N   PN      +  +   W  G+++NF+YLT LN  AGRS++D+MQYPVFPFIL++Y + TLDL+  + YR+L+KPI++Q+    ++ I+ +    DEY +  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES  VS  + +W+DLVFG+KQ G+AA++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF   + S P  K+            ++    +  G       +DS        +  S+D    + L  + G++WG++VGSP+
Sbjct: 2587 TILWSCKDTFRVQLGRLLVHLLSPSQPLEVRKQALDIV-QEPKHQEILRDCLSPGLQHGPKLALYLYELMHDHKEELTKEEQVAGGLFMNALKLTGYRCIPPSAPPKPDL-IKAISEEQKKYENEENENRV-AWRKTIINNQQKLFQRLDARSKDLS-KTAGDITQSVSLSQGMERKKVIQHIRSMYKVDLSASRHWQELVQQLTHDRAVWYDPESYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LRDRQKPEETVKPPLSYLFE-----DKTHSSFSSTVKDKAASERIRVTQRCINVAPSRETFGELLL---------------------------EAASFAWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKIRDDIYHNILNNNLPNLLEYGNITALTHLWCTGQITNFEYLTHLNKHAGRSFSDLMQYPVFPFILSDYFNETLDLSDSAIYRNLAKPIAVQSKEKEDRYIDNYKYLEDEYCKGDR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMKTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGLRQNGERVNHVNLPPWARNDPRLFILIHRQALESDNVSQTICHWIDLVFGYKQKGRAAVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLFHSAHVSRPGSKL-----------LMEGELPAAMGLLVQLAFRDS--------RDTSRDVGHPSPLPWIKGLKWGEYVGSPS 3308          
BLAST of Lysosomal trafficking regulator vs. Ensembl Xenopus
Match: LYST (lysosomal trafficking regulator [Source:NCBI gene;Acc:779601])

HSP 1 Score: 350.517 bits (898), Expect = 1.362e-95
Identity = 245/794 (30.86%), Postives = 402/794 (50.63%), Query Frame = 1
Query: 7441 SVFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEEFIKSLSQLLFAIS------------PDFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGES----LTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF--INKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPN 9765
            ++   CK+  +  LG LL+ L      L +R +A+  V +      ++R CL         L L + +++   K    + E+    L      ++            PD  ++ ++E+ +    +ENE ++ A++K   +      Q  D R  ++S +         + ++   + + I +I++    +      W+ L+   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+    E+    L++LFE     DK         +     E I+++  CI V  S    GE  +                           +     W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD I   I N   PN      +  +   W  G+++NF+YLT LN  AGRS++D+MQYPVFPFIL++Y + TLDL+  + YR+L+KPI++Q+    ++ I+ +    DEY +  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES  VS  + +W+DLVFG+KQ G+AA++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF   + S P  K+            ++    +  G       +DS        +  S+D    + L  + G++WG++VGSP+
Sbjct: 2632 TILWSCKDTFRVQLGRLLVHLLSPSQPLEVRKQALDIV-QEPKHQEILRDCLSPGLQHGPKLALYLYELMHDHKEELTKEEQVAGGLFMNALKLTGYRCIPPSAPPKPDL-IKAISEEQKKYENEENENRV-AWRKTIINNQQKLFQRLDARSKDLS-KTAGDITQSVSLSQGMERKKVIQHIRSMYKVDLSASRHWQELVQQLTHDRAVWYDPESYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LRDRQKPEETVKPPLSYLFE-----DKTHSSFSSTVKDKAASERIRVTQRCINVAPSRETFGELLL---------------------------EAASFAWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKIRDDIYHNILNNNLPNLLEYGNITALTHLWCTGQITNFEYLTHLNKHAGRSFSDLMQYPVFPFILSDYFNETLDLSDSAIYRNLAKPIAVQSKEKEDRYIDNYKYLEDEYCKGDR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMKTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGLRQNGERVNHVNLPPWARNDPRLFILIHRQALESDNVSQTICHWIDLVFGYKQKGRAAVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLFHSAHVSRPGSKL-----------LMEGELPAAMGLLVQLAFRDS--------RDTSRDVGHPSPLPWIKGLKWGEYVGSPS 3353          
BLAST of Lysosomal trafficking regulator vs. Ensembl Xenopus
Match: LYST (lysosomal trafficking regulator [Source:NCBI gene;Acc:779601])

HSP 1 Score: 350.517 bits (898), Expect = 1.455e-95
Identity = 245/794 (30.86%), Postives = 402/794 (50.63%), Query Frame = 1
Query: 7441 SVFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEEFIKSLSQLLFAIS------------PDFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGES----LTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF--INKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPN 9765
            ++   CK+  +  LG LL+ L      L +R +A+  V +      ++R CL         L L + +++   K    + E+    L      ++            PD  ++ ++E+ +    +ENE ++ A++K   +      Q  D R  ++S +         + ++   + + I +I++    +      W+ L+   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+    E+    L++LFE     DK         +     E I+++  CI V  S    GE  +                           +     W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD I   I N   PN      +  +   W  G+++NF+YLT LN  AGRS++D+MQYPVFPFIL++Y + TLDL+  + YR+L+KPI++Q+    ++ I+ +    DEY +  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES  VS  + +W+DLVFG+KQ G+AA++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF   + S P  K+            ++    +  G       +DS        +  S+D    + L  + G++WG++VGSP+
Sbjct: 2626 TILWSCKDTFRVQLGRLLVHLLSPSQPLEVRKQALDIV-QEPKHQEILRDCLSPGLQHGPKLALYLYELMHDHKEELTKEEQVAGGLFMNALKLTGYRCIPPSAPPKPDL-IKAISEEQKKYENEENENRV-AWRKTIINNQQKLFQRLDARSKDLS-KTAGDITQSVSLSQGMERKKVIQHIRSMYKVDLSASRHWQELVQQLTHDRAVWYDPESYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LRDRQKPEETVKPPLSYLFE-----DKTHSSFSSTVKDKAASERIRVTQRCINVAPSRETFGELLL---------------------------EAASFAWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKIRDDIYHNILNNNLPNLLEYGNITALTHLWCTGQITNFEYLTHLNKHAGRSFSDLMQYPVFPFILSDYFNETLDLSDSAIYRNLAKPIAVQSKEKEDRYIDNYKYLEDEYCKGDR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMKTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGLRQNGERVNHVNLPPWARNDPRLFILIHRQALESDNVSQTICHWIDLVFGYKQKGRAAVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLFHSAHVSRPGSKL-----------LMEGELPAAMGLLVQLAFRDS--------RDTSRDVGHPSPLPWIKGLKWGEYVGSPS 3347          
BLAST of Lysosomal trafficking regulator vs. Ensembl Xenopus
Match: LYST (lysosomal trafficking regulator [Source:NCBI gene;Acc:779601])

HSP 1 Score: 350.517 bits (898), Expect = 1.501e-95
Identity = 245/794 (30.86%), Postives = 402/794 (50.63%), Query Frame = 1
Query: 7441 SVFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEEFIKSLSQLLFAIS------------PDFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGES----LTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF--INKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPN 9765
            ++   CK+  +  LG LL+ L      L +R +A+  V +      ++R CL         L L + +++   K    + E+    L      ++            PD  ++ ++E+ +    +ENE ++ A++K   +      Q  D R  ++S +         + ++   + + I +I++    +      W+ L+   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+    E+    L++LFE     DK         +     E I+++  CI V  S    GE  +                           +     W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD I   I N   PN      +  +   W  G+++NF+YLT LN  AGRS++D+MQYPVFPFIL++Y + TLDL+  + YR+L+KPI++Q+    ++ I+ +    DEY +  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES  VS  + +W+DLVFG+KQ G+AA++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF   + S P  K+            ++    +  G       +DS        +  S+D    + L  + G++WG++VGSP+
Sbjct: 2615 TILWSCKDTFRVQLGRLLVHLLSPSQPLEVRKQALDIV-QEPKHQEILRDCLSPGLQHGPKLALYLYELMHDHKEELTKEEQVAGGLFMNALKLTGYRCIPPSAPPKPDL-IKAISEEQKKYENEENENRV-AWRKTIINNQQKLFQRLDARSKDLS-KTAGDITQSVSLSQGMERKKVIQHIRSMYKVDLSASRHWQELVQQLTHDRAVWYDPESYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LRDRQKPEETVKPPLSYLFE-----DKTHSSFSSTVKDKAASERIRVTQRCINVAPSRETFGELLL---------------------------EAASFAWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKIRDDIYHNILNNNLPNLLEYGNITALTHLWCTGQITNFEYLTHLNKHAGRSFSDLMQYPVFPFILSDYFNETLDLSDSAIYRNLAKPIAVQSKEKEDRYIDNYKYLEDEYCKGDR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMKTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGLRQNGERVNHVNLPPWARNDPRLFILIHRQALESDNVSQTICHWIDLVFGYKQKGRAAVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLFHSAHVSRPGSKL-----------LMEGELPAAMGLLVQLAFRDS--------RDTSRDVGHPSPLPWIKGLKWGEYVGSPS 3336          
BLAST of Lysosomal trafficking regulator vs. Ensembl Mouse
Match: Lyst (lysosomal trafficking regulator [Source:MGI Symbol;Acc:MGI:107448])

HSP 1 Score: 379.407 bits (973), Expect = 2.020e-104
Identity = 258/808 (31.93%), Postives = 413/808 (51.11%), Query Frame = 1
Query: 7936 EFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSG----ESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFH-TMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF--INKSFPAKKINWRNIKNTAPRNI----QHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSKMTSKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXI---AVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWD 10317
            + I +I+     +      W+  I   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+  S       L++LFE     DK         +     E I+++  CI V  S    GE  +GK  + F+ED  ++   E   L   L+   F +W   +I+ V RR ++LRD A+E+ + +GR  L+A ++   RD +   I     PN      +  +   W  G+++NF+YLT LN  AGRS+ND+MQYPVFPFIL++Y S TLDL   S YR+LSKPI++Q     ++ ++ +    +EY++  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH T  +    S  S++ +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES +VS  + +W+DLVFG+KQ GKA+++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF   + S P  K+N   I+   P  +    Q +F   +                E +K ++      + L+ + G++WG++VGSP ++   +    +      G+L  LPT  +          +     +LM    E+G +       + N   +Q  ++     ++N ++L++  S              +   A    S ++F G + G+IT Y   +   + +   +++  H    L GH  EI  L +C  ++V+ S        +WD
Sbjct: 2890 KVIQHIRGMYKVDLSASRHWQECIQQLTHDRAVWYDPIYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LRDRQKSEGVLRPPLSYLFE-----DKTHSSFSSTVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDAV-ESSSLQGELEPASF-SWTYEEIKEVHRRWWQLRDNAVEIFLTNGRTLLLAFDNNKVRDDVYQSILTNNLPNLLEYGNITALTNLWYSGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILSDYVSETLDLNDPSIYRNLSKPIAVQYKEKEDRYVDTYKYLEEEYRKGAR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDHVSQNICHWIDLVFGYKQKGKASVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLFHTAHASRPGAKLN---IEGELPAAVGLLVQFAFRETR----------------EPVKEVTHP----SPLSWIKGLKWGEYVGSP-SAPVPVVCFSQPHGERFGSLQALPTRAICG--------LSRNFCLLMTYNKEQGVR-------SMNNTNIQWSAILSWGYADNILRLKSKQSEPPINFIQSSQQHQVTSCAWVPDSCQLFTGSKCGVITAYTNRLTSSTPSEIEMESQMH----LYGHTEEITGLCVCKPYSVMISVSRDGTCIVWD 3630          
BLAST of Lysosomal trafficking regulator vs. Ensembl Mouse
Match: Wdfy3 (WD repeat and FYVE domain containing 3 [Source:MGI Symbol;Acc:MGI:1096875])

HSP 1 Score: 277.715 bits (709), Expect = 1.074e-73
Identity = 157/420 (37.38%), Postives = 239/420 (56.90%), Query Frame = 1
Query: 8470 DIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILP-------------PNAN--RKPRLID-------IQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDK-GYQDTDQMKDSI 9657
            DI+ V +RR+ L+  A+E+   DGRN L+A    + R+++      ++P             PN +  +   L+        + + W  G++SNF YL  LNT AGRSYND+MQYPVFP+IL++Y S  +DLT   T+R+L+KP+  Q             E+  +Y+++ +  +  N          P YHY + YS++  V  Y++R+ PFTQ F++ Q G FD  DRMFH++  +W+ ++      +KE+IPEFFYLPE   NS +F+ G + NGTK+ DVILP W+ GD R F  +HR +LE  YVS  L+ W+DL+FG+KQ G AA+EA+N+FH   Y   +    I + ++ +A    I N+GQIPKQLF  K  P K++  R   +    ++    +SDK  +   D ++ S+
Sbjct: 2595 DIKEVHKRRYLLQPIAVEVFSGDGRNYLLAFQKGI-RNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILSDYDSEEVDLTNPKTFRNLAKPMGAQT-----------DERLAQYKKRYKDWEDPNG-------ETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVILPPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLF-KKPHPPKRVRSRLNGDNIGISVPPGATSDKIFFHHLDNLRPSL 2994          
BLAST of Lysosomal trafficking regulator vs. Ensembl Mouse
Match: Wdfy3 (WD repeat and FYVE domain containing 3 [Source:MGI Symbol;Acc:MGI:1096875])

HSP 1 Score: 277.715 bits (709), Expect = 1.133e-73
Identity = 157/420 (37.38%), Postives = 239/420 (56.90%), Query Frame = 1
Query: 8470 DIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILP-------------PNANRK------PRLI---DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDK-GYQDTDQMKDSI 9657
            DI+ V +RR+ L+  A+E+   DGRN L+A    + R+++      ++P             PN + +        L+    + + W  G++SNF YL  LNT AGRSYND+MQYPVFP+IL++Y S  +DLT   T+R+L+KP+  Q             E+  +Y+++ +  +  N          P YHY + YS++  V  Y++R+ PFTQ F++ Q G FD  DRMFH++  +W+ ++      +KE+IPEFFYLPE   NS +F+ G + NGTK+ DVILP W+ GD R F  +HR +LE  YVS  L+ W+DL+FG+KQ G AA+EA+N+FH   Y   +    I + ++ +A    I N+GQIPKQLF  K  P K++  R   +    ++    +SDK  +   D ++ S+
Sbjct: 2613 DIKEVHKRRYLLQPIAVEVFSGDGRNYLLAFQKGI-RNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILSDYDSEEVDLTNPKTFRNLAKPMGAQT-----------DERLAQYKKRYKDWEDPNG-------ETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVILPPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLF-KKPHPPKRVRSRLNGDNIGISVPPGATSDKIFFHHLDNLRPSL 3012          
BLAST of Lysosomal trafficking regulator vs. Ensembl Mouse
Match: Wdfy3 (WD repeat and FYVE domain containing 3 [Source:MGI Symbol;Acc:MGI:1096875])

HSP 1 Score: 277.715 bits (709), Expect = 1.199e-73
Identity = 157/420 (37.38%), Postives = 239/420 (56.90%), Query Frame = 1
Query: 8470 DIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILP-------------PNAN--RKPRLID-------IQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDK-GYQDTDQMKDSI 9657
            DI+ V +RR+ L+  A+E+   DGRN L+A    + R+++      ++P             PN +  +   L+        + + W  G++SNF YL  LNT AGRSYND+MQYPVFP+IL++Y S  +DLT   T+R+L+KP+  Q             E+  +Y+++ +  +  N          P YHY + YS++  V  Y++R+ PFTQ F++ Q G FD  DRMFH++  +W+ ++      +KE+IPEFFYLPE   NS +F+ G + NGTK+ DVILP W+ GD R F  +HR +LE  YVS  L+ W+DL+FG+KQ G AA+EA+N+FH   Y   +    I + ++ +A    I N+GQIPKQLF  K  P K++  R   +    ++    +SDK  +   D ++ S+
Sbjct: 2599 DIKEVHKRRYLLQPIAVEVFSGDGRNYLLAFQKGI-RNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILSDYDSEEVDLTNPKTFRNLAKPMGAQT-----------DERLAQYKKRYKDWEDPNG-------ETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVILPPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLF-KKPHPPKRVRSRLNGDNIGISVPPGATSDKIFFHHLDNLRPSL 2998          
BLAST of Lysosomal trafficking regulator vs. Ensembl Mouse
Match: Wdfy4 (WD repeat and FYVE domain containing 4 [Source:MGI Symbol;Acc:MGI:3584510])

HSP 1 Score: 268.085 bits (684), Expect = 8.007e-71
Identity = 192/620 (30.97%), Postives = 303/620 (48.87%), Query Frame = 1
Query: 7900 NYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYR--LDPIEGPSRIRRRM--IKTTHKINDKYFNPTSPARNV-------QDKSSSGES-------------LTF---LFESTYQVD--KIVYENPIDCQLLKCIEDIQISCPCILVCESGHF--KGEFFVGKWRIGFLED----RVNNLYSEYDELPNYLKDFGF-------------INWHL-NDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILP----------PNANRKPRLID---IQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRN 9570
            NYR   ++     +   ++ +++       +W  +      E  +W    + ++  R  LD  EGP+R+R+R+  +     +N  Y        +V       QD+ ++ E+             LTF   L ES +  D  ++  E  +  Q L   E +    P ++V   GH   +G    G+      E+       ++Y  +  L N    F F                H  +D+  + + RF L+D ALE+  ++G + L+   ++ +R + L       P          P   RK    D   +QR W + ++SNF+YL +LNT AGR+YND MQYPVFP++L +YTS  L+LT   T+RDLSKP+  Q                   +R+L+  Q   +++++        HY + YS++  V  Y++R+PPFTQ F   Q G FD  DRMFH++ S+W  ++      ++E+ PEFFYLPE   N     FG   +GT + DV LP W+ GD R F  +HR +LES +VS+ L++W+DL+FG+KQ G AA+EA+N FHPY Y   I    IT+ + +S +   I N+GQ+PKQ+F  K  P++    +N
Sbjct: 2069 NYRRKGQELYASIYKDYVQRRKSGSIKAATAWARMREQLFGELGLWGQMTESTRCSRWELDGREGPARMRKRIRHLLAWEPLNLGYKESQEGKGDVSQTNTGNQDELTTEEAESRPDEVGVDCTQLTFFPALHESLHSEDFLELCRERQVILQELLDGEKVSQKVPMVIV--QGHLVSEGILLFGQHHFYICENFTLSPTGDVYCTHHCLSNISDPFIFNMCSKDRSSDHYSCQRHAYSDLRELRQARFLLQDIALEIFFQNGYSKLLVFYNS-DRSKALKSFSTFQPSLKGKGTTEDPFNLRKHPGFDRTMLQR-WQKREISNFEYLMYLNTLAGRTYNDYMQYPVFPWVLADYTSEMLNLTNPKTFRDLSKPMGAQT-----------------KERKLKFTQRFKDVEKIEGDMTVQCHYYTHYSSAIIVASYLVRMPPFTQAFCSLQGGSFDVADRMFHSVKSTWESASKENMSDVRELTPEFFYLPEFLTNCNAVEFGCMQDGTTLGDVQLPPWADGDPRKFISLHRQALESDFVSSNLHHWIDLIFGYKQQGPAAVEAVNTFHPYFYGDRIDLGSITDPLIKSTILGFISNFGQVPKQIF-TKPHPSRNTTGKN 2666          
BLAST of Lysosomal trafficking regulator vs. UniProt/SwissProt
Match: sp|Q99698|LYST_HUMAN (Lysosomal-trafficking regulator OS=Homo sapiens OX=9606 GN=LYST PE=1 SV=3)

HSP 1 Score: 385.956 bits (990), Expect = 1.369e-105
Identity = 297/984 (30.18%), Postives = 482/984 (48.98%), Query Frame = 1
Query: 7444 VFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEEFIKSLSQLLFA--------ISPDFS-----VEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGE----SLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFH-TMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF--INKSFPAKKINWRNIKNTAPRNI----QHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSKMT--SKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWD 10317
            +   CKE  +  LG LL+ +     +   R +  + V    N   ++R CL  +      L+L + +++ +    G  TEE + +   L+ A        I P  S     ++ + E+ +    +E   K  A++K   +   +  Q  D +  ++S ++        + ++ N + + I +I+     +      W+ LI   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+  S +     L++LFE     DK         +     E I+++  CI V  S    GE  +GK  + F+ED  ++   E   L   L+   F +W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD +   I     PN      +  +   W  G+++NF+YLT LN  AGRS+ND+MQYPVFPFIL +Y S TLDL     YR+LSKPI++Q     ++ ++ +    +EY++  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH T  +    S  S++ +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES YVS  +  W+DLVFG+KQ GKA+++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF   + S P  K+N   I+   P  +    Q +F   +                E +K ++      + L+ + G++WG++VGSP ++   +    +      G+L  LPT  +   S+    ++   +   V  +  T+      + +  A N  R++        P  N +Q            S Q  V S A    S ++F G + G+IT Y       + +   ++   H    L GH  EI  L +C  +++L S        IWD
Sbjct: 2732 ILWSCKETFRMQLGRLLVHILSPAHAAQERKQIFEIVHE-PNHQEILRDCLSPSLQHGAKLVLYLSELIHN--HQGELTEEELGTAELLMNALKLCGHKCIPPSASTKADLIKMIKEEQKKYETEEGVNK-AAWQKTVNNNQQSLFQRLDSKSKDIS-KIAADITQAVSLSQGNERKKVIQHIRGMYKVDLSASRHWQELIQQLTHDRAVWYDPIYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LRDRQKSEDVVKPPLSYLFE-----DKTHSSFSSTVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDTV-ESSSLQGELEPASF-SWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKVRDDVYHNILTNNLPNLLEYGNITALTNLWYTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILADYVSETLDLNDLLIYRNLSKPIAVQYKEKEDRYVDTYKYLEEEYRKGAR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDYVSQNICQWIDLVFGYKQKGKASVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLFHMAHVSRPGAKLN---IEGELPAAVGLLVQFAFRETR----------------EQVKEITYP----SPLSWIKGLKWGEYVGSP-SAPVPVVCFSQPHGERFGSLQALPTRAICGLSRNFCLLMTYSKEQGVRSMNSTDIQWSAILSWGYADNILRLKSKQ---SEPPVNFIQ-----------SSQQYQVTSCAWVPDSCQLFTGSKCGVITAYTNRFTSSTPSEIEMETQIH----LYGHTEEITSLFVCKPYSILISVSRDGTCIIWD 3644          

HSP 2 Score: 63.5438 bits (153), Expect = 5.012e-8
Identity = 64/238 (26.89%), Postives = 114/238 (47.90%), Query Frame = 1
Query: 5020 SVDSAIENLGGISIMIFWLAKVVE-SGDEVSTRYXXXXXXXXXRKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQHMIYED------PTKSKLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQ---EPFEALEHPLPVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHP 5703
            ++   +  +GG  I +F  A+VVE S  E +    L++IL LI+ +    H+     G S++ Q+    K  +GF I+  L++    ED        + KL +  N+ + +D ++L ELL+ WKI        SK E  + E         LL  +  L+  D+   + N   L    ++   L++CQ   E  E    P+P  +C+  ++II  ++ +P D+ ++T + N +L +HP
Sbjct: 1800 TIQGILHEIGGTGIFVFLFARVVELSSCEETQALALRVILSLIKYNQQRVHELENCNGLSMIHQVLIKQKCIVGFYILKTLLEGCCGEDIIYMNENGEFKLDVDSNA-IIQDVKLLEELLLDWKIW-------SKAEQGVWET--------LLAALEVLIRADHHQQMFNIKQLLKAQVVHHFLLTCQVLQEYKEGQLTPMPREVCRSFVKIIAEVLGSPPDLELLTIIFNFLLAVHP 2021          
BLAST of Lysosomal trafficking regulator vs. UniProt/SwissProt
Match: sp|Q9TTK4|LYST_BOVIN (Lysosomal-trafficking regulator OS=Bos taurus OX=9913 GN=LYST PE=1 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 6.475e-105
Identity = 297/984 (30.18%), Postives = 483/984 (49.09%), Query Frame = 1
Query: 7444 VFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEEFIKSLSQLLFA--------ISPDFSVED-----LNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGE----SLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFH-TMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF--INKSFPAKKINWRNIKNTAPRNI----QHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSKMT--SKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWD 10317
            +   CKE  +  LG LL+ +         R +  + V R  N   ++R CL  +      L+L + +++ + K     TEE + +   L+ A        I P  S +      + E+ R    +E   K N ++K   +   +  Q  D +  ++S ++        + ++   + + I +I+     +      W+ LI   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+  S +     L++LFE     DK         +     E I+++  CI V  S    GE  +GK  + F+ED  ++   E   L   L+   F +W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  R+ +   I     PN      +  +   W  G+++NF+YLT LN  AGRS+ND+MQYPVFPFIL +Y S TLDL+  S YR+LSKPI++Q     ++ ++ +    +EY++  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH T  +    S  S++ +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES YVS  +  W+DLVFG+KQ GKA+++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF   + S P  K+N   I+   P  +    Q +F   +                E +K ++      + L+ + G++WG++VGSP ++   +    +      G+L  LPT  +   S+    ++   +   V  +  T+      + +  A N  R++        P  N +Q            S Q  V S A    S ++F G + G+IT Y       + +   +++  H    L GH  EI  L +C  ++++ S        IWD
Sbjct: 2727 ILWSCKETFRMQLGRLLVHMLSPAHPSQERKQIFEIV-REPNHQEILRECLSPSLQHGAKLVLYLSELIHNHK--DELTEEELDTAELLMNALKLCGHKCIPPSASTKSDLIRVIKEEQRKYETEEGVNKAN-WQKTVNNNQQSLFQRLDSKSKDIS-KIAADITQAVSLSQGIERKKVIQHIRGMYKVDLSASRHWQELIQQLTHDRAVWYDPIYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LRDRQKSEDVVKPPLSYLFE-----DKTHSSFSSTVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDTV-ECSNLQGELEPASF-SWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKVRNDVYHSILTNNLPNLLEYGNITALTHLWYTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILADYVSETLDLSDPSVYRNLSKPIAVQYKEKEDRYVDTYKYLEEEYRKGAR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDYVSQNICQWIDLVFGYKQKGKASVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLFQSAHASRPGSKLN---IEGELPAAVGLLVQFAFRETR----------------EQVKEITYP----SPLSWIKGLKWGEYVGSP-SAPVPVVCFSQPHGERFGSLQALPTRAICGLSRNFCLLMTYSKEQGVRSMNSTDIQWSAILSWGYADNILRLKSKQ---SEPPINFIQ-----------SSQQYQVTSCAWVPDSCQLFTGSKCGVITAYSNRFTSGTPSEIEMESQIH----LYGHTEEISSLFVCKPYSIMISVSRDGTCIIWD 3639          

HSP 2 Score: 56.225 bits (134), Expect = 9.263e-6
Identity = 61/241 (25.31%), Postives = 109/241 (45.23%), Query Frame = 1
Query: 5020 SVDSAIENLGGISIMIFWLAKVVESGDEVSTRYXXXXXXXXXRKSVFLAHQNIEE----KGYSVLLQLFKSFKMTLGFDIISDLVQHMIYED------PTKSKLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQEPFEALEHPL---PVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHP 5703
            ++   +  +GG  I +F  A+VVE      T+ L   ++L + K      Q I E     G S++ Q+    K  +GF I+  L++    ED        + KL +  N+ + +D ++L ELL+ WKI        +K E  + E         LL  +  L+  D+   + N   L    ++   L++CQ   E  E  L   P  +C+  ++I   ++ +P D+ ++T + N +L +HP
Sbjct: 1795 TLQGILHEIGGTGIFVFLFARVVELSSCEETQALALRVILSLIK---YNQQRIHELENCNGLSMIHQVLIKQKCIVGFHILKTLLEGCCGEDIIHINENGELKLDVESNA-IIQDVKLLEELLLDWKIW-------NKAEHGVWET--------LLAALEVLIRADHQQQMFNIKQLLKARVVHHFLLTCQVLQEHKEGQLISMPQEVCRSFVKITAEVLGSPPDLELLTIIFNFLLAVHP 2016          
BLAST of Lysosomal trafficking regulator vs. UniProt/SwissProt
Match: sp|P97412|LYST_MOUSE (Lysosomal-trafficking regulator OS=Mus musculus OX=10090 GN=Lyst PE=1 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 1.474e-103
Identity = 258/808 (31.93%), Postives = 413/808 (51.11%), Query Frame = 1
Query: 7936 EFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSG----ESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFH-TMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF--INKSFPAKKINWRNIKNTAPRNI----QHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSKMTSKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXI---AVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWD 10317
            + I +I+     +      W+  I   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+  S       L++LFE     DK         +     E I+++  CI V  S    GE  +GK  + F+ED  ++   E   L   L+   F +W   +I+ V RR ++LRD A+E+ + +GR  L+A ++   RD +   I     PN      +  +   W  G+++NF+YLT LN  AGRS+ND+MQYPVFPFIL++Y S TLDL   S YR+LSKPI++Q     ++ ++ +    +EY++  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH T  +    S  S++ +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES +VS  + +W+DLVFG+KQ GKA+++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF   + S P  K+N   I+   P  +    Q +F   +                E +K ++      + L+ + G++WG++VGSP ++   +    +      G+L  LPT  +          +     +LM    E+G +       + N   +Q  ++     ++N ++L++  S              +   A    S ++F G + G+IT Y   +   + +   +++  H    L GH  EI  L +C  ++V+ S        +WD
Sbjct: 2891 KVIQHIRGMYKVDLSASRHWQECIQQLTHDRAVWYDPIYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LRDRQKSEGVLRPPLSYLFE-----DKTHSSFSSTVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDAV-ESSSLQGELEPASF-SWTYEEIKEVHRRWWQLRDNAVEIFLTNGRTLLLAFDNNKVRDDVYQSILTNNLPNLLEYGNITALTNLWYSGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILSDYVSETLDLNDPSIYRNLSKPIAVQYKEKEDRYVDTYKYLEEEYRKGAR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDHVSQNICHWIDLVFGYKQKGKASVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLFHTAHASRPGAKLN---IEGELPAAVGLLVQFAFRETR----------------EPVKEVTHP----SPLSWIKGLKWGEYVGSP-SAPVPVVCFSQPHGERFGSLQALPTRAICG--------LSRNFCLLMTYNKEQGVR-------SMNNTNIQWSAILSWGYADNILRLKSKQSEPPINFIQSSQQHQVTSCAWVPDSCQLFTGSKCGVITAYTNRLTSSTPSEIEMESQMH----LYGHTEEITGLCVCKPYSVMISVSRDGTCIVWD 3631          
BLAST of Lysosomal trafficking regulator vs. UniProt/SwissProt
Match: sp|Q86JF2|LVSB_DICDI (BEACH domain-containing protein lvsB OS=Dictyostelium discoideum OX=44689 GN=lvsB PE=4 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 2.152e-75
Identity = 161/382 (42.15%), Postives = 223/382 (58.38%), Query Frame = 1
Query: 8452 INWHLNDIEWVLRRRFKLRDYALEMIMKDG---RNCLIAMNSTLERDRILSFIENILPPN-------ANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINW 9564
            I W  +DI  + +RR  L++ A+E+ +  G   +  L A N   +RD +   I +   PN        +     + I ++W  G +SNF+YL  LNT AGRS+ND+ QYP+FPFIL +Y S  LDL   +T+RD +KP+  Q+    EK I       ++Y   L M +              PYHY S YSN  +VL++++R+ PFT  FI FQ G FD PDR FH++A SW+LS+S  +  +KE+IPEFFYL +  VNS  F  G + NG KVDDVILP W+  D RLF   H  +LE  YVS  L++W+DL+FG+KQ G+AA++A N+F P TY  A+  D I +++ R A    I +YGQ PKQ+F     P  K NW
Sbjct: 3426 ITWSYDDIIEIHKRRHVLKNNAIEIFLGSGVPHKTYLFAFNKPSDRDIVYDLIMSKPLPNRVDYAAEVHGNILKMSITKKWQSGLISNFEYLMHLNTLAGRSFNDLTQYPIFPFILRDYESEVLDLENPNTFRDFTKPMGAQDPKRLEKFI-------EKYNDLLEMNE-------------KPYHYGSHYSNIGSVLHFLVRLQPFTSYFIDFQGGRFDVPDRAFHSIAQSWNLSSSISNSDVKELIPEFFYLSDFLVNSNKFFMGIKQNGVKVDDVILPPWAHNDPRLFIKKHNEALECKYVSENLHHWIDLLFGYKQQGEAAVKAHNMFFPLTYEGAVDIDSIEDQLNRDAAVAQIHSYGQTPKQIFTK---PHPKKNW 3784          
BLAST of Lysosomal trafficking regulator vs. UniProt/SwissProt
Match: sp|Q55DM1|LVSA_DICDI (BEACH domain-containing protein lvsA OS=Dictyostelium discoideum OX=44689 GN=lvsA PE=4 SV=2)

HSP 1 Score: 284.648 bits (727), Expect = 7.625e-75
Identity = 170/461 (36.88%), Postives = 247/461 (53.58%), Query Frame = 1
Query: 8284 IEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLY-SEYDELPNYLKDFG-FINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRIL-SFIENILPPNA----------------------------NRKPRLIDIQRE------WAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXX-XXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAK 9552
            IE I I CP  +    G++K E       I  +E+++N+ +  E   LP   K    F+ W   DI  VL+RR+ LR  ALE+   DGRN L+       RD +  + + N+   N                               + R   I R+      W +G++SNF YL  LNT AGRSYND+ QYPVFP++L++Y S  LD+     YRDLSKP+    G L E     F E+ + +  Q                 VP +HY + YS++A VLYY+IR+ PFTQ F++ Q G +D+PDR+F ++  +    S  S   + E+IPEF+YL E  VN+  FNFG +  G  +DD+ILP W+ G  + F  +HR +LES YVS  L+ W+DL+FG++Q GKAA +++N+F+  TY  A+  D I++ + ++A    I N+GQ PKQLF +K  P +
Sbjct: 2827 IEGILIFCPVYMYIFDGYYKDE---NTGDISEVEEKINSEWLPEGTVLPMKKKIIHYFLKWAYEDIRDVLKRRYLLRQVALEIFSTDGRNNLVVYRDEPTRDEVYHTLVNNVSSHNTIGGDAQGITGGQTGNDDNDDHHGGGGGRGVRDRFTSIWRKSPLTLKWQQGQISNFQYLMHLNTLAGRSYNDLTQYPVFPWVLSDYESEELDIDDPKVYRDLSKPM----GALEESRAQKFRERFENWDDQEPNEHGHK---------VPKFHYGTHYSSAAIVLYYLIRLEPFTQHFLKLQGGRWDQPDRLFSSITEAWASSSQGSTGVVMELIPEFYYLDEFLVNNNKFNFGTKQGGEPIDDIILPPWAKGSPQEFIKLHRKALESDYVSEHLHEWIDLIFGYRQQGKAADDSLNVFYYLTYEGAVNIDAISDPVEKAATIAQINNFGQTPKQLF-DKPHPKR 3270          
BLAST of Lysosomal trafficking regulator vs. TrEMBL
Match: A0A4Z2H9X9 (Lysosomal-trafficking regulator OS=Liparis tanakae OX=230148 GN=LYST_0 PE=4 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 7.047e-123
Identity = 311/1019 (30.52%), Postives = 496/1019 (48.68%), Query Frame = 1
Query: 7801 AYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHE-FISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYD-----ELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSKMT--SKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQXXXXXXXXXXXXIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNSQYISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGRLTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESG 10830
            A++KK  +   N  Q  D +  ++S    +   N     R+ ++ +  I +I+    ++      W+ L+   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY       R  +D  ++   L+FL E     DK         +     E I+ +  CI V  S    GE  +GK  + F+ED   + +         E P++       +W   +I+ V +R ++LRD A+E+ + +GR  LIA ++T  RD +   I     PN      +  + + W  G++SNF+YLT LN  AGRS+ND+MQYPVFPFIL +YTS T+DL   S YR+L KPI++Q     ++ ++ +    +EY++ +R        D M    V PYHY S YSNS TVL++M+R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES  VS  L  W+DLVFG KQ GKAA+ AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF          +  ++    P+ ++    +  G       +++ E         +K+  C + L  + G++WG++VGSP+          +      G+L  LPT  +   S++   M++  +   V  +  T+      + +  A N  R++        P  N +Q   L             V S A      ++F G + G+IT Y  + F  + +   V++  H    L GH  E+  L +C  +++L S        +WD   L  L Y+                               Q  +   + V+A+S SET GD+         +V     S++ L+T+NG  +  +     + S++++   EG +VN IA   + G + + S+W+L+ V +V   +   S PI ++ Y+  G  LY  N  G
Sbjct:   63 AWEKKMTNTQRNLLQRLDGKSKDISKIAADITQN--VSLRQGMERKKVIQHIRGLYKTDLSASRHWQELVQQLTHDRAVWYDQTSYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--LKDRRKAED--AAKPPLSFLVE-----DKTHSSFSSTVKDKATSEPIRFTRRCISVVPSRETAGELLLGKSGMFFVEDNAADAHDNQSLHGETEAPSF-------SWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLIAFDNTKFRDDVYHNILTSDLPNLLEHGNITALTQLWGLGQISNFEYLTHLNKHAGRSFNDLMQYPVFPFILRDYTSETIDLQDISIYRNLIKPIAVQTKEKEDRYVDNYRYLEEEYKKGIR------EDDPMP--PVQPYHYGSHYSNSGTVLHFMVRMPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRLSSFESMTDVKELIPEFFYLPEFLVNREGFDFGIRQNGERVNHVNLPPWARNDPRLFILIHRQALESDQVSQTLCQWIDLVFGLKQKGKAAVHAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLF----------SASHVSRAGPKLMEGELPAAMGLLVQLAFRETREQ--------AKEIVCPSPLPWIKGLKWGEYVGSPSAPDPV-VCFSQPHGERFGSLLALPTRAICGLSRKFCLMMIYSKEQGVRSMHSTDIQWSAILSWGYADNILRLKSKQ---SEPPINFIQCSQL-----------HQVTSCAWVPDGCQLFTGSKCGVITAY-SNRFTSTTSDMEVESKVH----LYGHTGEVTSLFVCKPYSILISVSQDGTCILWD---LNRLCYV-------------------------------QSLTGHKSPVTAVSASETTGDIATV----CDSVGGG--SDLRLWTVNGDLIGHVHCREIICSVAFSNQPEGVSVNVIAGGLENGVVRLWSTWDLKPVREVTFSK--SSKPIISLTYSCDGHHLYTANSEG 974          
BLAST of Lysosomal trafficking regulator vs. TrEMBL
Match: A0A3B3U614 (Lysosomal trafficking regulator OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 6.847e-120
Identity = 333/1160 (28.71%), Postives = 550/1160 (47.41%), Query Frame = 1
Query: 7444 VFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEH----VKRSGNQTEEFIKSLSQLLFAISP-------DFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGES----LTFLFE-------STYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEY-----DELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSKMT--SKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQXXXXXXXXXXXXIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNSQ-YISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGRLTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESG 10830
            +   CK+  +  +G LL+      L L  R EA++ VF   + D +      G   G    +   + + +H     K   +    F+ SL    +   P       D  ++ + ED      +E   K  A++KK  +   N  Q  D +  ++S    +   N  +  +   + + I +I+    ++      W+ L+   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+    E+    L+FLFE       S+   DK   E+            I+ +  C  V  S    GE  +GK  + F+ED   + +         E P++       +W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD +   I     PN      ++ + + W+ G+++NF+YLT LN  AGRS+ND+MQYPVFPFIL++Y S T+DL   + YR+L+KPI++Q+    ++ ++ +    +EY++ +R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES +VS  L  W+DLVFG KQ GKAA+ AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF          +  +I  TAP+ +          +    M   ++      +  +K+  C + L  + G++WG++VGSP+          +      G+L  LPT  +   S+    M++  +   V  +  T+      + +  A N  R++        P  N +Q   L             V S A      ++F G + G+IT Y       + +   V++  H    L GH  E+  L +C  +++L S        +WD   L  L Y+                               Q  +   + V+A+S SET GD+           NS+   S++ L+T+NG  +  +    T+ S++++   EG +VN IA   + G + + S+W+L+ V ++  P+   S PI ++ Y+  G  LY  N  G
Sbjct: 2483 ILWSCKDTFRVQIGRLLVHTLSPSLPLQDRKEALEFVFDHKHIDILKESLSPGLEHGPKLSLYLFEMLHDHKDELTKEEQSAVGVFMTSLKLCGYRCIPLNVPHKHDL-LKAIKEDKMKFEAEEKTSK-AAWEKKMANTQKNLIQRLDGKSKDISKIAADITQNV-SLKQGMERKKVIQHIRGLYKTDLSASRHWQELVQQLTHDRAVWYDQTSYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LKDRRKPEETVKPPLSFLFEDKTHSFFSSTVKDKATSES------------IRFTRRCTSVAPSRETAGELLLGKSGMHFVEDNAADAHDSQILQGETEAPSF-------SWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKFRDDVYHNILTSDLPNLLEHGNILALTQLWSSGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILSDYVSETIDLQDANIYRNLNKPIAVQSKEKEDRYVDNYRYLEEEYKKGIR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESEHVSQTLCQWIDLVFGLKQKGKAAVHAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLF----------SATHISRTAPKLMMEG-------ELPAAMGLLVQLAFRETREHAKEIVCPSPLPWIKGLKWGEYVGSPSAPDPV-VCFSQPHGERFGSLLALPTRAICGLSRSFCLMMIYSKEQGVRSMHSTDIQWSAILSWGYADNILRLKSKQ---SEPPINFIQCSQL-----------HQVTSCAWVPDGCQLFTGSKCGVITAYSNRFTSTTPSEMEVESQVH----LYGHTGEVTSLFVCKPYSILISVSNDGTCILWD---LNRLCYV-------------------------------QSLTGHKSPVTAVSASETTGDIAT-------VCNSEGGGSDLRLWTVNGDLIGHVHCRETICSVAFSNQPEGVSVNVIAGGLENGVVRLWSTWDLKPVREITFPK--SSKPIISLTYSCDGHHLYTANSEG 3524          
BLAST of Lysosomal trafficking regulator vs. TrEMBL
Match: A0A3B4ZMN3 (Lysosomal trafficking regulator OS=Stegastes partitus OX=144197 PE=4 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 7.035e-120
Identity = 333/1148 (29.01%), Postives = 546/1148 (47.56%), Query Frame = 1
Query: 7444 VFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEEFIKSLSQLLFAISPDFSVEDLNEDNRNLW--VKENEFKLN--------AYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHE-FISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYD-----ELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSKMT--SKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQXXXXXXXXXXXXIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNSQYISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGRLTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESG 10830
            +   C++  +  +G LL+      L L  R EA++ VF   + D +++  L         L L + ++L   K S  + E+    +      +     +       ++L   +KE +FK          A++KK  S   N  Q  D +  ++S    +   N     R+ ++ +  I +I+    ++      W+ L+   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY          Q + +   +L+FLFE     DK         +     E I+ +  CI V  S    GE  +GK  + F+ED   + +         E P++       +W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD +   I     PN      +  + + W  G++SNF+YLT LN  AGRS+ND+MQYPVFPFIL +YTS T+DL   S YR+LSKPI++Q+    ++ ++ +    +EY++ +R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES  VS  L  W+DLVFG KQ GKAA++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF          N  +I    P+ +          +    M   ++      +  +K+  C + L  + G++WG++VGSP+          +      G+L  LPT  +   S++   M++  +   V  +  T+      + +  A N  R++        P  N +Q   L             V S A      ++F G + G+IT Y       + +   V++  H    L GH  E+  L +C  +++L S        +WD   L  L Y+                               Q  +   + V+A+S SET GD  I+ +   +       S++ L+T+NG  +  +     + S++++   EG +VN IA   + G + + S+W+L+ V ++  P+   S PI ++ Y+  G  LY  N  G
Sbjct: 2621 ILWSCRDTFRVQIGRLLVHTLSPALPLSDRKEALEFVFDPRHLD-ILKESLSPGLEHGPKLSLYLYEMLHDHKDSLTKDEQSAVGVFMTSLKLCGHRCIPPNAPHKQDLLKAIKEEKFKYESEEKTSKVAWEKKMASTQRNLIQRLDGKSKDISKIAADITQNVSL--RQGMERKKVIQHIRGLYKTDLSASRHWQELVQQLTHDRAVWYDQTSYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLL----KDRRQPEDTVKPALSFLFE-----DKTHSSFSSTVKDKATSESIRFTRRCISVAPSRETAGELLLGKSGMYFVEDNAADAHDNQSLHGETEAPSF-------SWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKFRDDVYHNILTSDLPNLLEHGNITALTQLWGSGQISNFEYLTHLNKHAGRSFNDLMQYPVFPFILRDYTSETVDLQDPSIYRNLSKPIAVQSKEKEDRYVDNYRYLEEEYKKGIR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDQVSQTLCQWIDLVFGLKQKGKAAVQAINVFHPATYF-GMDVSSVEDPVQRRALETMIKTYGQTPRQLF----------NASHISRAGPKLMMEG-------ELPAAMGLLVQLAFRETREQAKEIACPSPLPWIKGLKWGEYVGSPSAPDPV-VCFSQPHGERFGSLLALPTRAICGLSRKFCLMMIYSKEQGVRSMHSTDIQWSAILSWGYADNILRLKSKQ---SEPPINFIQCSQL-----------HQVTSCAWVPDGCQLFTGSKCGVITAYSNRFTSTTPSEMEVESQVH----LYGHTGEVTSLFVCKPYSILISVSNDGTCILWD---LNRLCYV-------------------------------QSLTGHKSPVTAVSASETTGD--IATVCDSEGGG----SDLRLWTVNGDLIGHVHCREIICSVAFSNQPEGVSVNVIAGGLENGVVRLWSTWDLKPVREITFPK--SSKPIISLTYSCDGHHLYTANSEG 3662          
BLAST of Lysosomal trafficking regulator vs. TrEMBL
Match: A0A087YNC9 (Lysosomal trafficking regulator OS=Poecilia formosa OX=48698 PE=4 SV=2)

HSP 1 Score: 440.269 bits (1131), Expect = 1.279e-119
Identity = 334/1161 (28.77%), Postives = 551/1161 (47.46%), Query Frame = 1
Query: 7444 VFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEH----VKRSGNQTEEFIKSLSQLLFAISP-------DFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHE-FISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGES----LTFLFE-------STYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEY-----DELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSKMT--SKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQXXXXXXXXXXXXIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNSQ-YISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGRLTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESG 10830
            +   CK+  +  +G LL+      L L  R EA++ VF   + D +      G   G    +   + + +H     K   +    F+ SL    +   P       D  ++ + ED      +E   K  A++KK  +   N  Q  D +  ++S    +   N     R+ ++ +  I +I+    ++      W+ L+   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+    E+    L+FLFE       S+   DK   E+            I+ +  C  V  S    GE  +GK  + F+ED   + +         E P++       +W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD +   I     PN      ++ + + W+ G+++NF+YLT LN  AGRS+ND+MQYPVFPFIL++Y S T+DL   + YR+L+KPI++Q+    ++ ++ +    +EY++ +R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES +VS  L  W+DLVFG KQ GKAA+ AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF          +  +I  TAP+ +          +    M   ++      +  +K+  C + L  + G++WG++VGSP+          +      G+L  LPT  +   S+    M++  +   V  +  T+      + +  A N  R++        P  N +Q   L             V S A      ++F G + G+IT Y       + +   V++  H    L GH  E+  L +C  +++L S        +WD   L  L Y+                               Q  +   + V+A+S SET GD+           NS+   S++ L+T+NG  +  +    T+ S++++   EG +VN IA   + G + + S+W+L+ V ++  P+   S PI ++ Y+  G  LY  N  G
Sbjct: 2695 ILWSCKDTFRVQIGRLLVHTLSPSLPLQDRKEALEFVFDHKHIDILKESLSPGLEHGPKLSLYLFEMLHDHKDELTKEEQSAVGVFMTSLKLCGYRCIPLNVPHKHDL-LKAIKEDKMKFEAEEKTSK-AAWEKKMANTQKNLIQRLDGKSKDISKIAADITQNVSL--RQGMERKKVIQHIRGLYKTDLSASRHWQELVQQLTHDRAVWYDQTSYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LKDRRKPEETVKPPLSFLFEDKTHSFFSSTVKDKATSES------------IRFTRRCTSVAPSRETSGELLLGKSGMYFVEDNAADAHDSQILQGETEAPSF-------SWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKFRDDVYHNILTSDLPNLLEHGNILALTQLWSSGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILSDYVSETIDLQDANIYRNLNKPIAVQSKEKEDRYVDNYRYLEEEYKKGIR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESEHVSQTLCQWIDLVFGLKQKGKAAVHAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLF----------SATHISRTAPKLMMEG-------ELPAAMGLLVQLAFRETREHAKEIVCPSPLPWIKGLKWGEYVGSPSAPDPV-VCFSQPHGERFGSLLALPTRAICGLSRSFCLMMIYSKEQGVRSMHSTDIQWSAILSWGYADNILRLKSKQ---SEPPINFIQCSQL-----------HQVTSCAWVPDGCQLFTGSKCGVITAYSNRFTSTTPSEMEVESQVH----LYGHTGEVTSLFVCKPYSILISVSNDGTCILWD---LNRLCYV-------------------------------QSLTGHKSPVTAVSASETTGDIAT-------VCNSEGGGSDLRLWTVNGDLIGHVHCRETICSVAFSNQPEGVSVNVIAGGLENGVVRLWSTWDLKPVREITFPK--SSKPIISLTYSCDGHHLYTANSEG 3736          
BLAST of Lysosomal trafficking regulator vs. TrEMBL
Match: A0A3Q4HV96 (Lysosomal trafficking regulator OS=Neolamprologus brichardi OX=32507 PE=4 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 3.789e-119
Identity = 339/1151 (29.45%), Postives = 557/1151 (48.39%), Query Frame = 1
Query: 7444 VFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEEFIKSLSQLLFAISPDFSVEDLNEDNRNLW--VKENEFKLNAYKKKFK----SKLDNWNQNTDRRFNEVSIQM-KNSYNNYRTYA-RKNLQHE-FISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGES----LTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYD-----ELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSK---MTSKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQXXXXXXXXXXXXIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNSQYISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGRLTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESG 10830
            +   C++  +  +G LL+      L L  R EA++ VF   + D +++  L         L L + ++L   K +  + E+    +      +     +       ++L   +KE +FK  A +K  K     K+ N  +N  +R +  S  + K + +  +T + R+ ++ +  I +I+    ++      W+ L+   T ++ +W D       ++LDP EGP+R RRR+ +    I +KY         ++D+  S E+    L+FLFE     DK         +     E I+ +  CI V  S    GE  +GK  + F+ED   + +         E P++       +W   +I+ V +R ++LRD A+E+ + +GR  L+A +++  RD +   I     PN      +  + + W  G++SNF+YLT LN  AGRS+ND+MQYPVFPFIL +YT+ TLDL   + YR+LSKPI++Q+    ++ ++ +    +EY++ +R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES  VS  L  W+DLVFG KQ GKAA++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF          N  +I  T+ + ++    +  G       ++S E         +K+  C + L  + G++WG++VGSP+          +      G+L  LPT     ++SK  L M+  +E   V  +  T+      + +  A N  R++        P  N +Q   L             V S A      ++F G + G+IT Y       + +   V++  H    L GH  E+  L +C  +++L S        +WD   L  L Y+                               Q  +   + V A+S SET GD  I+ +   +       S++ L+T+NG  +  +     + SL+++   EG +VN IA   + G + + S+W+L+ V ++  P+   S PI ++ Y+  G  LY  N  G
Sbjct: 2671 ILWSCRDTFRVQIGRLLVHTLSPALPLSDRKEALQFVFDPKHLD-ILKESLSPGLEHGPKLSLYLYEMLHDHKDNLTKEEQSAVGVFMTSLKLCGHRCIPPNAPHKQDLLKAIKEEKFKYEAEEKTSKVAWEKKMANAQRNLIQRLDGKSKDISKIAADITQTVSLRQGMERKKVIQHIRGLYKTDLSASRHWQELVQQLTHDRAVWYDPTSYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYL--------LKDRRKSEETVKPPLSFLFE-----DKTHSSFSSTVKDKATSESIRFTRRCISVAPSRETAGELLLGKCGMYFVEDNAADAHDNQSLHGETEAPSF-------SWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNSKFRDDVYHNILTSDLPNLLEHGNITALTQLWGSGQISNFEYLTHLNKHAGRSFNDLMQYPVFPFILRDYTNETLDLQDPNIYRNLSKPIAVQSKEKEDRYVDNYRYLEEEYKKGIR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDQVSQTLCQWIDLVFGLKQKGKAAVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLF----------NTSHISRTSTKLMEGELPAAMGLLVQLAFRESREP--------AKEIVCPSPLPWIKGLKWGEYVGSPSAPDPV-VCFSQPHGERFGSLLALPTRAICGLSSKFCLMMIYSKE-QGVRSMHSTDIQWSAILSWGYADNILRLKSKQ---SEPPINFIQCSQL-----------HQVTSCAWVPDGCQLFTGSKCGVITAYSNRFTSTTPSEMEVESQVH----LYGHTGEVTSLFVCKPYSILISVSNDGTCILWD---LNRLCYV-------------------------------QSLTGHKSPVMAVSASETTGD--IATVCDSEGGG----SDLRLWTVNGDLIGHVHCREIICSLAFSNQPEGVSVNVIAGGLENGVVRLWSTWDLKPVREITFPK--SSKPIISLTYSCDGHHLYTANSEG 3711          
BLAST of Lysosomal trafficking regulator vs. Ensembl Cavefish
Match: lyst (lysosomal trafficking regulator [Source:ZFIN;Acc:ZDB-GENE-070702-1])

HSP 1 Score: 411.764 bits (1057), Expect = 2.263e-114
Identity = 295/971 (30.38%), Postives = 469/971 (48.30%), Query Frame = 1
Query: 7936 EFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYF--NPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPR-NIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSKMT--SKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQXXXXXXXXXXXXIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNSQYISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGRLTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESG 10830
            + I +I+    ++      W+ L+   T ++ +W D +     ++LDP EGP+R RRR+ +    I +KY   +   P   V+       SL FLFE     DK         +     E I+ +  CI V  S    GE  +GK  + F+ED          E P+   +     W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD +   I     PN      +  + + W   +++NF+YLT LN  AGRS+ND+MQYPVFPFIL +Y S TLDL   + YR+LSKPI++Q+    ++ ++ +    +EY++  R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R N  +V+ V LP W+  D RLF LIHR +LES  VS  L  W+DLVFG KQ GKAA+ AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF          N  +I    P+  ++    +  G       ++S E         +K+    + L  + G++WG++VGSP+     +       E   G+L  LPT  +   S++   M++  +   V  +  T+      + +    N  R++        P  N +Q   L                 A      ++F G + G+IT Y         +   V++  H    L GH  E+  L +C  +++L S        IWD   L  L Y+                               Q  +   + V+A+S SET GD+         +V     S++ L+T+NG  +  +     + S++++   EG +VN IA   + G + + S+W+L+ V ++  P+   + PI ++ ++  G  LY  N  G
Sbjct: 2800 KVIQHIRGLYKTDLSASRHWQELVQQLTHDRAVWYDQSCYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLLKDRHKPEDTVK------ASLAFLFE-----DKTHSSFSSTVKDKATSEPIRFTRRCISVAPSRETAGELLLGKSGMYFVEDNAA-------ETPHGETEPASFCWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKFRDDVYHNILTSELPNLLEYDNISALTQLWGSSQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILRDYVSETLDLQDPNIYRNLSKPIAVQSKEKEDRYVDNYRYLEEEYKKGAR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNSERVNHVNLPPWARNDPRLFVLIHRQALESDQVSQTLCQWIDLVFGLKQKGKAAIHAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLF----------NATHISRAGPKLMMEGELPAAMGLLVQLAFRESREQ--------AKEVTYPSPLPWIKGLKWGEYVGSPSAPDPVVCFSQPHGERF-GSLLALPTRAICGLSRKFCLMMIYSKEQGVRSMHSTDIQWSAILSWGYTDNMLRLKSKQ---SEPPINFIQCSPLHQVTS-----------CAWVPDGCQLFTGSKCGVITAYSNRFSTTMASEMDVESQVH----LYGHTDEVTGLFVCKPYSILISVSRDGTCIIWD---LNRLCYV-------------------------------QSLTGHKSPVNAVSASETTGDIATV----CDSVGGG--SDLRLWTVNGDLIGHVHCREIICSVAFSNQPEGVSVNVIAGGLENGVVRLWSTWDLKPVREITFPK--SNKPIISLTFSCDGHHLYTANSEG 3664          
BLAST of Lysosomal trafficking regulator vs. Ensembl Cavefish
Match: wdfy3 (WD repeat and FYVE domain containing 3 [Source:NCBI gene;Acc:103029491])

HSP 1 Score: 273.863 bits (699), Expect = 1.390e-72
Identity = 149/386 (38.60%), Postives = 223/386 (57.77%), Query Frame = 1
Query: 8470 DIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNAN-------RKPR------------LI---DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKI 9558
            DI+ V +RR+ L+  A+E+   DGRN L+A    + R+++      ++P  A+       ++P             L+    + + W  G++SNF YL  LNT AGRSYND+MQYPVFP+IL +Y +  LDL    T+R+LSKP+  Q             ++  +Y+++ +  +  N          P YHY + YS++  V  Y++R+ PFTQ F++ Q G FD  DRMFH++  +W  ++      +KE+IPEFFYLPE  +NS +F+ G + NGT++ DVILP W+ GD R F  +HR +LE  YVS  L+ W+DL+FGFKQ G  A+EA+N+FH   Y   +    I + ++ +A    I N+GQIPKQLF  K  P K++
Sbjct: 2586 DIKEVHKRRYLLQPMAVEVFSGDGRNYLLAFQKGV-RNKVYQRFLAVVPSLADSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDAEELDLNNPKTFRNLSKPMGAQT-----------DDRLIQYKKRFKDWEDPNG-------ETPAYHYGTHYSSAMIVASYLLRMEPFTQIFLRLQGGHFDLADRMFHSVREAWLSASKHNMADVKELIPEFFYLPEFLLNSNNFDLGSKQNGTRLGDVILPPWAKGDPREFIRVHRQALECDYVSAHLHEWIDLIFGFKQQGPPAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLF-KKPHPPKRV 2951          
BLAST of Lysosomal trafficking regulator vs. Ensembl Cavefish
Match: nbeal1 (neurobeachin-like 1 [Source:ZFIN;Acc:ZDB-GENE-130530-544])

HSP 1 Score: 266.159 bits (679), Expect = 2.577e-70
Identity = 186/591 (31.47%), Postives = 296/591 (50.08%), Query Frame = 1
Query: 7993 WKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVD--------------KIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILS--FIENILPPNANRKPRLI----DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGE-RLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAK----KINWRNIK-NTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTL 9687
            WK        E+  W D  +K   ++L   E  SR+R ++++  +    +  +       VQ +  + ESL  L E+  QV               +      +D +     E + +S  C LV     + G   +    I F +       S  ++     +DF    W L+ I  +  RR+ LR  ALE+ + D  N  +     + R+++ S   +   LP +  R P+ +     + ++W   ++SNFDYL  LNT AGR+YN++ QYPVFP+IL +YTS  LDL+    +RDLSKP+++ N    EK      EK + ++        +  ID         +HY + YSN+A V++Y+IR+ PFT   IQ Q G FD  DR FH++ ++W     + + +KE+IPEFFY PE   N   F+ G  +++  +V+DV+LP+W+      F   HR +LES YVS  L+ W+DL+FG+KQ G AA+EA+N+F+  TY  A+  D IT+E  R A+E MI N+GQ P QL + +  P +    ++  R  + ++ P N+    +  K +       + I  NC  +K +
Sbjct: 1821 WKAARRELMSERGPWVDKKQKEMHWKLSSAENYSRMRLKLVRNYNFDTHREASALRDNLGVQQQQVNTESL--LLEAVKQVKVSDLEEEILELPEEEQTGNTQVDDEDANQKEKLVMSEDCELVTVVDVYPGRLDITTHHIYFYD-------SSTEKEEGVGQDF---KWPLSQIREIHLRRYNLRRSALEIFLIDQTNYFLNFKKEV-RNKVYSRMLLLCSLPLHGTRSPQELLKASGLTQKWVNREISNFDYLMQLNTIAGRTYNNLAQYPVFPWILADYTSEELDLSDPCVFRDLSKPVAVLN----EKNAKAVREKYESFE------DPTGTIDR--------FHYGTHYSNAAGVMHYLIRVEPFTSLHIQLQSGRFDCADRQFHSIPATWQTLIDNPNDVKELIPEFFYFPEFLENQNGFDLGRLQISKERVNDVVLPKWAKSPED-FIYKHRKALESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYCTYEGAVDLDAITDEKERKALEGMISNFGQTPCQL-LKEPHPVRLSLEELEKRTSRLDSCPLNVFEHLTELKSF-----FVEGISDNCALVKAV 2373          
BLAST of Lysosomal trafficking regulator vs. Ensembl Cavefish
Match: nbeal2 (neurobeachin-like 2 [Source:NCBI gene;Acc:100330830])

HSP 1 Score: 254.218 bits (648), Expect = 1.019e-66
Identity = 154/411 (37.47%), Postives = 235/411 (57.18%), Query Frame = 1
Query: 8464 LNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPN----ANRKPRLI----DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFG-ERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFP---AKKINWRNIK-NTAPRNIQHSFSSDKGYQDTDQMKDSI 9657
            L+ +  V  RR+ LR  ALE+   D  +  I     + R+++ S I  + PPN     +R P+ +    ++ ++W   ++SNF+YL  LNT AGR+YND+ QYPVFP++L +YTSS LDL   + +RDLSKPI + N    + V     EK + ++        +  +D+        +HY + YSN+A V++YMIR+ PFT   IQ Q G+FD  DR FH++A++W     S + +KE+IPEFFY PE   N   FN G  ++N  +V++V+LP W+S     F   HR +LES +VS  L+ W+DL+FG+KQ G  A+EA+N+F+  TY  A+  D I  E  R A+E +I N+GQ P QL      P   A+  + R  + +T P N+         ++  D+++D +
Sbjct: 2039 LSQLREVHLRRYNLRRSALELFFIDQAHYFINFRKKV-RNKVYSRILGLRPPNLFYFGSRSPQELLKASNLTQKWVCREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLCDYTSSVLDLEDPAVFRDLSKPIGVVNPRHAQNV----REKYESFE------DPTGTVDK--------FHYGTHYSNAAGVMHYMIRMEPFTTLHIQLQSGKFDCADRQFHSVAAAWQARMESPADVKELIPEFFYFPEFLDNMNGFNLGCLQVNQEQVNNVVLPRWASSRED-FIRKHRKALESEHVSAHLHEWIDLIFGYKQRGPEAVEALNVFYYCTYEGAVDLDAIANETERKALEGIISNFGQTPCQLLKEAHPPRMSAENASRRQSRIDTLPPNL---------FEQLDKLRDGV 2420          
BLAST of Lysosomal trafficking regulator vs. Ensembl Cavefish
Match: lrba (LPS-responsive vesicle trafficking, beach and anchor containing [Source:ZFIN;Acc:ZDB-GENE-090311-19])

HSP 1 Score: 243.047 bits (619), Expect = 2.257e-63
Identity = 139/377 (36.87%), Postives = 210/377 (55.70%), Query Frame = 1
Query: 8458 WHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFI------ENILPPNANR----KPRLI----DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFP 9546
            W   +I  V  RR+ L++ ALE+ + +    +          +++  +       N   P   R     P+ +     + + W   ++SNF+YL FLNT +GR++ND+ QYPVFP+++T Y +  LDLT  S YRDLSKPI    G L  K    F+++ + ++            DE     VP +HY + YS ++  + +++RI PFT  F+ FQ G+FD  DR F +++ +W       S +KE+IPEFFYLPE+FVNS ++N G   +GT V DV LP W+      F  I+R +LES +VS QL+ W+DL+FG+KQ G  A+ ++N+F+  TY  A+    IT+ + R AVE  I ++GQ P QL I    P
Sbjct: 1981 WLFTEIRAVFSRRYLLQNTALEIFLANRTAVMFNFADAATVKKVVHCLPRVGVGTNYGLPQTRRISLATPKQLFKASSMTQRWQRREISNFEYLIFLNTISGRTFNDLNQYPVFPWVITNYDTEDLDLTLPSNYRDLSKPI----GALNPKRAAFFSDRFESWE------------DEQ----VPKFHYGTHYSTASFTMMWLLRIEPFTTFFLNFQGGKFDHADRTFSSISRAWRNCQRDTSDVKELIPEFFYLPEMFVNSNNYNLGVMDDGTVVSDVELPPWAKSPEE-FVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRSLNVFYYLTYEGAVNLSTITDPMLREAVESQIRSFGQTPCQLLIEPHSP 2336          
BLAST of Lysosomal trafficking regulator vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000320.1 (pep scaffold:Pmarinus_7.0:GL481331:460:21348:1 gene:ENSPMAG00000000288.1 transcript:ENSPMAT00000000320.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 259.225 bits (661), Expect = 1.452e-74
Identity = 149/394 (37.82%), Postives = 221/394 (56.09%), Query Frame = 1
Query: 8482 VLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILP-------------PNANRKPR------LI---DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTS--STLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAP 9588
            V +RR+ L+  A+E+   DGRN L+     + R+++      I P             PNA+ +        L+    + + W  G++SNF YL  LNT AGRSYND+MQYPVFP+IL +Y S    LDLT   T+RD+SKP+  Q             E+ +++Q++ +  +  N          P YHY + YS++  V  Y++R+ PFTQ F++ Q G FD  DRMFH++  +W  ++ +    +KE+IPEFFYLP+   NS  +N G + NG  + +V+LP W+ GDAR F  +HR +LE  YVS  L+ W+DL+FG KQ G  A+ + N+FH   Y   +    IT+ ++ +A    I N+GQIPKQLF  K  PAK++  +   +T P
Sbjct:   35 VHKRRYLLQPMAVEVFSNDGRNYLLVFPRGV-RNKVYQRFLTIAPSLADSSESVSGQNPNASVEAGSGLLSGLVGERSVTQRWVHGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYQSEEQELDLTDPRTFRDMSKPMGAQT-----------MERLEQFQKRYQDWEDPNG-------ETPAYHYGTHYSSAMIVASYLVRMEPFTQTFLRLQGGHFDLADRMFHSVRDAWLSASRNNMADVKELIPEFFYLPDFLQNSNHYNLGCKQNGIWLGEVLLPNWAKGDAREFIRVHREALECDYVSAHLHEWIDLIFGCKQQGPMAVASTNVFHHLFYEGQVDIYSITDPLKLTATIGFINNFGQIPKQLF-KKPHPAKRVGSKPSGDTNP 408          
BLAST of Lysosomal trafficking regulator vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000322.1 (pep scaffold:Pmarinus_7.0:GL481331:12961:21303:1 gene:ENSPMAG00000000288.1 transcript:ENSPMAT00000000322.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 245.743 bits (626), Expect = 2.576e-71
Identity = 130/310 (41.94%), Postives = 188/310 (60.65%), Query Frame = 1
Query: 8668 EGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTS--STLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAP 9588
             G++SNF YL  LNT AGRSYND+MQYPVFP+IL +Y S    LDLT   T+RD+SKP+  Q             E+ +++Q++ +  +  N  +       P YHY + YS++  V  Y++R+ PFTQ F++ Q G FD  DRMFH++  +W  ++ +    +KE+IPEFFYLP+   NS  +N G + NG  + +V+LP W+ GDAR F  +HR +LE  YVS  L+ W+DL+FG KQ G  A+ + N+FH   Y   +    IT+ ++ +A    I N+GQIPKQLF  K  PAK++  +   +T P
Sbjct:    2 HGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYQSEEQELDLTDPRTFRDMSKPMGAQT-----------MERLEQFQKRYQDWEDPNGSE------TPAYHYGTHYSSAMIVASYLVRMEPFTQTFLRLQGGHFDLADRMFHSVRDAWLSASRNNMADVKELIPEFFYLPDFLQNSNHYNLGCKQNGIWLGEVLLPNWAKGDAREFIRVHREALECDYVSAHLHEWIDLIFGCKQQGPMAVASTNVFHHLFYEGQVDIYSITDPLKLTATIGFINNFGQIPKQLF-KKPHPAKRVGSKPSGDTNP 293          
BLAST of Lysosomal trafficking regulator vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007035.1 (pep scaffold:Pmarinus_7.0:GL477366:176480:246408:1 gene:ENSPMAG00000006333.1 transcript:ENSPMAT00000007035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 244.973 bits (624), Expect = 1.212e-67
Identity = 145/386 (37.56%), Postives = 213/386 (55.18%), Query Frame = 1
Query: 8458 WHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILP----------PNANR----KPRLI----DIQREWAEGKMSNFDYLTFLNTAA-----GRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFP 9546
            W  +++E +  RR+ L++ ALE+ +    + +      L    I+  + ++LP          P A R     PR +    ++ + W +  +SNF+YL FLNT A     GR+YND+ QYPVFP+++  Y S  LDLT  S +RDLSKP+   N P R  V   F E+   +          ++ D      +P +HY + YS +A VL +++R+ PFT  F+  Q G+FD  DR F ++A +W  S    S +KE+IPEFFYLPE+F NS D+N G    G  V DV+LP W+      F  I+RA+LES  VS QL+ WVDL+FG+KQ G  A+ A+N+++  TY  A+    I + + R AVE  I ++GQ P QL +    P
Sbjct:   23 WLFSEVEAIFSRRYLLQNTALEIFLSSRTSIMF----NLPDATIVKSVVHLLPRVGIGTLYGLPQARRYSLASPRQLFKASNMTQRWQQRDVSNFEYLMFLNTIAACTDPGRTYNDLNQYPVFPWVIANYDSEELDLTLPSNFRDLSKPVGALN-PQRAAV---FAERYASW----------DDAD------IPAFHYGTHYSTAAFVLMWLLRVEPFTNYFLSLQGGKFDHADRTFSSVARAWRNSQRDTSDVKELIPEFFYLPEMFTNSNDYNLGVTDAGVAVGDVVLPPWAK-TGEEFVRINRAALESEIVSCQLHQWVDLIFGYKQRGPEAIRAMNVYYYLTYEGAVNMASIRDRVTREAVEAQIRSFGQTPAQLMVEPHAP 383          
BLAST of Lysosomal trafficking regulator vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000006.1 (pep scaffold:Pmarinus_7.0:GL476426:99633:131478:1 gene:ENSPMAG00000000006.1 transcript:ENSPMAT00000000006.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 221.476 bits (563), Expect = 1.572e-57
Identity = 129/365 (35.34%), Postives = 191/365 (52.33%), Query Frame = 1
Query: 8440 DFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLE--------------------------RDRILSFIENILPPN----ANRKPRLI----DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGE-RLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTY 9429
            DF    W L ++     RR+ LR  ALE+   D  +  +     +                           R+R+ S I  + PPN     +R P+ +     I ++W   ++SNF+YL  LNT AGR+YND+ QYPVFP++L++YTS  LDL+    +RDLSKPI I +                  +R  + ++      E +      +HY + YSN+A V++YMIR+ P T   IQ Q G FD  DR FH++ ++W     S + +KE+IPEFFY PE   N   F+ G  +++   V++V+LP W+      F   HRA+LES +VS  L+ W+DL+FG+KQ G AA+EA N+F+  TY
Sbjct: 1792 DFKCPLWQLREVHL---RRYNLRRSALEIFFIDQTSYFLNFTKEISCSLYYGTGWYDLPDVHGVYHTTHLHVRNRVYSRIVGLRPPNLVYYGSRSPQELLKASGITQKWVNREISNFEYLMKLNTIAGRTYNDLAQYPVFPWVLSDYTSDELDLSNPGVFRDLSKPIGIVS------------------ERNAKEVKDRYENFEDTTGTTGKFHYGTHYSNAAGVMHYMIRVEPLTTLHIQLQSGRFDCADRQFHSIPATWQALMDSPNDVKELIPEFFYFPEFLENQNGFDLGTLQMSRETVNNVVLPRWAKSPDD-FIRKHRAALESEFVSAHLHEWIDLIFGYKQRGPAAVEAHNVFYYCTY 2134          
BLAST of Lysosomal trafficking regulator vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003512.1 (pep scaffold:Pmarinus_7.0:GL476505:6657:94563:1 gene:ENSPMAG00000003156.1 transcript:ENSPMAT00000003512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.688 bits (400), Expect = 2.153e-38
Identity = 109/367 (29.70%), Postives = 175/367 (47.68%), Query Frame = 1
Query: 7753 EDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHE-FISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGES-----LTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKP 8835
            E NR  WV+    ++    +    +++   ++  R   EV+          R   R+ L+ +  I++I+    +E   +  W+ L    T E+ +W         ++LDP EGP+R RRR+ +    I +KY         ++D+ +S        L+FLF+     DK         +     E  + +  CI V  S    GE  +G+  + F+ED   +  +E        +   F +W   DI+ V  R ++LRD ALE+ + +GR  L+  +ST  RD++   I +   PN      L  + + W  G+++NF+YLT LN  AGRS+ND+MQYPVFPF+L +Y S TLDL     YR L +P
Sbjct: 2882 ESNREAWVR----RMTTNGQALLGRIETRARSVSRVAAEVT---------QRVAGRQGLERKKVIAHIREAYKAELSAQRCWQTLFRQLTHERVVWFFPVACPSSWQLDPTEGPNRERRRLQRCHITIPNKYL--------LKDRWTSAADAIKLPLSFLFD-----DKSSSSGSSAVKDKATSEPTKFTRRCISVVPSRETPGELLLGETGMHFVEDSTGDA-TETPSCVGEAEALSF-SWTYEDIKEVHLRWWQLRDNALEVFLTNGRTLLLTFDSTKVRDQVYQTILSSDLPNLLEYGNLSALTQLWCAGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFVLRDYASETLDLADPRVYRSLVRP 3220          
BLAST of Lysosomal trafficking regulator vs. Ensembl Yeast
Match: BPH1 (Protein homologous to Chediak-Higashi syndrome and Beige proteins; both of which are implicated in disease syndromes in human and mouse, respectively, due to defective lysosomal trafficking; mutant phenotype and genetic interactions suggest a role in protein sorting [Source:SGD;Acc:S000000628])

HSP 1 Score: 246.514 bits (628), Expect = 2.615e-65
Identity = 141/411 (34.31%), Postives = 224/411 (54.50%), Query Frame = 1
Query: 8422 LPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENI---LPPNA-----------------------------------NRKPRLID---IQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF 9528
            +  +LK   F+ W L DI +V +R F LRD A+E++ K+  +   +  +   RD +L  +  I   LP +                                    +    LID   I ++W  G++SNF YL  +N  AGRS+ND+ QYPVFP+++ +Y S+ LDL    TYRDLSKP+  Q            +EK     R+L+ ++    +  +      P+HY + YS++  V  Y+IR+ PF + F+  Q G F   DR+F ++  +W  ++S  +  ++E+ PEFF+LPE  +N   ++FG   +G KVDDV+LP W++GD ++F   +R +LESPYVS  L+ W+DL+FG+KQ G  A++++N+F+  +Y  A+  D I +E  R A+  +I N+GQ P Q+F
Sbjct: 1440 VSTFLKHEVFV-WKLLDITFVTKRPFLLRDVAIELLFKERVSAFFSFYNKRVRDDVLRVLNKIPKHLPADPIFSSVLQEINDRGNSIVARNGIGKASIASKFTSVFSANNSLIDGFEISKKWVRGEISNFYYLLSINILAGRSFNDLTQYPVFPWVIADYESNVLDLENPKTYRDLSKPMGAQ------------SEK-----RKLQFIERYEALASLENADSAPFHYGTHYSSAMIVSSYLIRLKPFVESFLLLQGGSFGPADRLFSSLERAWSSASSENTTDVRELTPEFFFLPEFLINVNSYDFGTDQSGKKVDDVVLPPWANGDPKVFIQKNREALESPYVSAHLHEWIDLIFGYKQKGDIAVKSVNVFNRLSYPGAVNLDNIDDENERRAITGIIHNFGQTPLQIF 1832          
BLAST of Lysosomal trafficking regulator vs. Ensembl Nematostella
Match: EDO33951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQQ4])

HSP 1 Score: 262.692 bits (670), Expect = 9.045e-72
Identity = 191/611 (31.26%), Postives = 286/611 (46.81%), Query Frame = 1
Query: 7774 VKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYA----RKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPAR-NVQDKSSSGESLTFLFESTYQVDKIVY---ENPIDCQL----------LKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPN----ANRKP----RLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF 9528
            +K+ E K +    +F  +     Q++ ++ +++S   +  +    T A    R  LQ      ++A+        + W +     T E+  W     +   ++L   E   R+R RM   T  +N  Y    S AR N  D++  G++L+         + +V    E   D +L          +  +E + +   C LV       G+  V    + F  +R ++ +         L       W L ++  V  RR  LR  ALE  + D  N  I   S   R+ +   I ++ PPN      R P    +   +   W + ++SNF+YL  LNT AGR+YND+ QYPVFP++L +Y S  LDL+  + YRDLSKPI + N P R K      E  D Y+             E     +  +HY + YSNSA VL+Y++R+ PFT   +    G FD  DR FH++ + W    +  S +KE++PEFFY PE   N   F+ G    G +V+ V LP W+      F   HR +LES YVS  L+ W+DL+FG+KQ G+ A+EA N+F+  TY  A+  D IT E  R A E MI N+GQ P QL 
Sbjct:   30 IKQFEAKFSVLSGRFWMQCLTALQSSLKQRDQLSADGRERFARQVTKAAQELRTKLQERDKGLLRARSQQSARNAIDWLLTKRRLTSERAPWAYRTPEEVHWKLSTEETFQRMRLRM---TQNLNYSYHMEASNARDNKSDENLDGDTLSQSVPLRVAREAVVMRSLEADEDEELTASNNSVSPPMSVVEKVVLEVDCELVTLMDVMPGKLKVSTTHVYFTANRSSDAWD--------LTTVYEFTWALAELREVHLRRHNLRRSALEFFLVDQTNYFINC-SKKARNTVYKKIMSLRPPNLYYMGARSPAQLLKASGLTERWVKREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLVDYESKDLDLSNRAVYRDLSKPIGVLN-PARVK------EVEDRYKHF-----------EDPTGTIAKFHYGTHYSNSANVLFYLLRVEPFTTLHVALHSGRFDCADRQFHSIPALWDSLFNKASDVKELVPEFFYFPEFLENLNGFDLGRLQGGARVNHVTLPPWARTPEE-FVHKHRQALESEYVSTHLHDWIDLIFGYKQRGEKAVEAHNVFYYCTYEGAVDLDAITNEAERIATEGMINNFGQTPSQLL 609          
BLAST of Lysosomal trafficking regulator vs. Ensembl Nematostella
Match: EDO45998 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRE1])

HSP 1 Score: 232.261 bits (591), Expect = 1.859e-62
Identity = 138/387 (35.66%), Postives = 216/387 (55.81%), Query Frame = 1
Query: 8464 LNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQRE-----WAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLP-ELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHS 9606
            L+ I  V++RR+ LR   +E+  KD     + +NS  +RD+   + E +  P+ N    L D ++E     W  G ++NFDYL +LN+++ RS+ND+ QYPVFP+++ +YTSS LDL    T+RDL+KPI    G L    +N   E+  +                      P + Y S YS    VLYY++R+ P  +  +  Q G+FD+PDR+F+++  +W    +  + +KE+IPEF+    E  VN Q+   G + + + V DV LP W++ D   F   +R +LE PYVS +LN+W+DL+FG+KQ G+ A EA N+F+  TY  A+  D IT+   R+++E  I  +GQ PKQLF +   P + ++       +P  + HS
Sbjct:  177 LSQISRVVKRRYLLRHVGIEIFSKDSSQMYLVLNSQSDRDQF--YRELLKQPDVN----LDDTEQENMTLKWQNGAITNFDYLMYLNSSSDRSFNDLTQYPVFPWVIADYTSSQLDLRDPLTFRDLAKPI----GALNPNRLNQLKERCRDMTE-------------------PKFLYGSHYSTPGYVLYYLVRVAP--EFMLCLQGGKFDQPDRLFNSIQETWENVLTGHADVKELIPEFYQSSGEFLVNCQNLPLGMKQDKSNVGDVELPAWAT-DCEDFIRKNREALECPYVSERLNHWIDLIFGYKQRGEEAWEADNVFYYLTYEGAVDLDSITDPNERASLESQILEFGQTPKQLFTSP-HPQRLVSATPTMGASPSPLVHS 530          
BLAST of Lysosomal trafficking regulator vs. Ensembl Nematostella
Match: EDO30379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0Y3])

HSP 1 Score: 216.083 bits (549), Expect = 3.627e-59
Identity = 114/276 (41.30%), Postives = 163/276 (59.06%), Query Frame = 1
Query: 8719 GRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFP 9546
            GR+Y D+ QYPVFP+ILT Y S  LDL   + YRDL+KPI   N                   R ++ ++   + DE     +PP+HY + YS     L ++IR+ PF  +F+  Q G+FD P R F ++  +W       S +KE+IPE FYLPE+F NS  F FG   +G  +DDV LP W++   + F  IHRA+LES YVS+Q++ W+DL+FGFKQ G  A++A N+F   TY  ++  D I++ + R AVEQ I+++GQ P QL ++   P
Sbjct:    1 GRTYCDLNQYPVFPWILTNYESDKLDLKDPNNYRDLTKPIGALNP-----------------NRHVQFLERYASWDEND--DIPPFHYGTHYSTCGFTLAWLIRLEPFATQFLNLQGGKFDHPGRTFCSVQRAWQNCNRDTSDVKELIPELFYLPEMFCNSNRFTFGVDDDGMVIDDVELPSWANTPEQ-FVTIHRAALESEYVSSQIHGWIDLIFGFKQRGPEAVKATNVFFHLTYEGSVDLDSISDTVMREAVEQQIKSFGQTPSQLLLDPHPP 256          
BLAST of Lysosomal trafficking regulator vs. Ensembl Nematostella
Match: EDO46742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNV7])

HSP 1 Score: 166.392 bits (420), Expect = 8.611e-43
Identity = 82/155 (52.90%), Postives = 110/155 (70.97%), Query Frame = 1
Query: 9067 DGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF 9528
            DG FD+PDR FH++A++W LS+      +KE+IPEFF+LPE   N + F+FG R NG +V DV LP W+  + RLF LIHR +LE+  VS  L+ W+DL+FGFKQTGK A+EA+N+FHP TY+  +  + IT+ I   A++ MIE YGQ P QLF
Sbjct:    1 DGNFDQPDRTFHSLATTWRLSSYQSPTDVKELIPEFFFLPEFLENFEGFDFGFRQNGVRVMDVSLPPWAKNNPRLFILIHRQALETDIVSQHLHNWIDLIFGFKQTGKDAVEALNVFHPATYF-GVDINSITDPISNKALKTMIETYGQTPTQLF 154          
BLAST of Lysosomal trafficking regulator vs. Ensembl Nematostella
Match: EDO29546 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3B8])

HSP 1 Score: 123.635 bits (309), Expect = 1.452e-32
Identity = 66/135 (48.89%), Postives = 85/135 (62.96%), Query Frame = 1
Query: 8662 WAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQ 9066
            W  G +SNF+YLT LN  AGR+ ND+MQYPVFPF+L+++TS  LDL    T RDL+KPI++QN P+ E        K  EY RQ             S  A  P HYSS YSNS TVL++++R+PPFT   +Q+Q
Sbjct:    2 WRAGTLSNFEYLTELNKMAGRTCNDLMQYPVFPFVLSDFTSEVLDLNDPKTLRDLTKPIAVQN-PIMEA-------KYKEYYRQ----------QGESDPAAAPCHYSSHYSNSGTVLHFLVRLPPFTNMLLQYQ 118          
BLAST of Lysosomal trafficking regulator vs. Ensembl Medaka
Match: lyst (lysosomal trafficking regulator [Source:NCBI gene;Acc:101170120])

HSP 1 Score: 382.874 bits (982), Expect = 1.196e-105
Identity = 258/799 (32.29%), Postives = 419/799 (52.44%), Query Frame = 1
Query: 7444 VFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEE------FIKSLSQLLFAISPDFSV--EDLNEDNRNLWVKENEFKLNA--------YKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYF--NPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNN------LYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPN 9765
            +   C++  K  +G LL+    + L L  R EA++ VF   + + +++  L         L L + ++L H  R G   +E      F+ SL        P  +   +DL +      +KE +FK  A        ++KK  +   N  Q  D +  ++S    +   N  +  +   + + I +I+    ++      W+ L+   T ++ +W + N     ++LDP EGP+R RRR+ +    I +KY   +   P   V+        L+FLFE     DK         +     E I+ +  C+ V  S    GE  +GK  + F+ED   +      L+ E  E P++       +W   +I+ V +R ++LRD A+E+ + +GR  L+A ++T  RD +   I     PN      +  + + W  G+++NF+YLT LN  AGRS+ND+MQYPVFPF+L++YTS TLDL + + YR+LSKPI++Q+    ++ ++ +    +EY++ +R        ++  +  V PYHY S YSNS TVL++++R+PPFT+ F+ +QD  FD PDR FH+M ++W LS+      +KE+IPEFFYLPE  VN + F+FG R NG +V+ V LP W+  D RLF LIHR +LES +VS  L  W+DLVFG KQ G+AA++AIN+FHP TY+  +    + + ++R A+E MI+ YGQ P+QLF          +  ++  T P+ +          +    M   ++      +  +K+  C + L  + G++WG++VGSP+
Sbjct: 2763 ILWSCRDTFKVQIGRLLVHSLSTALPLSDRKEALEFVFDSKHLE-ILKESLSPGLEHGPKLSLYLYEML-HDHRDGLTKDEQGAVGVFMTSLKLCGHRCIPPSAPHKQDLLKA-----IKEEKFKYEAEEKNSKVAWEKKMVNAQRNLIQRLDGKLKDISKIAADITQNV-SLQQGQERKKVIQHIRGLYKTDLSASRHWQELVQQLTHDRAVWYNQNSYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLLLDRRKPEEAVKPP------LSFLFE-----DKTHSSFSSTVKDKATSESIRFTRRCVSVAPSRETAGELLLGKSGMYFVEDNAADAQDSQILHGE-TEAPSF-------SWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKFRDDVFHNILTSDLPNLLEYGNITALTQLWGSGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFVLSDYTSETLDLQEANIYRNLSKPIAVQSKEKEDRYVDNYRYLEEEYKKGIR--------EDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRLSSYESMTDVKELIPEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFVLIHRQALESDHVSQTLCQWIDLVFGLKQKGRAAVQAINVFHPATYF-GMDVSAVEDPVQRRALETMIKTYGQTPRQLF----------SASHMSRTGPKLMMEG-------ELPAAMGLLVQLAFRETREQAKEVVCPSPLPWIKGMKWGEFVGSPS 3508          

HSP 2 Score: 53.5286 bits (127), Expect = 6.211e-6
Identity = 56/239 (23.43%), Postives = 108/239 (45.19%), Query Frame = 1
Query: 5023 VDSAIENLGGISIMIFWLAKVVESGD-EVSTRYXXXXXXXXXRKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQH-------MIYEDPTKSKLSLPCNS-RLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQEPFEALEHPL---PVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHP 5703
            + S +  +GG    +F  A+ VE  D E +    L+++L L   +    H+     GY+++ Q+    K  +G+ ++  L+         ++ ED    +  L   S  + +D ++L E+L+ WK+ A       K +  + E         LL  +  L+   + Y + N   L   G++   L++CQ   E  +  L   P  +C   I+II  ++ +P D+ ++  +CN +L +HP
Sbjct: 1820 LQSVLHKIGGTGNFVFLFAQTVELSDCEKTQALALQVLLSLCNSNQHRIHEMDCYHGYAMIHQVLIKPKCVVGYHMLKTLLDGCCSGPILLLGED---GQFRLDAESVAVVQDLRLLSEILLDWKVWA-------KAQCGVWET--------LLAALEILIRVHHPYQVFNIRQLLNAGVVHRFLLACQVLQEHRDEHLTTIPQEVCLSFIKIIQEVLGSPPDLDLLRLICNFLLAVHP 2040          
BLAST of Lysosomal trafficking regulator vs. Ensembl Medaka
Match: wdfy3 (WD repeat and FYVE domain containing 3 [Source:NCBI gene;Acc:101161316])

HSP 1 Score: 275.789 bits (704), Expect = 3.943e-73
Identity = 154/420 (36.67%), Postives = 239/420 (56.90%), Query Frame = 1
Query: 8470 DIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNAN-------RKPR------------LI---DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXC-MKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDK-GYQDTDQMKDSI 9657
            DI+ V +RR+ L+  A+E+   DGRN L+A    + R+++      ++P  A+       ++P             L+    + + W  G++SNF YL  LNT AGRSYND+MQYPVFP+IL +Y S  +DL    ++R+L+KP+  Q             ++  +Y+++ +  +  N          P YHY + YS++  V  Y++R+ PFTQ F++ Q G FD  DRMFH++  +W  ++      +KE+IPEFFYLPE  +NS +F+ G + NGTK+ DV+LP W+ GD R F  +HR +LE  YVS  L+ W+DL+FG+KQ G  A+EA+N+FH   Y   +    I + ++ +A    I N+GQIPKQLF  K  P K++  R+  N     +  +F+SDK  +   D ++ S+
Sbjct: 2605 DIKEVHKRRYLLQPMAVEVFSADGRNYLLAFQKGV-RNKVYQRFLAVVPSLADSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEEVDLNNPKSFRNLAKPMGAQT-----------DDRLTQYKKRYKDWEDPNG-------ETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAWLSASKHNMADVKELIPEFFYLPEFLLNSNNFDLGAKQNGTKLGDVLLPSWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPPAVEAVNVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLF-KKPHPPKRV--RSKANGDAAGVPPNFNSDKIFFHHLDNLRPSL 3002          
BLAST of Lysosomal trafficking regulator vs. Ensembl Medaka
Match: nbeal2 (neurobeachin like 2 [Source:NCBI gene;Acc:101163272])

HSP 1 Score: 249.21 bits (635), Expect = 3.258e-65
Identity = 175/534 (32.77%), Postives = 270/534 (50.56%), Query Frame = 1
Query: 7993 WKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSS-SGESLTFLFESTYQV-----------DKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGF-INWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPN----ANRKPRLI----DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGE-RLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLF 9528
            W+ L   FT E+  W +  +    ++L   E  S++R +++   +   D +   ++   N+  +S  S E +        +V           D +  +N ++ +     E + +S  C L+       G   V    + F        Y    E     +  GF     L+ +  V  RR+ LR  ALE+   D  +  I     + R+++ S I  + PPN     +R P+ +     + ++W   ++SNF+YL  LNT AGR+YND+ QYPVFP++L +YTS TLDL+  S +RDLSKPI + N    + V     EK + ++        + NID+        +HY + YSN+A V++YMIR+ PFT   IQ Q G FD  DR FH++A++W     S + +KE+IPEFFY PE   N   F+ G  +++   V DV LP W++     F   HR +LES +VS+ L+ W+DL+FG KQ G+ A+ A+N+F+  TY  A+  D I  E  R A E +I N+GQ P QL 
Sbjct: 1881 WRSLRRHFTNERGAWANRVQPEVKWKLSNAETYSKMRLKLVPNYNY--DAHCEASALRDNMGAESPRSSEPIPLAVAKEAKVSVMKDDQLGEEDLVFLDNEVEGEDESQREKLVLSEDCELITIVAVVPGRLEVTTHHLYF--------YDGSSEKEETEEGIGFDFKRPLSQLREVHLRRYNLRRSALELFFIDQSHYFINFKKKV-RNKVYSRILGLRPPNLFYFGSRSPQELLKASGLTQKWVYREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLCDYTSPTLDLSDPSIFRDLSKPIGVVNPRHAQNV----REKYESFE------DPTGNIDK--------FHYGTHYSNAAGVMHYMIRMEPFTTLHIQLQSGRFDVADRQFHSVAAAWQARMESPADVKELIPEFFYFPEFLQNMNGFDLGRLQISQEAVTDVELPRWATSRED-FIRKHRKALESEHVSSHLHEWIDLIFGCKQRGEEAVNALNVFYYCTYEGAVDLDAIANETERKAYEGIISNFGQTPCQLL 2384          
BLAST of Lysosomal trafficking regulator vs. Ensembl Medaka
Match: lrba (LPS responsive beige-like anchor protein [Source:NCBI gene;Acc:101175296])

HSP 1 Score: 241.506 bits (615), Expect = 6.991e-63
Identity = 138/377 (36.60%), Postives = 209/377 (55.44%), Query Frame = 1
Query: 8458 WHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENI-------LPPN---ANRKPRLI----DIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFP 9546
            W   +I  V  RR+ L++ ALE+ M +    L          +++  +  +       LP     +   P+ +    ++ + W   ++SNF+YL FLNT +GR+YND+ QYPVFP+++T Y S  LDLT  S +RDLSKPI    G L  K    F+++ + ++                   VP +HY + YS S+  L +++RI PFT  F+ FQ G+FD  DR F +++ +W       S +KE+IPEF+YLPE+FVNS ++N G   +GT V +V+LP W+      F  I+R +LES +VS QL+ W+DL+FG+KQ G  A  A+N+++  TY  A+    I + + R AVE  I ++GQ P QL I    P
Sbjct: 1977 WLFTEIRAVFSRRYLLQNTALEVFMANRTAVLFNFPDAATVKKVVHCLPRVGVGTSFGLPQTRRISLATPKQLFKASNMTQRWQRREISNFEYLMFLNTISGRTYNDLNQYPVFPWVITNYDSEELDLTLPSNFRDLSKPI----GALNPKRAAFFSDRYESWEDD----------------QVPKFHYGTHYSTSSFTLMWLLRIEPFTTFFLNFQGGKFDHADRTFSSVSRAWRNCQRDTSDVKELIPEFYYLPEMFVNSNNYNLGVMEDGTVVSNVVLPPWAKSPEE-FVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEATRALNVYYYVTYEGAVNLSSINDPMLREAVESQIRSFGQTPCQLLIEPHPP 2332          
BLAST of Lysosomal trafficking regulator vs. Ensembl Medaka
Match: nsmaf (neutral sphingomyelinase activation associated factor [Source:NCBI gene;Acc:101155551])

HSP 1 Score: 218.779 bits (556), Expect = 2.092e-57
Identity = 137/375 (36.53%), Postives = 198/375 (52.80%), Query Frame = 1
Query: 8452 INWHLNDIEWVLRRRFKLRDYALEMIMKDGRNC---LIAMNSTLERDRI----LSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFV-NSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAK 9552
            I   L  +  + +RR  L+   LE+   +   C    +   +T +RD I     +F+EN +  +      L     +W  G +SN+ YL  LN  A RS ND+ QYPVFP+++ +Y SS LDLT  +T+RDLSKP+   N                  +R  R++   + + E      P + Y S YS+   VL+Y++R+ P  +  +  Q+G +D PDRMF+ +A +W       +  KE+IPEF+     F+ N  + + G R NG+ V DV LP W+S DA  F   H+A+LESP+VS  L+ W+DLVFGFKQ G  A  A N+FHP TY   I  D I +  +R A+   I  +GQ PKQLF N   P +
Sbjct:  215 IQIKLQQVRRIYKRRHGLKPLGLEVFCTENDLCSDIYLKFYNTADRDEIYYYMATFLENHITEHTAESYML-----QWQRGHISNYQYLLHLNNLADRSCNDLSQYPVFPWVIADYGSSQLDLTNAATFRDLSKPVGALNK-----------------ERLDRLLARYSGMPE------PRFIYGSHYSSPGYVLFYLVRVAP--EHMLCLQNGRYDHPDRMFNCIAETWKNCLEGATDFKELIPEFYGSDSSFLENRLNLDLGRRQNGSLVGDVSLPPWAS-DASDFLEKHKAALESPFVSEHLHEWIDLVFGFKQRGSDAEAAHNVFHPLTYEGNIDCDSIEDTDQRIAMLTQILEFGQTPKQLF-NSPHPQR 557          
BLAST of Lysosomal trafficking regulator vs. Planmine SMEST
Match: SMESG000069981.1 (SMESG000069981.1)

HSP 1 Score: 4343.11 bits (11263), Expect = 0.000e+0
Identity = 2316/2316 (100.00%), Postives = 2316/2316 (100.00%), Query Frame = 1
Query:  382 MLTKQFLTDLENLYMLKMDSDEKGNELDRLKAYLETEYGALMLYGIEFIIEQILIAKRNNTDSMKSSVLKIIIESELGNILATTLLSILTDMCLNTNQLIDKNFLDSITVPEFTFSQYLRQDFVRSSLFKTNIKQIRRPRPSEELSTDDNEFFPTVKIRTKRRPMKFSKYFARSDGTMNPFPFIVENQSVSEIGELCQSDMDERLYMNPISHTIETSNKVHILTSLRTAARLLYQIIQLDPSMHSDAISIYLEVLKSCCRLLNNVHSDFVSFXXXXXXXXXXXXCNIALTVSILVSEKSSSNSIMTIILGHKVTDRLLEIHQLFHEIHQDFMVLHDINKLVFYIFIIVTKNILENYSGSCRGIIHLLTGWYATGGSQIAQISLNSETSNEDFYFTLKNSKISLFSEICVLLSLLKDIPNEKRLNQIPKNSTEVFSHHSDQFNYIVTAENTDSFKDVCCYGSICYLILDNLVFLLNQDSQLKFISSRKKHIYNHILASIKTIRFCCTVDLMEFSNKLVRRLINPMPAAIKTIVISFLQRIIEISFEFYKLRFSCDCQFSSRHDVVGILQMIRNVCIPKSKEPICPLSCYNATFVELLHFIDWLGNIQDDKMKALVKENVIQPIFKRTNQYASNLHSSYCGMIGSSMFSLLPYMNYSWENDDLNLLWSACEKFPKLKRNYYKCLTITLLSTRSSPVEDSKELSMKTRIIDFLVSRVNFEILMKQMDHNSGSIKLLFEDIYIWECFRILFTYNDEFRRSMFTSNGIDCCYVMLKEIIEFISILTDENLETYKLSGFLLFESLMCLVIDGNMLKNXXXXXXXXXXXXWVQIQSSILKYFPKEESVAQSLIQSLLNCCFRHKWTVQNDLYQLRRLFLDSIVSKNISITNQGSEIDISDVGIESSFSEPXXXXXXXXXXXXXVNGSHKYDADVSSDLVNDDESELRARKKHNLRDTEGERANVFIDINTAYTNGSNMEINTDFLRLFIKIILSLPIDNYHFIGQKALESVYYSLRYIPDKNQQSFICDDFMEKMMCSIENILNSHDIPGXXXXXXXXXXXPFSCWCTAKRLRFLINLSEKNPGLKVQIIKMLIEKAELINSLQPDLSLMVPVHQNIPKSVRGWRNSNFEFYSFDEEIGDVSNYLFETKLNRPNWKGLDFDNSCENSGFSVSMWIQMDSTVEYKRRKKSGEMXXXXXXXXXXXXXXXXXXXXXXXQSIQDFIHVASIYSKDKNSSFKSQCFQIWCKPSTGTIMIRFYQRIYQTVNLDPNKPATPLPQMRESRSQIFNIFQSQTVXXXXXXXXXXXXXXXXXXXXFVLVGESMLNNVLPLNAWNFVTVSVNWKSPEVGEVFCVINGDFSYESKLIRNSHYVYQGSQSLESFFNIGQLGCPPGGSSHLKYNLGSLFIFEGAKIQTANENLSLMFLSPNWDGGSMMLNAAQRDSANTLGLVIMRILADRQVGSEFVASMLERCQNILQNNWLEKMNELITNNLVATFTCGDIPRFDVNEMCSADSEMPTLSPNYYQFSSIVSPKSETEVPVAFSSNCFSKYFIIKASVDSAIENLGGISIMIFWLAKVVESGDEVSTRYXXXXXXXXXRKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQHMIYEDPTKSKLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQEPFEALEHPLPVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHPISMKDNDIDSGQYYRHLKAFTKMEVEKSTDDHNEIDGTFPEKARVCKINIQRGNHLKLNPERDITEQLSISLMGSKVSEVEKKTLQQFYVATLTDNRQDSNENNEFLDIXXXXXXXXXXXXXCPTLIDENDKNEMNSSFETSFIASNNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQKSLSLFRVYLYRKKSXXXXXXXXXXXXXXVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWEXXXXXXXXXXXXXXXXXXXMNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAXXXXXXXXXXXXXXMLWAFKICGWLFVNHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKFLFKYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC 7329
            MLTKQFLTDLENLYMLKMDSDEKGNELDRLKAYLETEYGALMLYGIEFIIEQILIAKRNNTDSMKSSVLKIIIESELGNILATTLLSILTDMCLNTNQLIDKNFLDSITVPEFTFSQYLRQDFVRSSLFKTNIKQIRRPRPSEELSTDDNEFFPTVKIRTKRRPMKFSKYFARSDGTMNPFPFIVENQSVSEIGELCQSDMDERLYMNPISHTIETSNKVHILTSLRTAARLLYQIIQLDPSMHSDAISIYLEVLKSCCRLLNNVHSDFVSFQQQLLKLADDLLCNIALTVSILVSEKSSSNSIMTIILGHKVTDRLLEIHQLFHEIHQDFMVLHDINKLVFYIFIIVTKNILENYSGSCRGIIHLLTGWYATGGSQIAQISLNSETSNEDFYFTLKNSKISLFSEICVLLSLLKDIPNEKRLNQIPKNSTEVFSHHSDQFNYIVTAENTDSFKDVCCYGSICYLILDNLVFLLNQDSQLKFISSRKKHIYNHILASIKTIRFCCTVDLMEFSNKLVRRLINPMPAAIKTIVISFLQRIIEISFEFYKLRFSCDCQFSSRHDVVGILQMIRNVCIPKSKEPICPLSCYNATFVELLHFIDWLGNIQDDKMKALVKENVIQPIFKRTNQYASNLHSSYCGMIGSSMFSLLPYMNYSWENDDLNLLWSACEKFPKLKRNYYKCLTITLLSTRSSPVEDSKELSMKTRIIDFLVSRVNFEILMKQMDHNSGSIKLLFEDIYIWECFRILFTYNDEFRRSMFTSNGIDCCYVMLKEIIEFISILTDENLETYKLSGFLLFESLMCLVIDGNMLKNIYYYEGYSYEIIWVQIQSSILKYFPKEESVAQSLIQSLLNCCFRHKWTVQNDLYQLRRLFLDSIVSKNISITNQGSEIDISDVGIESSFSEPEDDIGGDEDDSDIVNGSHKYDADVSSDLVNDDESELRARKKHNLRDTEGERANVFIDINTAYTNGSNMEINTDFLRLFIKIILSLPIDNYHFIGQKALESVYYSLRYIPDKNQQSFICDDFMEKMMCSIENILNSHDIPGLQLILLKLLTLPFSCWCTAKRLRFLINLSEKNPGLKVQIIKMLIEKAELINSLQPDLSLMVPVHQNIPKSVRGWRNSNFEFYSFDEEIGDVSNYLFETKLNRPNWKGLDFDNSCENSGFSVSMWIQMDSTVEYKRRKKSGEMKKNKKKSNKLSANANSLSKLLLLQSIQDFIHVASIYSKDKNSSFKSQCFQIWCKPSTGTIMIRFYQRIYQTVNLDPNKPATPLPQMRESRSQIFNIFQSQTVSRWDSNDSSSLLDTNSRNSSFVLVGESMLNNVLPLNAWNFVTVSVNWKSPEVGEVFCVINGDFSYESKLIRNSHYVYQGSQSLESFFNIGQLGCPPGGSSHLKYNLGSLFIFEGAKIQTANENLSLMFLSPNWDGGSMMLNAAQRDSANTLGLVIMRILADRQVGSEFVASMLERCQNILQNNWLEKMNELITNNLVATFTCGDIPRFDVNEMCSADSEMPTLSPNYYQFSSIVSPKSETEVPVAFSSNCFSKYFIIKASVDSAIENLGGISIMIFWLAKVVESGDEVSTRYLLKLILLLIRKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQHMIYEDPTKSKLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQEPFEALEHPLPVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHPISMKDNDIDSGQYYRHLKAFTKMEVEKSTDDHNEIDGTFPEKARVCKINIQRGNHLKLNPERDITEQLSISLMGSKVSEVEKKTLQQFYVATLTDNRQDSNENNEFLDIESSMESSSSEPSSCPTLIDENDKNEMNSSFETSFIASNNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQKSLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWENFSIFNSSSNSSKSAEHNSMNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAFKICGWLFVNHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKFLFKYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC
Sbjct:    1 MLTKQFLTDLENLYMLKMDSDEKGNELDRLKAYLETEYGALMLYGIEFIIEQILIAKRNNTDSMKSSVLKIIIESELGNILATTLLSILTDMCLNTNQLIDKNFLDSITVPEFTFSQYLRQDFVRSSLFKTNIKQIRRPRPSEELSTDDNEFFPTVKIRTKRRPMKFSKYFARSDGTMNPFPFIVENQSVSEIGELCQSDMDERLYMNPISHTIETSNKVHILTSLRTAARLLYQIIQLDPSMHSDAISIYLEVLKSCCRLLNNVHSDFVSFQQQLLKLADDLLCNIALTVSILVSEKSSSNSIMTIILGHKVTDRLLEIHQLFHEIHQDFMVLHDINKLVFYIFIIVTKNILENYSGSCRGIIHLLTGWYATGGSQIAQISLNSETSNEDFYFTLKNSKISLFSEICVLLSLLKDIPNEKRLNQIPKNSTEVFSHHSDQFNYIVTAENTDSFKDVCCYGSICYLILDNLVFLLNQDSQLKFISSRKKHIYNHILASIKTIRFCCTVDLMEFSNKLVRRLINPMPAAIKTIVISFLQRIIEISFEFYKLRFSCDCQFSSRHDVVGILQMIRNVCIPKSKEPICPLSCYNATFVELLHFIDWLGNIQDDKMKALVKENVIQPIFKRTNQYASNLHSSYCGMIGSSMFSLLPYMNYSWENDDLNLLWSACEKFPKLKRNYYKCLTITLLSTRSSPVEDSKELSMKTRIIDFLVSRVNFEILMKQMDHNSGSIKLLFEDIYIWECFRILFTYNDEFRRSMFTSNGIDCCYVMLKEIIEFISILTDENLETYKLSGFLLFESLMCLVIDGNMLKNIYYYEGYSYEIIWVQIQSSILKYFPKEESVAQSLIQSLLNCCFRHKWTVQNDLYQLRRLFLDSIVSKNISITNQGSEIDISDVGIESSFSEPEDDIGGDEDDSDIVNGSHKYDADVSSDLVNDDESELRARKKHNLRDTEGERANVFIDINTAYTNGSNMEINTDFLRLFIKIILSLPIDNYHFIGQKALESVYYSLRYIPDKNQQSFICDDFMEKMMCSIENILNSHDIPGLQLILLKLLTLPFSCWCTAKRLRFLINLSEKNPGLKVQIIKMLIEKAELINSLQPDLSLMVPVHQNIPKSVRGWRNSNFEFYSFDEEIGDVSNYLFETKLNRPNWKGLDFDNSCENSGFSVSMWIQMDSTVEYKRRKKSGEMKKNKKKSNKLSANANSLSKLLLLQSIQDFIHVASIYSKDKNSSFKSQCFQIWCKPSTGTIMIRFYQRIYQTVNLDPNKPATPLPQMRESRSQIFNIFQSQTVSRWDSNDSSSLLDTNSRNSSFVLVGESMLNNVLPLNAWNFVTVSVNWKSPEVGEVFCVINGDFSYESKLIRNSHYVYQGSQSLESFFNIGQLGCPPGGSSHLKYNLGSLFIFEGAKIQTANENLSLMFLSPNWDGGSMMLNAAQRDSANTLGLVIMRILADRQVGSEFVASMLERCQNILQNNWLEKMNELITNNLVATFTCGDIPRFDVNEMCSADSEMPTLSPNYYQFSSIVSPKSETEVPVAFSSNCFSKYFIIKASVDSAIENLGGISIMIFWLAKVVESGDEVSTRYLLKLILLLIRKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQHMIYEDPTKSKLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQEPFEALEHPLPVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHPISMKDNDIDSGQYYRHLKAFTKMEVEKSTDDHNEIDGTFPEKARVCKINIQRGNHLKLNPERDITEQLSISLMGSKVSEVEKKTLQQFYVATLTDNRQDSNENNEFLDIESSMESSSSEPSSCPTLIDENDKNEMNSSFETSFIASNNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQKSLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWENFSIFNSSSNSSKSAEHNSMNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAFKICGWLFVNHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKFLFKYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC 2316          
BLAST of Lysosomal trafficking regulator vs. Planmine SMEST
Match: SMESG000069981.1 (SMESG000069981.1)

HSP 1 Score: 4313.84 bits (11187), Expect = 0.000e+0
Identity = 2302/2302 (100.00%), Postives = 2302/2302 (100.00%), Query Frame = 1
Query:  424 MLKMDSDEKGNELDRLKAYLETEYGALMLYGIEFIIEQILIAKRNNTDSMKSSVLKIIIESELGNILATTLLSILTDMCLNTNQLIDKNFLDSITVPEFTFSQYLRQDFVRSSLFKTNIKQIRRPRPSEELSTDDNEFFPTVKIRTKRRPMKFSKYFARSDGTMNPFPFIVENQSVSEIGELCQSDMDERLYMNPISHTIETSNKVHILTSLRTAARLLYQIIQLDPSMHSDAISIYLEVLKSCCRLLNNVHSDFVSFXXXXXXXXXXXXCNIALTVSILVSEKSSSNSIMTIILGHKVTDRLLEIHQLFHEIHQDFMVLHDINKLVFYIFIIVTKNILENYSGSCRGIIHLLTGWYATGGSQIAQISLNSETSNEDFYFTLKNSKISLFSEICVLLSLLKDIPNEKRLNQIPKNSTEVFSHHSDQFNYIVTAENTDSFKDVCCYGSICYLILDNLVFLLNQDSQLKFISSRKKHIYNHILASIKTIRFCCTVDLMEFSNKLVRRLINPMPAAIKTIVISFLQRIIEISFEFYKLRFSCDCQFSSRHDVVGILQMIRNVCIPKSKEPICPLSCYNATFVELLHFIDWLGNIQDDKMKALVKENVIQPIFKRTNQYASNLHSSYCGMIGSSMFSLLPYMNYSWENDDLNLLWSACEKFPKLKRNYYKCLTITLLSTRSSPVEDSKELSMKTRIIDFLVSRVNFEILMKQMDHNSGSIKLLFEDIYIWECFRILFTYNDEFRRSMFTSNGIDCCYVMLKEIIEFISILTDENLETYKLSGFLLFESLMCLVIDGNMLKNXXXXXXXXXXXXWVQIQSSILKYFPKEESVAQSLIQSLLNCCFRHKWTVQNDLYQLRRLFLDSIVSKNISITNQGSEIDISDVGIESSFSEPXXXXXXXXXXXXXVNGSHKYDADVSSDLVNDDESELRARKKHNLRDTEGERANVFIDINTAYTNGSNMEINTDFLRLFIKIILSLPIDNYHFIGQKALESVYYSLRYIPDKNQQSFICDDFMEKMMCSIENILNSHDIPGXXXXXXXXXXXPFSCWCTAKRLRFLINLSEKNPGLKVQIIKMLIEKAELINSLQPDLSLMVPVHQNIPKSVRGWRNSNFEFYSFDEEIGDVSNYLFETKLNRPNWKGLDFDNSCENSGFSVSMWIQMDSTVEYKRRKKSGEMXXXXXXXXXXXXXXXXXXXXXXXQSIQDFIHVASIYSKDKNSSFKSQCFQIWCKPSTGTIMIRFYQRIYQTVNLDPNKPATPLPQMRESRSQIFNIFQSQTVXXXXXXXXXXXXXXXXXXXXFVLVGESMLNNVLPLNAWNFVTVSVNWKSPEVGEVFCVINGDFSYESKLIRNSHYVYQGSQSLESFFNIGQLGCPPGGSSHLKYNLGSLFIFEGAKIQTANENLSLMFLSPNWDGGSMMLNAAQRDSANTLGLVIMRILADRQVGSEFVASMLERCQNILQNNWLEKMNELITNNLVATFTCGDIPRFDVNEMCSADSEMPTLSPNYYQFSSIVSPKSETEVPVAFSSNCFSKYFIIKASVDSAIENLGGISIMIFWLAKVVESGDEVSTRYXXXXXXXXXRKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQHMIYEDPTKSKLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQEPFEALEHPLPVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHPISMKDNDIDSGQYYRHLKAFTKMEVEKSTDDHNEIDGTFPEKARVCKINIQRGNHLKLNPERDITEQLSISLMGSKVSEVEKKTLQQFYVATLTDNRQDSNENNEFLDIXXXXXXXXXXXXXCPTLIDENDKNEMNSSFETSFIASNNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQKSLSLFRVYLYRKKSXXXXXXXXXXXXXXVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWEXXXXXXXXXXXXXXXXXXXMNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAXXXXXXXXXXXXXXMLWAFKICGWLFVNHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKFLFKYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC 7329
            MLKMDSDEKGNELDRLKAYLETEYGALMLYGIEFIIEQILIAKRNNTDSMKSSVLKIIIESELGNILATTLLSILTDMCLNTNQLIDKNFLDSITVPEFTFSQYLRQDFVRSSLFKTNIKQIRRPRPSEELSTDDNEFFPTVKIRTKRRPMKFSKYFARSDGTMNPFPFIVENQSVSEIGELCQSDMDERLYMNPISHTIETSNKVHILTSLRTAARLLYQIIQLDPSMHSDAISIYLEVLKSCCRLLNNVHSDFVSFQQQLLKLADDLLCNIALTVSILVSEKSSSNSIMTIILGHKVTDRLLEIHQLFHEIHQDFMVLHDINKLVFYIFIIVTKNILENYSGSCRGIIHLLTGWYATGGSQIAQISLNSETSNEDFYFTLKNSKISLFSEICVLLSLLKDIPNEKRLNQIPKNSTEVFSHHSDQFNYIVTAENTDSFKDVCCYGSICYLILDNLVFLLNQDSQLKFISSRKKHIYNHILASIKTIRFCCTVDLMEFSNKLVRRLINPMPAAIKTIVISFLQRIIEISFEFYKLRFSCDCQFSSRHDVVGILQMIRNVCIPKSKEPICPLSCYNATFVELLHFIDWLGNIQDDKMKALVKENVIQPIFKRTNQYASNLHSSYCGMIGSSMFSLLPYMNYSWENDDLNLLWSACEKFPKLKRNYYKCLTITLLSTRSSPVEDSKELSMKTRIIDFLVSRVNFEILMKQMDHNSGSIKLLFEDIYIWECFRILFTYNDEFRRSMFTSNGIDCCYVMLKEIIEFISILTDENLETYKLSGFLLFESLMCLVIDGNMLKNIYYYEGYSYEIIWVQIQSSILKYFPKEESVAQSLIQSLLNCCFRHKWTVQNDLYQLRRLFLDSIVSKNISITNQGSEIDISDVGIESSFSEPEDDIGGDEDDSDIVNGSHKYDADVSSDLVNDDESELRARKKHNLRDTEGERANVFIDINTAYTNGSNMEINTDFLRLFIKIILSLPIDNYHFIGQKALESVYYSLRYIPDKNQQSFICDDFMEKMMCSIENILNSHDIPGLQLILLKLLTLPFSCWCTAKRLRFLINLSEKNPGLKVQIIKMLIEKAELINSLQPDLSLMVPVHQNIPKSVRGWRNSNFEFYSFDEEIGDVSNYLFETKLNRPNWKGLDFDNSCENSGFSVSMWIQMDSTVEYKRRKKSGEMKKNKKKSNKLSANANSLSKLLLLQSIQDFIHVASIYSKDKNSSFKSQCFQIWCKPSTGTIMIRFYQRIYQTVNLDPNKPATPLPQMRESRSQIFNIFQSQTVSRWDSNDSSSLLDTNSRNSSFVLVGESMLNNVLPLNAWNFVTVSVNWKSPEVGEVFCVINGDFSYESKLIRNSHYVYQGSQSLESFFNIGQLGCPPGGSSHLKYNLGSLFIFEGAKIQTANENLSLMFLSPNWDGGSMMLNAAQRDSANTLGLVIMRILADRQVGSEFVASMLERCQNILQNNWLEKMNELITNNLVATFTCGDIPRFDVNEMCSADSEMPTLSPNYYQFSSIVSPKSETEVPVAFSSNCFSKYFIIKASVDSAIENLGGISIMIFWLAKVVESGDEVSTRYLLKLILLLIRKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQHMIYEDPTKSKLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQEPFEALEHPLPVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHPISMKDNDIDSGQYYRHLKAFTKMEVEKSTDDHNEIDGTFPEKARVCKINIQRGNHLKLNPERDITEQLSISLMGSKVSEVEKKTLQQFYVATLTDNRQDSNENNEFLDIESSMESSSSEPSSCPTLIDENDKNEMNSSFETSFIASNNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQKSLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWENFSIFNSSSNSSKSAEHNSMNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAFKICGWLFVNHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKFLFKYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC
Sbjct:    1 MLKMDSDEKGNELDRLKAYLETEYGALMLYGIEFIIEQILIAKRNNTDSMKSSVLKIIIESELGNILATTLLSILTDMCLNTNQLIDKNFLDSITVPEFTFSQYLRQDFVRSSLFKTNIKQIRRPRPSEELSTDDNEFFPTVKIRTKRRPMKFSKYFARSDGTMNPFPFIVENQSVSEIGELCQSDMDERLYMNPISHTIETSNKVHILTSLRTAARLLYQIIQLDPSMHSDAISIYLEVLKSCCRLLNNVHSDFVSFQQQLLKLADDLLCNIALTVSILVSEKSSSNSIMTIILGHKVTDRLLEIHQLFHEIHQDFMVLHDINKLVFYIFIIVTKNILENYSGSCRGIIHLLTGWYATGGSQIAQISLNSETSNEDFYFTLKNSKISLFSEICVLLSLLKDIPNEKRLNQIPKNSTEVFSHHSDQFNYIVTAENTDSFKDVCCYGSICYLILDNLVFLLNQDSQLKFISSRKKHIYNHILASIKTIRFCCTVDLMEFSNKLVRRLINPMPAAIKTIVISFLQRIIEISFEFYKLRFSCDCQFSSRHDVVGILQMIRNVCIPKSKEPICPLSCYNATFVELLHFIDWLGNIQDDKMKALVKENVIQPIFKRTNQYASNLHSSYCGMIGSSMFSLLPYMNYSWENDDLNLLWSACEKFPKLKRNYYKCLTITLLSTRSSPVEDSKELSMKTRIIDFLVSRVNFEILMKQMDHNSGSIKLLFEDIYIWECFRILFTYNDEFRRSMFTSNGIDCCYVMLKEIIEFISILTDENLETYKLSGFLLFESLMCLVIDGNMLKNIYYYEGYSYEIIWVQIQSSILKYFPKEESVAQSLIQSLLNCCFRHKWTVQNDLYQLRRLFLDSIVSKNISITNQGSEIDISDVGIESSFSEPEDDIGGDEDDSDIVNGSHKYDADVSSDLVNDDESELRARKKHNLRDTEGERANVFIDINTAYTNGSNMEINTDFLRLFIKIILSLPIDNYHFIGQKALESVYYSLRYIPDKNQQSFICDDFMEKMMCSIENILNSHDIPGLQLILLKLLTLPFSCWCTAKRLRFLINLSEKNPGLKVQIIKMLIEKAELINSLQPDLSLMVPVHQNIPKSVRGWRNSNFEFYSFDEEIGDVSNYLFETKLNRPNWKGLDFDNSCENSGFSVSMWIQMDSTVEYKRRKKSGEMKKNKKKSNKLSANANSLSKLLLLQSIQDFIHVASIYSKDKNSSFKSQCFQIWCKPSTGTIMIRFYQRIYQTVNLDPNKPATPLPQMRESRSQIFNIFQSQTVSRWDSNDSSSLLDTNSRNSSFVLVGESMLNNVLPLNAWNFVTVSVNWKSPEVGEVFCVINGDFSYESKLIRNSHYVYQGSQSLESFFNIGQLGCPPGGSSHLKYNLGSLFIFEGAKIQTANENLSLMFLSPNWDGGSMMLNAAQRDSANTLGLVIMRILADRQVGSEFVASMLERCQNILQNNWLEKMNELITNNLVATFTCGDIPRFDVNEMCSADSEMPTLSPNYYQFSSIVSPKSETEVPVAFSSNCFSKYFIIKASVDSAIENLGGISIMIFWLAKVVESGDEVSTRYLLKLILLLIRKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQHMIYEDPTKSKLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQEPFEALEHPLPVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHPISMKDNDIDSGQYYRHLKAFTKMEVEKSTDDHNEIDGTFPEKARVCKINIQRGNHLKLNPERDITEQLSISLMGSKVSEVEKKTLQQFYVATLTDNRQDSNENNEFLDIESSMESSSSEPSSCPTLIDENDKNEMNSSFETSFIASNNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQKSLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWENFSIFNSSSNSSKSAEHNSMNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAFKICGWLFVNHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKFLFKYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC 2302          
BLAST of Lysosomal trafficking regulator vs. Planmine SMEST
Match: SMESG000069981.1 (SMESG000069981.1)

HSP 1 Score: 4308.06 bits (11172), Expect = 0.000e+0
Identity = 2299/2299 (100.00%), Postives = 2299/2299 (100.00%), Query Frame = 1
Query:  433 MDSDEKGNELDRLKAYLETEYGALMLYGIEFIIEQILIAKRNNTDSMKSSVLKIIIESELGNILATTLLSILTDMCLNTNQLIDKNFLDSITVPEFTFSQYLRQDFVRSSLFKTNIKQIRRPRPSEELSTDDNEFFPTVKIRTKRRPMKFSKYFARSDGTMNPFPFIVENQSVSEIGELCQSDMDERLYMNPISHTIETSNKVHILTSLRTAARLLYQIIQLDPSMHSDAISIYLEVLKSCCRLLNNVHSDFVSFXXXXXXXXXXXXCNIALTVSILVSEKSSSNSIMTIILGHKVTDRLLEIHQLFHEIHQDFMVLHDINKLVFYIFIIVTKNILENYSGSCRGIIHLLTGWYATGGSQIAQISLNSETSNEDFYFTLKNSKISLFSEICVLLSLLKDIPNEKRLNQIPKNSTEVFSHHSDQFNYIVTAENTDSFKDVCCYGSICYLILDNLVFLLNQDSQLKFISSRKKHIYNHILASIKTIRFCCTVDLMEFSNKLVRRLINPMPAAIKTIVISFLQRIIEISFEFYKLRFSCDCQFSSRHDVVGILQMIRNVCIPKSKEPICPLSCYNATFVELLHFIDWLGNIQDDKMKALVKENVIQPIFKRTNQYASNLHSSYCGMIGSSMFSLLPYMNYSWENDDLNLLWSACEKFPKLKRNYYKCLTITLLSTRSSPVEDSKELSMKTRIIDFLVSRVNFEILMKQMDHNSGSIKLLFEDIYIWECFRILFTYNDEFRRSMFTSNGIDCCYVMLKEIIEFISILTDENLETYKLSGFLLFESLMCLVIDGNMLKNXXXXXXXXXXXXWVQIQSSILKYFPKEESVAQSLIQSLLNCCFRHKWTVQNDLYQLRRLFLDSIVSKNISITNQGSEIDISDVGIESSFSEPXXXXXXXXXXXXXVNGSHKYDADVSSDLVNDDESELRARKKHNLRDTEGERANVFIDINTAYTNGSNMEINTDFLRLFIKIILSLPIDNYHFIGQKALESVYYSLRYIPDKNQQSFICDDFMEKMMCSIENILNSHDIPGXXXXXXXXXXXPFSCWCTAKRLRFLINLSEKNPGLKVQIIKMLIEKAELINSLQPDLSLMVPVHQNIPKSVRGWRNSNFEFYSFDEEIGDVSNYLFETKLNRPNWKGLDFDNSCENSGFSVSMWIQMDSTVEYKRRKKSGEMXXXXXXXXXXXXXXXXXXXXXXXQSIQDFIHVASIYSKDKNSSFKSQCFQIWCKPSTGTIMIRFYQRIYQTVNLDPNKPATPLPQMRESRSQIFNIFQSQTVXXXXXXXXXXXXXXXXXXXXFVLVGESMLNNVLPLNAWNFVTVSVNWKSPEVGEVFCVINGDFSYESKLIRNSHYVYQGSQSLESFFNIGQLGCPPGGSSHLKYNLGSLFIFEGAKIQTANENLSLMFLSPNWDGGSMMLNAAQRDSANTLGLVIMRILADRQVGSEFVASMLERCQNILQNNWLEKMNELITNNLVATFTCGDIPRFDVNEMCSADSEMPTLSPNYYQFSSIVSPKSETEVPVAFSSNCFSKYFIIKASVDSAIENLGGISIMIFWLAKVVESGDEVSTRYXXXXXXXXXRKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQHMIYEDPTKSKLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQEPFEALEHPLPVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHPISMKDNDIDSGQYYRHLKAFTKMEVEKSTDDHNEIDGTFPEKARVCKINIQRGNHLKLNPERDITEQLSISLMGSKVSEVEKKTLQQFYVATLTDNRQDSNENNEFLDIXXXXXXXXXXXXXCPTLIDENDKNEMNSSFETSFIASNNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQKSLSLFRVYLYRKKSXXXXXXXXXXXXXXVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWEXXXXXXXXXXXXXXXXXXXMNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAXXXXXXXXXXXXXXMLWAFKICGWLFVNHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKFLFKYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC 7329
            MDSDEKGNELDRLKAYLETEYGALMLYGIEFIIEQILIAKRNNTDSMKSSVLKIIIESELGNILATTLLSILTDMCLNTNQLIDKNFLDSITVPEFTFSQYLRQDFVRSSLFKTNIKQIRRPRPSEELSTDDNEFFPTVKIRTKRRPMKFSKYFARSDGTMNPFPFIVENQSVSEIGELCQSDMDERLYMNPISHTIETSNKVHILTSLRTAARLLYQIIQLDPSMHSDAISIYLEVLKSCCRLLNNVHSDFVSFQQQLLKLADDLLCNIALTVSILVSEKSSSNSIMTIILGHKVTDRLLEIHQLFHEIHQDFMVLHDINKLVFYIFIIVTKNILENYSGSCRGIIHLLTGWYATGGSQIAQISLNSETSNEDFYFTLKNSKISLFSEICVLLSLLKDIPNEKRLNQIPKNSTEVFSHHSDQFNYIVTAENTDSFKDVCCYGSICYLILDNLVFLLNQDSQLKFISSRKKHIYNHILASIKTIRFCCTVDLMEFSNKLVRRLINPMPAAIKTIVISFLQRIIEISFEFYKLRFSCDCQFSSRHDVVGILQMIRNVCIPKSKEPICPLSCYNATFVELLHFIDWLGNIQDDKMKALVKENVIQPIFKRTNQYASNLHSSYCGMIGSSMFSLLPYMNYSWENDDLNLLWSACEKFPKLKRNYYKCLTITLLSTRSSPVEDSKELSMKTRIIDFLVSRVNFEILMKQMDHNSGSIKLLFEDIYIWECFRILFTYNDEFRRSMFTSNGIDCCYVMLKEIIEFISILTDENLETYKLSGFLLFESLMCLVIDGNMLKNIYYYEGYSYEIIWVQIQSSILKYFPKEESVAQSLIQSLLNCCFRHKWTVQNDLYQLRRLFLDSIVSKNISITNQGSEIDISDVGIESSFSEPEDDIGGDEDDSDIVNGSHKYDADVSSDLVNDDESELRARKKHNLRDTEGERANVFIDINTAYTNGSNMEINTDFLRLFIKIILSLPIDNYHFIGQKALESVYYSLRYIPDKNQQSFICDDFMEKMMCSIENILNSHDIPGLQLILLKLLTLPFSCWCTAKRLRFLINLSEKNPGLKVQIIKMLIEKAELINSLQPDLSLMVPVHQNIPKSVRGWRNSNFEFYSFDEEIGDVSNYLFETKLNRPNWKGLDFDNSCENSGFSVSMWIQMDSTVEYKRRKKSGEMKKNKKKSNKLSANANSLSKLLLLQSIQDFIHVASIYSKDKNSSFKSQCFQIWCKPSTGTIMIRFYQRIYQTVNLDPNKPATPLPQMRESRSQIFNIFQSQTVSRWDSNDSSSLLDTNSRNSSFVLVGESMLNNVLPLNAWNFVTVSVNWKSPEVGEVFCVINGDFSYESKLIRNSHYVYQGSQSLESFFNIGQLGCPPGGSSHLKYNLGSLFIFEGAKIQTANENLSLMFLSPNWDGGSMMLNAAQRDSANTLGLVIMRILADRQVGSEFVASMLERCQNILQNNWLEKMNELITNNLVATFTCGDIPRFDVNEMCSADSEMPTLSPNYYQFSSIVSPKSETEVPVAFSSNCFSKYFIIKASVDSAIENLGGISIMIFWLAKVVESGDEVSTRYLLKLILLLIRKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQHMIYEDPTKSKLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQEPFEALEHPLPVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHPISMKDNDIDSGQYYRHLKAFTKMEVEKSTDDHNEIDGTFPEKARVCKINIQRGNHLKLNPERDITEQLSISLMGSKVSEVEKKTLQQFYVATLTDNRQDSNENNEFLDIESSMESSSSEPSSCPTLIDENDKNEMNSSFETSFIASNNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQKSLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWENFSIFNSSSNSSKSAEHNSMNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAFKICGWLFVNHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKFLFKYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC
Sbjct:    1 MDSDEKGNELDRLKAYLETEYGALMLYGIEFIIEQILIAKRNNTDSMKSSVLKIIIESELGNILATTLLSILTDMCLNTNQLIDKNFLDSITVPEFTFSQYLRQDFVRSSLFKTNIKQIRRPRPSEELSTDDNEFFPTVKIRTKRRPMKFSKYFARSDGTMNPFPFIVENQSVSEIGELCQSDMDERLYMNPISHTIETSNKVHILTSLRTAARLLYQIIQLDPSMHSDAISIYLEVLKSCCRLLNNVHSDFVSFQQQLLKLADDLLCNIALTVSILVSEKSSSNSIMTIILGHKVTDRLLEIHQLFHEIHQDFMVLHDINKLVFYIFIIVTKNILENYSGSCRGIIHLLTGWYATGGSQIAQISLNSETSNEDFYFTLKNSKISLFSEICVLLSLLKDIPNEKRLNQIPKNSTEVFSHHSDQFNYIVTAENTDSFKDVCCYGSICYLILDNLVFLLNQDSQLKFISSRKKHIYNHILASIKTIRFCCTVDLMEFSNKLVRRLINPMPAAIKTIVISFLQRIIEISFEFYKLRFSCDCQFSSRHDVVGILQMIRNVCIPKSKEPICPLSCYNATFVELLHFIDWLGNIQDDKMKALVKENVIQPIFKRTNQYASNLHSSYCGMIGSSMFSLLPYMNYSWENDDLNLLWSACEKFPKLKRNYYKCLTITLLSTRSSPVEDSKELSMKTRIIDFLVSRVNFEILMKQMDHNSGSIKLLFEDIYIWECFRILFTYNDEFRRSMFTSNGIDCCYVMLKEIIEFISILTDENLETYKLSGFLLFESLMCLVIDGNMLKNIYYYEGYSYEIIWVQIQSSILKYFPKEESVAQSLIQSLLNCCFRHKWTVQNDLYQLRRLFLDSIVSKNISITNQGSEIDISDVGIESSFSEPEDDIGGDEDDSDIVNGSHKYDADVSSDLVNDDESELRARKKHNLRDTEGERANVFIDINTAYTNGSNMEINTDFLRLFIKIILSLPIDNYHFIGQKALESVYYSLRYIPDKNQQSFICDDFMEKMMCSIENILNSHDIPGLQLILLKLLTLPFSCWCTAKRLRFLINLSEKNPGLKVQIIKMLIEKAELINSLQPDLSLMVPVHQNIPKSVRGWRNSNFEFYSFDEEIGDVSNYLFETKLNRPNWKGLDFDNSCENSGFSVSMWIQMDSTVEYKRRKKSGEMKKNKKKSNKLSANANSLSKLLLLQSIQDFIHVASIYSKDKNSSFKSQCFQIWCKPSTGTIMIRFYQRIYQTVNLDPNKPATPLPQMRESRSQIFNIFQSQTVSRWDSNDSSSLLDTNSRNSSFVLVGESMLNNVLPLNAWNFVTVSVNWKSPEVGEVFCVINGDFSYESKLIRNSHYVYQGSQSLESFFNIGQLGCPPGGSSHLKYNLGSLFIFEGAKIQTANENLSLMFLSPNWDGGSMMLNAAQRDSANTLGLVIMRILADRQVGSEFVASMLERCQNILQNNWLEKMNELITNNLVATFTCGDIPRFDVNEMCSADSEMPTLSPNYYQFSSIVSPKSETEVPVAFSSNCFSKYFIIKASVDSAIENLGGISIMIFWLAKVVESGDEVSTRYLLKLILLLIRKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQHMIYEDPTKSKLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLDKYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQEPFEALEHPLPVGICKILIQIINNLIPTPVDISIVTKLCNTILQLHPISMKDNDIDSGQYYRHLKAFTKMEVEKSTDDHNEIDGTFPEKARVCKINIQRGNHLKLNPERDITEQLSISLMGSKVSEVEKKTLQQFYVATLTDNRQDSNENNEFLDIESSMESSSSEPSSCPTLIDENDKNEMNSSFETSFIASNNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQKSLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWENFSIFNSSSNSSKSAEHNSMNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAFKICGWLFVNHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKFLFKYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC 2299          
BLAST of Lysosomal trafficking regulator vs. Planmine SMEST
Match: SMESG000069985.1 (SMESG000069985.1)

HSP 1 Score: 2281.52 bits (5911), Expect = 0.000e+0
Identity = 1172/1183 (99.07%), Postives = 1176/1183 (99.41%), Query Frame = 1
Query: 7390 MILISNCLACNQTPDEFSVFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEEFIKSLSQLLFAISPDFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSKMTSKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQXXXXXXXXXXXXIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNSQYISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGRLTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESGHLQVLQSNRLDLSPRQSIYFWL*LFFSKCFSLINFV 10938
            MILISNCLACNQTPDEFSVFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYCLLGNSSGSLCLILNVKQILEHVKRSGNQTEEFIKSLSQLLFAISPDFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMASSWHLSTSSLSCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFINEIHKKKENIIGNLFLLPTSKMTSKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLGSFLVSVGSGQGVVKSIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQSSKKFNFSSSGNIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNSQYISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGRLTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESGHLQVLQSNRLDLSPRQSIYFW   F+  C SL++ +
Sbjct:    1 MILISNCLACNQTPDEFSVFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYCLLGNSSGSLCLILNVKQILEHVKRSGNQTEEFIKSLSQLLFAISPDFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMASSWHLSTSSLSCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFINEIHKKKENIIGNLFLLPTSKMTSKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLGSFLVSVGSGQGVVKSIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQSSKKFNFSSSGNIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNSQYISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGRLTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESGHLQVLQSNRLDLSPRQSIYFWT-QFYLLCKSLVSTI 1182          
BLAST of Lysosomal trafficking regulator vs. Planmine SMEST
Match: SMESG000069985.1 (SMESG000069985.1)

HSP 1 Score: 2273.82 bits (5891), Expect = 0.000e+0
Identity = 1169/1169 (100.00%), Postives = 1169/1169 (100.00%), Query Frame = 1
Query: 7390 MILISNCLACNQTPDEFSVFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYXXXXXXXXXXXXXXXVKQILEHVKRSGNQTEEFIKSLSQLLFAISPDFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMAXXXXXXXXXXXCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFXXXXXXXXXXXXGNLFLLPTSKMTSKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLXXXXXXXXXXXXXXXXIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQXXXXXXXXXXXXIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNSQYISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGRLTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESGHLQVLQSNRLDLSPRQSIYFWL 10896
            MILISNCLACNQTPDEFSVFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYCLLGNSSGSLCLILNVKQILEHVKRSGNQTEEFIKSLSQLLFAISPDFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMASSWHLSTSSLSCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFINEIHKKKENIIGNLFLLPTSKMTSKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLGSFLVSVGSGQGVVKSIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQSSKKFNFSSSGNIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNSQYISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGRLTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESGHLQVLQSNRLDLSPRQSIYFWL
Sbjct:    1 MILISNCLACNQTPDEFSVFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAVKCVFRFHNFDRVVRYCLLGNSSGSLCLILNVKQILEHVKRSGNQTEEFIKSLSQLLFAISPDFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQNTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSWKILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKYFNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYENPIDCQLLKCIEDIQISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDFGFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILSFIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQYPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKADEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFTQKFIQFQDGEFDRPDRMFHTMASSWHLSTSSLSCMKEIIPEFFYLPELFVNSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLNYWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMIENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQMKDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFINEIHKKKENIIGNLFLLPTSKMTSKRPLQMLVIQELSSVLMLPPTEEGSQVFIKFSLATNKRRVQVDSMTYGNPSNNEVQLENLGSFLVSVGSGQGVVKSIAVSQRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEIIFLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQSSKKFNFSSSGNIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNSQYISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGRLTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESGHLQVLQSNRLDLSPRQSIYFWL 1169          
The following BLAST results are available for this feature:
BLAST of Lysosomal trafficking regulator vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LYST2.851e-10630.18lysosomal trafficking regulator [Source:HGNC Symbo... [more]
WDFY35.711e-7938.33WD repeat and FYVE domain containing 3 [Source:HGN... [more]
WDFY35.589e-7437.62WD repeat and FYVE domain containing 3 [Source:HGN... [more]
NBEA4.464e-6939.20neurobeachin [Source:HGNC Symbol;Acc:HGNC:7648][more]
NBEAL15.098e-6840.25neurobeachin like 1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Lysosomal trafficking regulator vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sel-23.887e-7334.63Putative neurobeachin homolog [Source:UniProtKB/S... [more]
wdfy-38.017e-7238.27WD40 and FYVE domain protein [Source:UniProtKB/Tr... [more]
wdfy-38.499e-7238.27WD40 and FYVE domain protein [Source:UniProtKB/Tr... [more]
wdfy-38.506e-7238.27WD40 and FYVE domain protein [Source:UniProtKB/Tr... [more]
wdfy-38.574e-7238.27WD40 and FYVE domain protein [Source:UniProtKB/Tr... [more]
back to top
BLAST of Lysosomal trafficking regulator vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mv7.825e-8133.46gene:FBgn0265988 transcript:FBtr0304060[more]
CG433671.115e-7132.79gene:FBgn0263110 transcript:FBtr0307309[more]
CG433671.335e-7132.79gene:FBgn0263110 transcript:FBtr0307310[more]
CG433671.385e-7132.79gene:FBgn0263110 transcript:FBtr0307312[more]
CG433671.385e-7132.79gene:FBgn0263110 transcript:FBtr0307311[more]
back to top
BLAST of Lysosomal trafficking regulator vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lyst7.456e-10431.74lysosomal trafficking regulator [Source:ZFIN;Acc:Z... [more]
lyst3.309e-10331.62lysosomal trafficking regulator [Source:ZFIN;Acc:Z... [more]
wdfy44.426e-7537.70WDFY family member 4 [Source:ZFIN;Acc:ZDB-GENE-090... [more]
wdfy35.033e-7238.60WD repeat and FYVE domain containing 3 [Source:ZFI... [more]
nbeal13.739e-6933.58neurobeachin-like 1 [Source:ZFIN;Acc:ZDB-GENE-1305... [more]
back to top
BLAST of Lysosomal trafficking regulator vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LYST1.253e-9530.86lysosomal trafficking regulator [Source:NCBI gene;... [more]
LYST1.326e-9530.86lysosomal trafficking regulator [Source:NCBI gene;... [more]
LYST1.362e-9530.86lysosomal trafficking regulator [Source:NCBI gene;... [more]
LYST1.455e-9530.86lysosomal trafficking regulator [Source:NCBI gene;... [more]
LYST1.501e-9530.86lysosomal trafficking regulator [Source:NCBI gene;... [more]
back to top
BLAST of Lysosomal trafficking regulator vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lyst2.020e-10431.93lysosomal trafficking regulator [Source:MGI Symbol... [more]
Wdfy31.074e-7337.38WD repeat and FYVE domain containing 3 [Source:MGI... [more]
Wdfy31.133e-7337.38WD repeat and FYVE domain containing 3 [Source:MGI... [more]
Wdfy31.199e-7337.38WD repeat and FYVE domain containing 3 [Source:MGI... [more]
Wdfy48.007e-7130.97WD repeat and FYVE domain containing 4 [Source:MGI... [more]
back to top
BLAST of Lysosomal trafficking regulator vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99698|LYST_HUMAN1.369e-10530.18Lysosomal-trafficking regulator OS=Homo sapiens OX... [more]
sp|Q9TTK4|LYST_BOVIN6.475e-10530.18Lysosomal-trafficking regulator OS=Bos taurus OX=9... [more]
sp|P97412|LYST_MOUSE1.474e-10331.93Lysosomal-trafficking regulator OS=Mus musculus OX... [more]
sp|Q86JF2|LVSB_DICDI2.152e-7542.15BEACH domain-containing protein lvsB OS=Dictyostel... [more]
sp|Q55DM1|LVSA_DICDI7.625e-7536.88BEACH domain-containing protein lvsA OS=Dictyostel... [more]
back to top
BLAST of Lysosomal trafficking regulator vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2H9X97.047e-12330.52Lysosomal-trafficking regulator OS=Liparis tanakae... [more]
A0A3B3U6146.847e-12028.71Lysosomal trafficking regulator OS=Poecilia latipi... [more]
A0A3B4ZMN37.035e-12029.01Lysosomal trafficking regulator OS=Stegastes parti... [more]
A0A087YNC91.279e-11928.77Lysosomal trafficking regulator OS=Poecilia formos... [more]
A0A3Q4HV963.789e-11929.45Lysosomal trafficking regulator OS=Neolamprologus ... [more]
back to top
BLAST of Lysosomal trafficking regulator vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lyst2.263e-11430.38lysosomal trafficking regulator [Source:ZFIN;Acc:Z... [more]
wdfy31.390e-7238.60WD repeat and FYVE domain containing 3 [Source:NCB... [more]
nbeal12.577e-7031.47neurobeachin-like 1 [Source:ZFIN;Acc:ZDB-GENE-1305... [more]
nbeal21.019e-6637.47neurobeachin-like 2 [Source:NCBI gene;Acc:10033083... [more]
lrba2.257e-6336.87LPS-responsive vesicle trafficking, beach and anch... [more]
back to top
BLAST of Lysosomal trafficking regulator vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000320.11.452e-7437.82pep scaffold:Pmarinus_7.0:GL481331:460:21348:1 gen... [more]
ENSPMAT00000000322.12.576e-7141.94pep scaffold:Pmarinus_7.0:GL481331:12961:21303:1 g... [more]
ENSPMAT00000007035.11.212e-6737.56pep scaffold:Pmarinus_7.0:GL477366:176480:246408:1... [more]
ENSPMAT00000000006.11.572e-5735.34pep scaffold:Pmarinus_7.0:GL476426:99633:131478:1 ... [more]
ENSPMAT00000003512.12.153e-3829.70pep scaffold:Pmarinus_7.0:GL476505:6657:94563:1 ge... [more]
back to top
BLAST of Lysosomal trafficking regulator vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BPH12.615e-6534.31Protein homologous to Chediak-Higashi syndrome and... [more]
back to top
BLAST of Lysosomal trafficking regulator vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO339519.045e-7231.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459981.859e-6235.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303793.627e-5941.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467428.611e-4352.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295461.452e-3248.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysosomal trafficking regulator vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lyst1.196e-10532.29lysosomal trafficking regulator [Source:NCBI gene;... [more]
wdfy33.943e-7336.67WD repeat and FYVE domain containing 3 [Source:NCB... [more]
nbeal23.258e-6532.77neurobeachin like 2 [Source:NCBI gene;Acc:10116327... [more]
lrba6.991e-6336.60LPS responsive beige-like anchor protein [Source:N... [more]
nsmaf2.092e-5736.53neutral sphingomyelinase activation associated fac... [more]
back to top
BLAST of Lysosomal trafficking regulator vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069981.10.000e+0100.00SMESG000069981.1[more]
SMESG000069981.10.000e+0100.00SMESG000069981.1[more]
SMESG000069981.10.000e+0100.00SMESG000069981.1[more]
SMESG000069985.10.000e+099.07SMESG000069985.1[more]
SMESG000069985.10.000e+0100.00SMESG000069985.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007567 ID=SMED30007567|Name=Lysosomal trafficking regulator|organism=Schmidtea mediterranea sexual|type=transcript|length=10951bp
TTAAAATATTGAAATGAGGAGTAATATCAAATATAGGATGGCCGTTTTGG
GATTTTACATATAAATTCTCTGTTTGACTGCTTCTAGCAGAGAAACAAAG
ATTTAATCAACAAAGATCAAATGCCCAGAGGAATATTATGTGAAAACACC
AACAAGCTGGGGTTATGAAAAAGTAGTATTCTGAATTGTAAAACAATGAT
GGAACCGCTCCTAAACCCACTATTCTCCAGCAACAAAGAAAATACCCGCC
CTTGTTTGATCAATTGGAAGAAATCGGAAAACTTACTAATATTTTTAAGA
TCTCTTTATATAAAATCCAGTAAACAAAGAAACCAAACTCGTTCAGTTTT
TATTACTAGTGATATATCTGGAATAGCAATTATGTTAACGAAGCAATTTC
TAACAGACCTCGAAAATCTTTATATGTTAAAAATGGATTCCGACGAAAAA
GGAAACGAACTAGACAGATTAAAAGCTTATTTAGAAACCGAATATGGAGC
ACTGATGTTGTACGGAATAGAATTCATTATTGAACAAATTTTAATCGCCA
AGCGAAACAATACTGATTCCATGAAATCATCGGTTTTGAAAATCATAATT
GAATCTGAACTCGGAAATATTCTTGCCACGACTTTGTTGTCGATTCTCAC
TGATATGTGTTTGAATACAAACCAACTGATTGATAAGAACTTTTTAGATT
CAATAACCGTTCCTGAGTTTACTTTCTCTCAATATTTACGTCAAGATTTC
GTGCGATCGAGTCTTTTTAAAACCAACATAAAACAGATTAGGAGACCGAG
GCCGTCGGAGGAATTGTCTACCGACGACAATGAATTTTTCCCAACTGTGA
AAATCCGTACTAAACGACGACCTATGAAATTTTCTAAGTATTTTGCTCGA
TCAGACGGAACAATGAATCCTTTCCCGTTTATTGTGGAAAATCAGTCCGT
TTCTGAAATTGGGGAGCTGTGCCAATCGGACATGGATGAGAGATTGTATA
TGAATCCAATTAGCCATACTATTGAAACAAGCAATAAGGTCCATATTCTA
ACGAGCCTCAGAACAGCTGCCAGATTATTGTATCAGATCATTCAGTTGGA
CCCATCGATGCATTCAGATGCCATTTCAATCTACTTGGAAGTTCTCAAAA
GTTGTTGTCGACTTCTCAACAATGTACATTCCGATTTCGTCTCATTCCAG
CAGCAGTTATTGAAATTAGCCGACGATCTCCTTTGCAATATCGCTCTCAC
GGTCAGCATTCTCGTCTCCGAGAAATCATCATCGAATTCTATAATGACAA
TAATTCTCGGCCACAAAGTCACTGATAGACTCCTCGAAATCCATCAGTTG
TTCCATGAAATTCATCAAGATTTCATGGTTTTGCACGACATTAACAAACT
GGTTTTCTATATTTTTATAATCGTCACTAAAAACATTCTCGAAAACTATT
CCGGTTCGTGTCGAGGCATCATTCATTTGCTCACGGGTTGGTATGCTACA
GGAGGCAGTCAAATCGCCCAGATCTCACTCAACTCAGAAACCTCCAATGA
AGACTTTTATTTCACTTTGAAGAATTCAAAAATCTCTTTGTTTTCAGAAA
TCTGCGTCCTTCTATCTCTACTGAAAGACATTCCCAATGAAAAACGGTTG
AATCAGATTCCGAAGAATTCCACCGAGGTCTTTTCTCACCATAGTGACCA
ATTCAACTATATCGTAACTGCTGAGAACACCGACTCATTCAAAGACGTTT
GCTGCTACGGCTCGATTTGCTATTTGATACTGGATAACCTCGTTTTCCTC
CTCAATCAAGACTCCCAATTAAAATTCATCTCGTCAAGAAAAAAGCACAT
TTACAATCATATTTTAGCGTCGATTAAAACCATTCGCTTCTGTTGCACAG
TCGACTTAATGGAGTTCTCCAACAAACTGGTCAGGCGTCTCATTAACCCA
ATGCCCGCTGCCATTAAAACAATCGTCATTTCTTTCCTCCAGAGAATAAT
TGAGATTTCTTTCGAGTTCTACAAGTTGCGCTTTTCGTGCGACTGCCAGT
TTTCATCACGGCACGATGTCGTCGGCATTCTGCAAATGATACGAAATGTT
TGCATTCCAAAATCCAAGGAACCGATTTGTCCTTTGTCTTGTTACAATGC
GACCTTTGTTGAGTTGTTGCATTTTATTGACTGGTTGGGCAATATTCAGG
ATGATAAAATGAAGGCTTTGGTGAAAGAGAACGTTATTCAACCGATTTTC
AAACGGACCAATCAATATGCATCGAATTTGCACAGTTCGTATTGCGGGAT
GATTGGCTCCTCTATGTTCTCTCTGTTACCCTATATGAATTATTCTTGGG
AAAATGACGACCTAAATTTGCTTTGGTCTGCTTGCGAAAAGTTTCCAAAA
CTCAAGAGGAATTATTATAAATGTCTAACGATAACATTATTGTCGACCCG
ATCATCGCCTGTCGAGGATTCCAAGGAACTGTCAATGAAGACCAGAATTA
TCGACTTTCTCGTGTCAAGGGTCAATTTTGAGATCCTCATGAAACAAATG
GACCATAATTCCGGCTCCATCAAGTTGCTCTTTGAAGATATCTACATTTG
GGAGTGTTTTAGAATTTTGTTCACGTACAATGACGAATTCCGACGCTCGA
TGTTCACTAGTAATGGAATCGACTGCTGCTATGTGATGCTGAAGGAAATC
ATTGAATTCATTTCTATCTTGACTGATGAAAACTTGGAAACATATAAACT
ATCAGGCTTTTTGTTGTTTGAATCGCTTATGTGTCTCGTTATAGATGGTA
ACATGCTGAAAAACATTTATTATTACGAGGGTTACTCATACGAAATAATA
TGGGTTCAGATTCAATCGAGTATTTTGAAATATTTTCCAAAAGAAGAATC
AGTAGCACAAAGTTTGATCCAGTCTTTGTTGAACTGCTGCTTTAGACATA
AATGGACCGTACAGAATGATCTGTATCAATTGCGTAGATTATTTCTCGAT
TCGATCGTCAGCAAGAACATCTCAATCACTAATCAAGGCAGTGAAATAGA
TATTAGTGATGTCGGCATAGAATCAAGCTTTTCCGAACCCGAAGACGATA
TTGGGGGTGACGAGGATGACAGTGATATCGTAAACGGTTCGCACAAATAC
GACGCTGATGTAAGCTCCGATCTCGTGAATGATGATGAATCTGAATTGCG
AGCCCGAAAGAAACATAACTTGCGAGATACAGAAGGTGAAAGAGCGAATG
TCTTTATCGATATAAATACGGCATATACAAACGGAAGTAACATGGAAATT
AACACGGATTTCCTGAGATTATTCATCAAAATAATTTTGAGCCTACCCAT
CGACAATTATCATTTTATTGGCCAGAAGGCTCTGGAATCTGTTTATTATT
CTTTGAGATATATTCCTGACAAAAATCAGCAATCTTTTATTTGTGATGAT
TTTATGGAGAAAATGATGTGTTCAATTGAAAATATCCTCAATTCTCATGA
CATTCCAGGTCTTCAATTAATTCTTTTGAAATTGTTGACATTACCTTTCT
CGTGTTGGTGTACAGCTAAAAGACTCAGATTTCTTATTAATTTGTCCGAA
AAGAATCCTGGGTTAAAGGTGCAAATAATAAAAATGCTAATCGAAAAAGC
AGAACTTATAAATTCTCTTCAACCGGACTTGTCGTTGATGGTTCCTGTCC
ATCAAAACATTCCTAAATCTGTTAGGGGATGGAGGAACTCGAACTTTGAA
TTTTATTCTTTTGATGAGGAAATCGGTGACGTGTCGAATTATCTTTTTGA
AACCAAATTAAACAGACCAAATTGGAAGGGTTTGGATTTTGACAATTCTT
GTGAGAATTCTGGATTTAGTGTGTCAATGTGGATTCAAATGGATAGCACG
GTTGAGTATAAAAGAAGGAAAAAATCCGGAGAGATGAAAAAAAATAAAAA
AAAGTCTAATAAGCTCTCTGCCAATGCAAATTCTCTTTCCAAACTTCTTT
TGTTGCAATCGATCCAAGATTTTATTCACGTAGCCTCCATTTATTCGAAA
GATAAAAATTCCAGTTTCAAATCTCAATGTTTTCAGATATGGTGCAAACC
CTCCACTGGAACGATTATGATTCGCTTCTATCAACGAATTTATCAAACTG
TCAACTTGGATCCCAACAAACCTGCAACTCCTCTGCCACAAATGCGAGAA
TCCAGATCTCAAATATTCAACATATTCCAATCTCAAACAGTCAGTAGATG
GGATTCAAATGATTCTAGCTCACTTCTCGATACAAACTCAAGAAATTCTT
CGTTTGTTTTGGTTGGAGAATCTATGTTGAATAACGTTTTGCCTCTAAAC
GCTTGGAATTTTGTCACAGTTAGTGTCAATTGGAAAAGTCCTGAAGTTGG
AGAGGTATTCTGTGTTATTAATGGAGACTTTTCCTATGAGAGCAAATTGA
TTCGGAATAGTCACTATGTTTATCAAGGTTCACAAAGTCTTGAATCTTTT
TTCAATATCGGGCAATTAGGATGTCCTCCTGGAGGCTCAAGTCATCTTAA
ATATAATTTGGGGAGCTTATTTATCTTCGAAGGTGCCAAAATTCAAACAG
CTAATGAAAATCTGTCCCTTATGTTTTTGTCTCCTAATTGGGATGGGGGC
TCAATGATGTTGAACGCGGCTCAACGTGACTCCGCAAATACTCTTGGATT
AGTTATTATGCGAATCCTGGCAGATAGACAAGTTGGTTCAGAATTTGTAG
CGTCTATGCTGGAAAGATGTCAAAATATTTTACAGAACAATTGGCTGGAA
AAGATGAATGAATTAATCACAAACAACCTTGTTGCTACCTTTACGTGTGG
AGATATCCCAAGATTCGACGTTAATGAAATGTGCTCAGCTGACAGTGAAA
TGCCGACCCTGTCTCCGAATTACTATCAATTTTCGTCAATAGTTTCTCCC
AAATCCGAAACTGAAGTTCCCGTTGCATTTTCTAGTAATTGTTTCAGTAA
ATATTTCATTATAAAAGCTTCCGTCGATTCTGCGATTGAGAATTTAGGAG
GTATCTCGATTATGATATTCTGGTTGGCAAAGGTTGTAGAGTCCGGCGAT
GAAGTCTCCACCCGGTATCTGTTAAAATTAATCCTTCTTCTAATAAGGAA
ATCTGTGTTTCTTGCCCATCAGAACATCGAAGAAAAAGGCTATTCTGTTT
TGTTGCAGTTATTCAAATCGTTTAAAATGACCCTCGGCTTTGACATTATT
TCCGATTTAGTACAGCATATGATTTACGAAGATCCAACGAAATCAAAATT
ATCACTTCCATGCAATTCAAGACTTTGTAGAGATCCTCAAATTCTCCATG
AATTATTGATGCACTGGAAAATTTTAGCGACCAGCAAACTGAATGCTAGC
AAAGGGGAGATATCAATGACAGAATGTCAGGCTCTGAATTTAGATAAATA
TCTTTTGGAACAAATCAACAGCCTTCTTAATGAAGACAATATTTACTCTA
TTATTAATTGTGGATCCCTTGGAACAGTAGGATTGCTGTCTCCTTTACTG
ATGTCATGTCAGGAACCATTTGAAGCTCTTGAACACCCTTTACCCGTGGG
AATCTGTAAGATACTAATACAAATCATCAACAATCTCATTCCAACCCCTG
TCGATATAAGTATTGTCACGAAACTCTGCAACACAATACTGCAATTGCAT
CCAATATCCATGAAAGACAATGATATCGACAGCGGCCAATACTACAGACA
TTTAAAAGCATTTACCAAAATGGAGGTAGAAAAATCAACTGATGATCACA
ATGAAATAGATGGAACATTCCCGGAGAAAGCCCGCGTTTGCAAAATTAAT
ATTCAACGAGGAAACCATTTGAAATTGAATCCTGAGCGTGATATTACCGA
ACAATTGTCTATATCCCTAATGGGCTCTAAAGTGAGTGAAGTAGAAAAGA
AGACCTTGCAACAGTTTTATGTGGCAACTCTCACGGACAACCGGCAAGAT
TCCAATGAAAACAATGAATTCTTGGACATTGAATCTTCGATGGAATCCTC
CAGTTCCGAACCAAGCAGCTGTCCAACATTAATTGATGAAAATGATAAAA
ACGAGATGAACTCGTCTTTCGAAACTTCATTTATTGCATCTAATAATTTA
ACCGATCAACCCGTAATCAGTGGTCAGTCTGAATCATCAAGGGTCCATGT
GATCGCCGGTCTGATTTCAATATTGGAAAATGTGATTGAAGTCAAAGTCA
GTGACAGCATTCTGGAGCGATGTTCGAATTATGACTTCTTTTTCGAATTC
ATTCTTCATTTATTATCTCACACAAGTGCCTTGGTTCGACAGAAGAGTTT
ATCATTATTTCGTGTTTATCTTTACCGTAAGAAGTCTCAACTTCAGCAAA
ACCAAAATCAATGGTTGTCCATAAATTTAGTCTCACATGTCATTCATCAA
AACTCAACAACGAAAGAAATACTGGCTGAGGCAATCTCTATTATGTTCGG
ACAAAATTTATTCAGCATAATCATGGACATTGACTGGGAAAATTTTTCGA
TTTTCAACTCTAGCTCCAATAGTAGCAAATCAGCAGAACACAATAGTATG
AATTTGGAACTGAAATCAATTTGTAAACTCCAAGGAATAGTATCAAATCA
ATCAGATAATATTCAGAGTTTCGCGAAATCTCTTGACGAAACAATGAATT
CTAGTAATCATTTCGGTTTACAATATCAAAAAAGCGCCATTTTACTGCTG
TCTATACTGAGTAACATAGACAACGATTCAATGCTTTGGGCTTTCAAAAT
TTGCGGATGGCTCTTTGTGAACCATTCAACATTACTTCAATCTTGCCTAA
AATCTGGATTCCTAGAATTTATGTGCAACTGTCCCATCATATTTTACAAA
GCTTCCTTTACAAAACAAGACCCAAGATTCACAGCCTTCTTGGATCTATG
CGCCATAACATCTGCAAGCATAATTGTATCAAACAAAATCCAAGAATTCA
GTCGACTGCTGGAGATGTGTGAAATTCTGCACGTGTCAGCATTGAAATTA
TCAAAGCAATTAACAAAAACAGGAACCATTAATCATGGCACCGGAACTCT
GGCCCATTACGCACTGGAGAAAATATTAATGACAATAATCGAAAGCATTT
GTATTATTAATTCAAACGACCCGGCATTCAATATCCCGATCACCAGCAGT
TGTATTCAGAAATTTCTATTCAAATACAGGCTGCTTACGAATCAATATGG
ATTTCAGAAGAATTTGAATGAACAGCTTTCAGAAACAATTAAATCCACAA
TTGGGATAGTAATCAACACAGAAAAATGTTTTACGTCATATTATGTTGAT
ACTTGTGAAATAGTTGGTTTAAGCATATTATTCTATTCAATGATTTTGAT
TAGCAACTGTTTGGCTTGCAATCAAACGCCCGATGAGTTTTCTGTCTTCC
TGGGATGCAAGGAGGCAATCAAAAGCCATCTTGGAGATTTGTTGATTTGT
CTCACTCAGTCAAAATTAAGCCTCCATTTAAGATTGGAAGCCGTGAAATG
TGTTTTTCGGTTTCACAATTTTGACAGAGTAGTTCGATATTGTCTTTTAG
GAAACTCTTCGGGCTCGTTGTGTCTGATTCTCAATGTCAAGCAGATTCTC
GAGCATGTTAAACGATCCGGAAACCAGACCGAAGAGTTTATTAAAAGTCT
TTCTCAGTTGTTGTTTGCTATCAGTCCAGATTTCTCTGTTGAAGATCTAA
ATGAGGACAACAGAAATCTTTGGGTTAAGGAAAATGAATTTAAACTAAAC
GCCTATAAAAAAAAATTCAAAAGTAAATTGGACAATTGGAATCAAAACAC
AGATAGGAGATTTAATGAGGTGTCGATCCAGATGAAAAATTCTTACAATA
ATTATCGGACTTATGCGAGAAAGAATTTACAGCACGAGTTTATATCCAAT
ATCAAAGCTCAAAGAGCATCAGAATTCTATAGAAGATTATCTTGGAAAAT
CTTAATTGCCACATTTACCCAAGAGAAAGAAATCTGGGATGATTCAAATA
AGAAGTCACAAATCTATAGACTTGATCCGATTGAAGGTCCTTCCAGAATC
AGACGAAGAATGATAAAGACTACTCACAAAATTAACGATAAATACTTCAA
TCCAACATCACCAGCAAGAAATGTTCAAGACAAAAGCTCAAGCGGGGAAA
GTCTGACATTTCTGTTTGAATCTACATATCAAGTCGACAAAATTGTATAT
GAGAACCCAATCGACTGTCAACTGTTAAAATGCATTGAAGATATCCAGAT
CTCTTGCCCATGTATCTTGGTCTGTGAATCTGGCCACTTTAAGGGAGAAT
TTTTCGTCGGAAAGTGGAGAATAGGATTTTTAGAAGACCGAGTTAATAAT
CTGTACAGCGAATACGATGAGTTACCCAACTATTTGAAGGATTTCGGTTT
CATAAATTGGCACTTAAATGATATAGAATGGGTGCTGAGGAGGCGCTTCA
AATTGCGAGATTACGCATTGGAAATGATTATGAAAGATGGCAGAAATTGT
CTCATTGCAATGAATTCGACCCTGGAAAGAGATCGAATCCTTAGTTTCAT
AGAAAATATTCTCCCCCCAAATGCTAATCGAAAGCCTCGTCTTATTGACA
TACAGCGCGAATGGGCCGAAGGGAAAATGAGCAATTTTGATTATCTCACA
TTTCTCAACACGGCTGCTGGACGAAGCTACAATGATATCATGCAATATCC
GGTTTTCCCTTTTATTTTGACAGAATATACAAGTTCAACTCTTGATCTCA
CAAAGGAATCAACATATAGAGATCTCAGCAAACCAATAAGCATTCAAAAC
GGACCTTTGCGAGAAAAGGTTATCAACTGCTTTACAGAGAAGGCGGACGA
GTACCAAAGACAATTACGGATGATGCAGACAAGCAATAATATAGATGAAA
TGTCAGTATGGGCAGTGCCGCCTTATCATTATTCTTCCCTTTATTCCAAC
AGTGCCACAGTATTGTACTACATGATTCGAATTCCTCCATTTACTCAAAA
ATTCATCCAATTTCAAGACGGGGAATTCGACAGACCAGATAGAATGTTTC
ACACGATGGCATCTTCTTGGCATTTGTCGACTTCTTCTTTATCCTGCATG
AAAGAAATCATTCCAGAATTCTTTTACCTGCCGGAATTATTTGTCAATAG
CCAGGATTTCAATTTCGGAGAAAGACTCAACGGAACGAAGGTGGATGATG
TGATTTTGCCAGAATGGTCCTCTGGAGACGCAAGACTTTTCTGCTTGATT
CATCGAGCATCATTAGAAAGTCCATACGTTTCCAACCAATTAAATTATTG
GGTCGACTTGGTATTCGGCTTTAAACAAACTGGGAAAGCCGCATTGGAAG
CGATTAACCTTTTCCATCCCTATACATACTACAAAGCCATTTGTCCTGAC
GAAATAACCGAAGAAATCCGCAGATCTGCCGTTGAGCAAATGATTGAAAA
TTACGGGCAAATCCCAAAGCAGCTTTTTATCAACAAATCCTTCCCAGCAA
AAAAGATAAATTGGAGAAATATCAAAAATACGGCTCCACGAAATATTCAA
CATTCCTTCTCCTCAGACAAGGGATACCAGGATACGGATCAAATGAAGGA
TTCAATTGAGAGTAATTGTGAATCCATCAAGACTCTTTCAAAGGATAGAA
AATGTTTAACTGTATTAAACAGTGTTATCGGCATAGAATGGGGGGACTGG
GTCGGAAGTCCGAATAATTCCCAAACGTTTATCAATGAAATCCATAAAAA
GAAAGAAAACATCATCGGAAATTTATTTCTGTTGCCCACATCTAAGATGA
CAAGTAAAAGACCCTTGCAAATGCTTGTAATCCAAGAATTATCCAGTGTC
CTTATGTTACCACCAACTGAAGAGGGTAGCCAAGTTTTTATTAAATTTTC
TTTAGCCACGAATAAACGACGAGTTCAAGTAGATTCCATGACTTATGGAA
ACCCTTCTAACAATGAAGTTCAATTAGAAAATTTGGGAAGTTTCCTGGTA
TCAGTAGGATCCGGCCAAGGAGTCGTTAAAAGCATTGCTGTTTCTCAAAG
ATCAGGTCGAGTGTTTTTTGGAATGGAATCTGGTCTTATTACGGTTTATC
AAGGAGACATGTTCAAATATTCACAAACTCGATCGTTTGTGGATAATCTG
AATCACCATAGAAAAACCTTATTGGGACACAAAACTGAAATTATCTTTCT
TCAGCTGTGCGACTCATTCGCTGTCCTTGCCTCTTGTGATATTCAAACAA
ATGTCGCCATTTGGGATTCCCAAACATTGGAACTCCTCCATTACATTGAC
TGGCAGTCAGTGAAGTATATTCAATCGTCGAAAAAATTTAACTTTTCGTC
AAGTGGCAATATAGCCGAATTACTACACAATGAAATTTCTCAAATACAAT
CAGAATCTATGACTAAGGTATCCGCTATGTCTTTCAGTGAGACTCTTGGA
GATATGGTGATTTCACGATTGATGAAACAGAAAACCGTAAACTCTCAATA
TATATCCAATGTCAGCCTCTTCACCATTAACGGAAAACATGTCGATTCTA
TAATGTTATCTGGAACTGTCGTATCGCTCAGTTATACAAAACTTACTGAA
GGATGCAATGTCAATGCCATTGCTGCTATTACCGACGAAGGGCGCTTAAC
AGTAATGAGTAGCTGGAATCTGCAAGTCGTTTGGAAAGTAAAAATCCCGC
AACTTTACCAATCAGATCCTATCAAAGCTATCCAATATACGCATTCTGGA
CGCGAGCTCTACGTCCTTAATGAATCCGGCCACCTACAGGTCTTACAGTC
CAACAGGCTAGATTTATCACCTAGACAGTCTATTTATTTTTGGTTATAAT
TATTCTTTTCTAAATGTTTTTCACTGATCAATTTTGTACGAAAGATCGGA
A
back to top

protein sequence of SMED30007567-orf-1

>SMED30007567-orf-1 ID=SMED30007567-orf-1|Name=SMED30007567-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=3568bp
MMEPLLNPLFSSNKENTRPCLINWKKSENLLIFLRSLYIKSSKQRNQTRS
VFITSDISGIAIMLTKQFLTDLENLYMLKMDSDEKGNELDRLKAYLETEY
GALMLYGIEFIIEQILIAKRNNTDSMKSSVLKIIIESELGNILATTLLSI
LTDMCLNTNQLIDKNFLDSITVPEFTFSQYLRQDFVRSSLFKTNIKQIRR
PRPSEELSTDDNEFFPTVKIRTKRRPMKFSKYFARSDGTMNPFPFIVENQ
SVSEIGELCQSDMDERLYMNPISHTIETSNKVHILTSLRTAARLLYQIIQ
LDPSMHSDAISIYLEVLKSCCRLLNNVHSDFVSFQQQLLKLADDLLCNIA
LTVSILVSEKSSSNSIMTIILGHKVTDRLLEIHQLFHEIHQDFMVLHDIN
KLVFYIFIIVTKNILENYSGSCRGIIHLLTGWYATGGSQIAQISLNSETS
NEDFYFTLKNSKISLFSEICVLLSLLKDIPNEKRLNQIPKNSTEVFSHHS
DQFNYIVTAENTDSFKDVCCYGSICYLILDNLVFLLNQDSQLKFISSRKK
HIYNHILASIKTIRFCCTVDLMEFSNKLVRRLINPMPAAIKTIVISFLQR
IIEISFEFYKLRFSCDCQFSSRHDVVGILQMIRNVCIPKSKEPICPLSCY
NATFVELLHFIDWLGNIQDDKMKALVKENVIQPIFKRTNQYASNLHSSYC
GMIGSSMFSLLPYMNYSWENDDLNLLWSACEKFPKLKRNYYKCLTITLLS
TRSSPVEDSKELSMKTRIIDFLVSRVNFEILMKQMDHNSGSIKLLFEDIY
IWECFRILFTYNDEFRRSMFTSNGIDCCYVMLKEIIEFISILTDENLETY
KLSGFLLFESLMCLVIDGNMLKNIYYYEGYSYEIIWVQIQSSILKYFPKE
ESVAQSLIQSLLNCCFRHKWTVQNDLYQLRRLFLDSIVSKNISITNQGSE
IDISDVGIESSFSEPEDDIGGDEDDSDIVNGSHKYDADVSSDLVNDDESE
LRARKKHNLRDTEGERANVFIDINTAYTNGSNMEINTDFLRLFIKIILSL
PIDNYHFIGQKALESVYYSLRYIPDKNQQSFICDDFMEKMMCSIENILNS
HDIPGLQLILLKLLTLPFSCWCTAKRLRFLINLSEKNPGLKVQIIKMLIE
KAELINSLQPDLSLMVPVHQNIPKSVRGWRNSNFEFYSFDEEIGDVSNYL
FETKLNRPNWKGLDFDNSCENSGFSVSMWIQMDSTVEYKRRKKSGEMKKN
KKKSNKLSANANSLSKLLLLQSIQDFIHVASIYSKDKNSSFKSQCFQIWC
KPSTGTIMIRFYQRIYQTVNLDPNKPATPLPQMRESRSQIFNIFQSQTVS
RWDSNDSSSLLDTNSRNSSFVLVGESMLNNVLPLNAWNFVTVSVNWKSPE
VGEVFCVINGDFSYESKLIRNSHYVYQGSQSLESFFNIGQLGCPPGGSSH
LKYNLGSLFIFEGAKIQTANENLSLMFLSPNWDGGSMMLNAAQRDSANTL
GLVIMRILADRQVGSEFVASMLERCQNILQNNWLEKMNELITNNLVATFT
CGDIPRFDVNEMCSADSEMPTLSPNYYQFSSIVSPKSETEVPVAFSSNCF
SKYFIIKASVDSAIENLGGISIMIFWLAKVVESGDEVSTRYLLKLILLLI
RKSVFLAHQNIEEKGYSVLLQLFKSFKMTLGFDIISDLVQHMIYEDPTKS
KLSLPCNSRLCRDPQILHELLMHWKILATSKLNASKGEISMTECQALNLD
KYLLEQINSLLNEDNIYSIINCGSLGTVGLLSPLLMSCQEPFEALEHPLP
VGICKILIQIINNLIPTPVDISIVTKLCNTILQLHPISMKDNDIDSGQYY
RHLKAFTKMEVEKSTDDHNEIDGTFPEKARVCKINIQRGNHLKLNPERDI
TEQLSISLMGSKVSEVEKKTLQQFYVATLTDNRQDSNENNEFLDIESSME
SSSSEPSSCPTLIDENDKNEMNSSFETSFIASNNLTDQPVISGQSESSRV
HVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQK
SLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIM
FGQNLFSIIMDIDWENFSIFNSSSNSSKSAEHNSMNLELKSICKLQGIVS
NQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAF
KICGWLFVNHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLD
LCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTINHGTG
TLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKFLFKYRLLTNQ
YGFQKNLNEQLSETIKSTIGIVINTEKCFTSYYVDTCEIVGLSILFYSMI
LISNCLACNQTPDEFSVFLGCKEAIKSHLGDLLICLTQSKLSLHLRLEAV
KCVFRFHNFDRVVRYCLLGNSSGSLCLILNVKQILEHVKRSGNQTEEFIK
SLSQLLFAISPDFSVEDLNEDNRNLWVKENEFKLNAYKKKFKSKLDNWNQ
NTDRRFNEVSIQMKNSYNNYRTYARKNLQHEFISNIKAQRASEFYRRLSW
KILIATFTQEKEIWDDSNKKSQIYRLDPIEGPSRIRRRMIKTTHKINDKY
FNPTSPARNVQDKSSSGESLTFLFESTYQVDKIVYENPIDCQLLKCIEDI
QISCPCILVCESGHFKGEFFVGKWRIGFLEDRVNNLYSEYDELPNYLKDF
GFINWHLNDIEWVLRRRFKLRDYALEMIMKDGRNCLIAMNSTLERDRILS
FIENILPPNANRKPRLIDIQREWAEGKMSNFDYLTFLNTAAGRSYNDIMQ
YPVFPFILTEYTSSTLDLTKESTYRDLSKPISIQNGPLREKVINCFTEKA
DEYQRQLRMMQTSNNIDEMSVWAVPPYHYSSLYSNSATVLYYMIRIPPFT
QKFIQFQDGEFDRPDRMFHTMASSWHLSTSSLSCMKEIIPEFFYLPELFV
NSQDFNFGERLNGTKVDDVILPEWSSGDARLFCLIHRASLESPYVSNQLN
YWVDLVFGFKQTGKAALEAINLFHPYTYYKAICPDEITEEIRRSAVEQMI
ENYGQIPKQLFINKSFPAKKINWRNIKNTAPRNIQHSFSSDKGYQDTDQM
KDSIESNCESIKTLSKDRKCLTVLNSVIGIEWGDWVGSPNNSQTFINEIH
KKKENIIGNLFLLPTSKMTSKRPLQMLVIQELSSVLMLPPTEEGSQVFIK
FSLATNKRRVQVDSMTYGNPSNNEVQLENLGSFLVSVGSGQGVVKSIAVS
QRSGRVFFGMESGLITVYQGDMFKYSQTRSFVDNLNHHRKTLLGHKTEII
FLQLCDSFAVLASCDIQTNVAIWDSQTLELLHYIDWQSVKYIQSSKKFNF
SSSGNIAELLHNEISQIQSESMTKVSAMSFSETLGDMVISRLMKQKTVNS
QYISNVSLFTINGKHVDSIMLSGTVVSLSYTKLTEGCNVNAIAAITDEGR
LTVMSSWNLQVVWKVKIPQLYQSDPIKAIQYTHSGRELYVLNESGHLQVL
QSNRLDLSPRQSIYFWL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000208testis
PLANA:0000429neoblast
PLANA:0000478pharynx musculature
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
PLANA:0004517blastomere
Vocabulary: INTERPRO
TermDefinition
IPR036372BEACH_dom_sf
IPR030464LYST
IPR036322WD40_repeat_dom_sf
IPR011528NERD
IPR000409BEACH_dom
IPR023362PH-BEACH_dom
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR011993PH-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0002446neutrophil mediated immunity
GO:0002456T cell mediated immunity
GO:0006644phospholipid metabolic process
GO:0006810transport
GO:0007017microtubule-based process
GO:0007040lysosome organization
GO:0007596blood coagulation
GO:0015031protein transport
GO:0030595leukocyte chemotaxis
GO:0032438melanosome organization
GO:0032510endosome to lysosome transport via multivesicular body sorting pathway
GO:0032816positive regulation of natural killer cell activation
GO:0033299secretion of lysosomal enzymes
GO:0033364mast cell secretory granule organization
GO:0042267natural killer cell mediated cytotoxicity
GO:0042493response to drug
GO:0042742defense response to bacterium
GO:0042832defense response to protozoan
GO:0043473pigmentation
GO:0048753pigment granule organization
GO:0051607defense response to virus
GO:0055091phospholipid homeostasis
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0015630microtubule cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000409BEACH domainSMARTSM01026Beach_2coord: 2820..3119
e-value: 7.4E-148
score: 507.2
IPR000409BEACH domainPFAMPF02138Beachcoord: 2822..3114
e-value: 6.3E-101
score: 337.4
IPR000409BEACH domainPROSITEPS50197BEACHcoord: 2808..3119
score: 107.264
IPR000409BEACH domainCDDcd06071Beachcoord: 2823..3111
e-value: 2.35512E-109
score: 348.464
IPR036372BEACH domain superfamilyGENE3DG3DSA:1.10.1540.10coord: 2812..3118
e-value: 4.1E-109
score: 366.4
IPR036372BEACH domain superfamilySUPERFAMILYSSF81837BEACH domaincoord: 2808..3113
IPR023362PH-BEACH domainPFAMPF14844PH_BEACHcoord: 2706..2800
e-value: 7.7E-11
score: 42.0
IPR023362PH-BEACH domainPROSITEPS51783PH_BEACHcoord: 2695..2803
score: 23.294
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 3282..3566
e-value: 5.3E-7
score: 30.9
NoneNo IPR availableGENE3DG3DSA:2.30.29.40coord: 2698..2800
e-value: 3.1E-6
score: 29.0
NoneNo IPR availablePANTHERPTHR13743BEIGE/BEACH-RELATEDcoord: 1877..3551
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 2698..2802
IPR030464Lysosomal-trafficking regulatorPANTHERPTHR13743:SF86LYSOSOMAL-TRAFFICKING REGULATORcoord: 1877..3551
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 3272..3554