Voltage-dependent calcium channel subunit alpha-2/delta-3

Overview
NameVoltage-dependent calcium channel subunit alpha-2/delta-3
Smed IDSMED30007566
Length (bp)3698
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage-dependent calcium channel subunit alpha-2/delta-3 (SMED30007566) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage-dependent calcium channel subunit alpha-2/delta-3 (SMED30007566) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage-dependent calcium channel subunit alpha-2/delta-3 (SMED30007566) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage-dependent calcium channel subunit alpha-2/delta-3 (SMED30007566) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007566

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30007566SMESG000020654.1 dd_Smed_v4_10409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007566SMESG000020654.1 dd_Smed_v4_10409_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30007566SMESG000020654.1 dd_Smed_v4_10409_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007566SMESG000020654.1 dd_Smed_v4_16278_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30007566SMESG000020654.1 dd_Smed_v4_16278_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Human
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:HGNC Symbol;Acc:HGNC:15460])

HSP 1 Score: 194.126 bits (492), Expect = 3.340e-52
Identity = 140/464 (30.17%), Postives = 227/464 (48.92%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVE 1934
              P+   +N+P   + +   +PT++Y           W++ L+++F    D D  L W+YF S+ GF R YPGI+W+  +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ L E FN+L  D N+     I +  +M ITDG++   D         D   RIFT++  + A+   ++  +AC+N+G+  +  TL+DV +NV+ YL V+SR   I Q    +WT  +   I ++ T D                                             + P+ L  + A  V+ +  +T   + G +LG VG D+ V E +KT P +K+G++ Y F IT+NG+++ HP+ R  Y   K   K  Y +VD+SEVE
Sbjct:   60 LAPNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDE------NGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEHFREHLDK-LFAKGIGMLDIALNEAFNIL-SDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAY---IDSTLTDD---------------------------------------------QGPV-LMTTVAMPVFSKQNET--RSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRLLYEEGKKRRKPNYSSVDLSEVE 463          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Human
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:HGNC Symbol;Acc:HGNC:15460])

HSP 1 Score: 194.126 bits (492), Expect = 3.340e-52
Identity = 140/464 (30.17%), Postives = 227/464 (48.92%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVE 1934
              P+   +N+P   + +   +PT++Y           W++ L+++F    D D  L W+YF S+ GF R YPGI+W+  +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ L E FN+L  D N+     I +  +M ITDG++   D         D   RIFT++  + A+   ++  +AC+N+G+  +  TL+DV +NV+ YL V+SR   I Q    +WT  +   I ++ T D                                             + P+ L  + A  V+ +  +T   + G +LG VG D+ V E +KT P +K+G++ Y F IT+NG+++ HP+ R  Y   K   K  Y +VD+SEVE
Sbjct:   60 LAPNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDE------NGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEHFREHLDK-LFAKGIGMLDIALNEAFNIL-SDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAY---IDSTLTDD---------------------------------------------QGPV-LMTTVAMPVFSKQNET--RSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRLLYEEGKKRRKPNYSSVDLSEVE 463          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Human
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:HGNC Symbol;Acc:HGNC:15460])

HSP 1 Score: 201.445 bits (511), Expect = 3.678e-52
Identity = 155/541 (28.65%), Postives = 255/541 (47.13%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAA-AVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
              P+   +N+P   + +   +PT++Y           W++ L+++F    D D  L W+YF S+ GF R YPGI+W+  +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ L E FN+L  D N+     I +  +M ITDG++   D         D   RIFT++  + A+   ++  +AC+N+G+  +  TL+DV +NV+ YL V+SR   I Q    +WT       +A   S  P                                     + Q + +   P+ ++T A  V+ +  +T   + G +LG VG D+ V E +KT P +K+G++ Y F IT+NG+++ HP+ R  Y   K   K  Y +VD+SEVE      +                LR  M+ N    +FS  +   + +D       +  +Y+   I GTP+  G+A+
Sbjct:   60 LAPNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDE------NGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEHFREHLDK-LFAKGIGMLDIALNEAFNIL-SDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWT-------EAYIDSTLP-------------------------------------QAQKLTDDQGPVLMTTVAMPVFSKQNET--RSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRLLYEEGKKRRKPNYSSVDLSEVEWEDRDDV----------------LRNAMV-NRKTGKFSMEVK--KTVDKGKRVLVMTNDYYYTDIKGTPFSLGVAL 526          

HSP 2 Score: 73.9442 bits (180), Expect = 1.591e-12
Identity = 54/213 (25.35%), Postives = 96/213 (45.07%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSS 3464
            Q K +F+Q           SL  K  I  +     CY+I  +G IL +  + T  G    +I  A+M   +    +     YD QA+C    + +     L++P +  +  + W++ +L L +  F+L +  W  S           ++E   PC  + PA+    +   + G+++ C  C+++F I+ I ++NLF+VVV  S     C+C S
Sbjct:  727 QMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSE-DYTQTGDFFGEIEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCS--WWHSDMTAKAQKLKQTLE---PCDTEYPAFVSERTIKETTGNIA-CEDCSKSFVIQQIPSSNLFMVVVDSS-----CLCES 927          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Human
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:HGNC Symbol;Acc:HGNC:15460])

HSP 1 Score: 201.445 bits (511), Expect = 6.786e-52
Identity = 154/541 (28.47%), Postives = 255/541 (47.13%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAA-AVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
              P+   +N+P   + +   +PT++Y           W++ L+++F    D D  L W+YF S+ GF R YPGI+W+  +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ L E FN+L  D N+     I +  +M ITDG++   D         D   RIFT++  + A+   ++  +AC+N+G+  +  TL+DV +NV+ YL V+SR   I Q    +WT       +A   S  P                                     + Q + +   P+ ++T A  V+ +  +T +  +  +LG VG D+ V E +KT P +K+G++ Y F IT+NG+++ HP+ R  Y   K   K  Y +VD+SEVE      +                LR  M+ N    +FS  +   + +D       +  +Y+   I GTP+  G+A+
Sbjct:  154 LAPNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDE------NGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEHFREHLDK-LFAKGIGMLDIALNEAFNIL-SDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWT-------EAYIDSTLP-------------------------------------QAQKLTDDQGPVLMTTVAMPVFSKQNETRSKGI--LLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRLLYEEGKKRRKPNYSSVDLSEVEWEDRDDV----------------LRNAMV-NRKTGKFSMEVK--KTVDKGKRVLVMTNDYYYTDIKGTPFSLGVAL 620          

HSP 2 Score: 73.9442 bits (180), Expect = 1.611e-12
Identity = 54/213 (25.35%), Postives = 96/213 (45.07%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSS 3464
            Q K +F+Q           SL  K  I  +     CY+I  +G IL +  + T  G    +I  A+M   +    +     YD QA+C    + +     L++P +  +  + W++ +L L +  F+L +  W  S           ++E   PC  + PA+    +   + G+++ C  C+++F I+ I ++NLF+VVV  S     C+C S
Sbjct:  821 QMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSE-DYTQTGDFFGEIEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCS--WWHSDMTAKAQKLKQTLE---PCDTEYPAFVSERTIKETTGNIA-CEDCSKSFVIQQIPSSNLFMVVVDSS-----CLCES 1021          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Human
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:HGNC Symbol;Acc:HGNC:15460])

HSP 1 Score: 201.445 bits (511), Expect = 6.786e-52
Identity = 154/541 (28.47%), Postives = 255/541 (47.13%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAA-AVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
              P+   +N+P   + +   +PT++Y           W++ L+++F    D D  L W+YF S+ GF R YPGI+W+  +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ L E FN+L  D N+     I +  +M ITDG++   D         D   RIFT++  + A+   ++  +AC+N+G+  +  TL+DV +NV+ YL V+SR   I Q    +WT       +A   S  P                                     + Q + +   P+ ++T A  V+ +  +T +  +  +LG VG D+ V E +KT P +K+G++ Y F IT+NG+++ HP+ R  Y   K   K  Y +VD+SEVE      +                LR  M+ N    +FS  +   + +D       +  +Y+   I GTP+  G+A+
Sbjct:  154 LAPNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDE------NGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEHFREHLDK-LFAKGIGMLDIALNEAFNIL-SDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWT-------EAYIDSTLP-------------------------------------QAQKLTDDQGPVLMTTVAMPVFSKQNETRSKGI--LLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRLLYEEGKKRRKPNYSSVDLSEVEWEDRDDV----------------LRNAMV-NRKTGKFSMEVK--KTVDKGKRVLVMTNDYYYTDIKGTPFSLGVAL 620          

HSP 2 Score: 73.9442 bits (180), Expect = 1.611e-12
Identity = 54/213 (25.35%), Postives = 96/213 (45.07%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSS 3464
            Q K +F+Q           SL  K  I  +     CY+I  +G IL +  + T  G    +I  A+M   +    +     YD QA+C    + +     L++P +  +  + W++ +L L +  F+L +  W  S           ++E   PC  + PA+    +   + G+++ C  C+++F I+ I ++NLF+VVV  S     C+C S
Sbjct:  821 QMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSE-DYTQTGDFFGEIEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCS--WWHSDMTAKAQKLKQTLE---PCDTEYPAFVSERTIKETTGNIA-CEDCSKSFVIQQIPSSNLFMVVVDSS-----CLCES 1021          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Celegans
Match: unc-36 (Voltage-dependent calcium channel unc-36 [Source:UniProtKB/Swiss-Prot;Acc:P34374])

HSP 1 Score: 149.443 bits (376), Expect = 4.932e-36
Identity = 124/475 (26.11%), Postives = 216/475 (45.47%), Query Frame = 3
Query:  594 IPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKDDSQ-LKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDR-NVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLR--KDKNNQTGNIIYNYLVMFITDG---SLSLVDNFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSR---KNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRP--QYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTI 1982
            +PT    +  HIPT LY+ + +     +W+ D+D ++R  +++++ L ++ FCS +G+ R YP   W     D  +     D +DCR   +Y+ S    K + IM+D SGSM G+   +  +  + IL TL+ ND+FNI  F  N   +D  N T  L+QAT +NK  L  +++ T     K      L   F+VL    +            ++M ITDG   +   + +    D   R+FT +    A D   + ++AC+NRGY V    ++DV + +  Y++ +SR   ++       + WTGV++ ++       F                S    +  A++       LQ +E    R +   ++V+T +      P  +N      +G   ++I + E  + +    IG  +Y F +  NGF++ HP+ RP   +    K  Y N+D+ E+E+  N  +      Q +
Sbjct:  156 LPTSSVSSAVHIPTPLYDRNEDLLRKIDWS-DIDAVYRTNREETKDLAFQLFCSEAGYMRYYPAASWFWDNQDEHL-----DLFDCRNTEWYINSATNSKNVLIMLDMSGSMLGQRYEVAKQTTEAILETLSHNDYFNIMTFSKNTFLLDGCNGTNGLLQATMRNKKALRRKMD-TYQSEGKAEYEKALPLAFSVLLDINNGGGDNNRGACENVIMLITDGAPNAYKKIFDMYNADKKVRVFTFLVGDEAIDFNEVREMACNNRGYMVHVANMADVDEKIHHYIRRMSRVVGRHYKESGQLSWWTGVYRERLYLPRPEIFA-------EPVPITNQSFAVMNKMASRRKIR---LQKSE---ARSR---MFVTTVSY-----PVIVNE---TFMGVAAVNIPLTEVAQKSHPANIGSKSYFFMLDQNGFVMTHPQLRPIDPFTKYHKQNYNNMDLLELEVGQNQNVRSSQKSQAV 599          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Celegans
Match: unc-36 (Voltage-dependent calcium channel unc-36 [Source:UniProtKB/Swiss-Prot;Acc:P34374])

HSP 1 Score: 123.635 bits (309), Expect = 3.834e-28
Identity = 93/356 (26.12%), Postives = 161/356 (45.22%), Query Frame = 3
Query:  594 IPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKDDSQ-LKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDR-NVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVL-----------RKDKNNQTGNIIYNY-----------------------------------LVMFITDG---SLSLVDNFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSR---KNAIIQNIFNIWTGVHQIQI 1499
            +PT    +  HIPT LY+ + +     +W+ D+D ++R  +++++ L ++ FCS +G+ R YP   W     D  +     D +DCR   +Y+ S    K + IM+D SGSM G+   +  +  + IL TL+ ND+FNI  F  N   +D  N T  L+QAT +NK  L  +++ T     K      L   F+VL           +++ +  + N    Y                                   ++M ITDG   +   + +    D   R+FT +    A D   + ++AC+NRGY V    ++DV + +  Y++ +SR   ++       + WTGV++ ++
Sbjct:  156 LPTSSVSSAVHIPTPLYDRNEDLLRKIDWS-DIDAVYRTNREETKDLAFQLFCSEAGYMRYYPAASWFWDNQDEHL-----DLFDCRNTEWYINSATNSKNVLIMLDMSGSMLGQRYEVAKQTTEAILETLSHNDYFNIMTFSKNTFLLDGCNGTNGLLQATMRNKKALRRKMD-TYQSEGKAEYEKALPLAFSVLLDLKGSYALYTKEEMSMMSANATNEYQFHLELPEHVLAATKQYIDSINNGGGDNNRGACENVIMLITDGAPNAYKKIFDMYNADKKVRVFTFLVGDEAIDFNEVREMACNNRGYMVHVANMADVDEKIHHYIRRMSRVVGRHYKESGQLSWWTGVYRERL 504          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Celegans
Match: tag-180 (pep chromosome:WBcel235:II:11323051:11329429:-1 gene:WBGene00007041.1 transcript:T24F1.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-180)

HSP 1 Score: 67.781 bits (164), Expect = 4.296e-11
Identity = 76/326 (23.31%), Postives = 142/326 (43.56%), Query Frame = 3
Query:  582 FLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWT--QDLDQLFRVTKDDS-QLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKD-KNNQTGNIIY----NYLVMFITDGSLSLVDNFMQNDIDA----------RIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDV------VQNVLTYLKVVSRKNAIIQNIFNIWTGVH 1487
            F+ N+    +++  HI    Y+         +WT  + L++     K+ + ++  +Y  + SG  R+YP   WK++ T   I     D +D RF  +++ + + PK +  ++D SGS++G ++ +    +  IL+TL+ ND+F    F  +   +     +  + AT  NK     +L   L+  ++ +    L    +VLR +  +NQ+    Y    + L++  TDG    VD +    +D           RIF      G S       +AC + G   E  ++ DV      +QNVL+ ++    K    +     WT ++
Sbjct:  133 FVSNMVEHNSKSGIHITVESYQCDPRVMRDFDWTGTKHLEKTMSDNKEKAPEMGHQYIGTYSGLTRMYPRRHWKVEPTPITI-----DLFDPRFRPWFVNAESVPKDIVFLLDYSGSVKGPTMHLIKITMMYILSTLSPNDYFFGVYFNNHFNPIISCANRTFMPATTSNKKVFFEELGM-LEEKDQAHFATPLKFSLDVLRGNLDSNQSLFADYRSEGHKLLIIFTDG----VDEWPHQILDEEFQTRNSELIRIFGFSMGYGTSLLPLQQYMACKSHGGYSEIDSIMDVKPQSRTIQNVLSQVRGDELKGTNAEKREPSWTQLY 448          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Celegans
Match: tag-180 (pep chromosome:WBcel235:II:11323051:11329147:-1 gene:WBGene00007041.1 transcript:T24F1.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-180)

HSP 1 Score: 67.781 bits (164), Expect = 4.676e-11
Identity = 76/326 (23.31%), Postives = 142/326 (43.56%), Query Frame = 3
Query:  582 FLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWT--QDLDQLFRVTKDDS-QLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKD-KNNQTGNIIY----NYLVMFITDGSLSLVDNFMQNDIDA----------RIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDV------VQNVLTYLKVVSRKNAIIQNIFNIWTGVH 1487
            F+ N+    +++  HI    Y+         +WT  + L++     K+ + ++  +Y  + SG  R+YP   WK++ T   I     D +D RF  +++ + + PK +  ++D SGS++G ++ +    +  IL+TL+ ND+F    F  +   +     +  + AT  NK     +L   L+  ++ +    L    +VLR +  +NQ+    Y    + L++  TDG    VD +    +D           RIF      G S       +AC + G   E  ++ DV      +QNVL+ ++    K    +     WT ++
Sbjct:  133 FVSNMVEHNSKSGIHITVESYQCDPRVMRDFDWTGTKHLEKTMSDNKEKAPEMGHQYIGTYSGLTRMYPRRHWKVEPTPITI-----DLFDPRFRPWFVNAESVPKDIVFLLDYSGSVKGPTMHLIKITMMYILSTLSPNDYFFGVYFNNHFNPIISCANRTFMPATTSNKKVFFEELGM-LEEKDQAHFATPLKFSLDVLRGNLDSNQSLFADYRSEGHKLLIIFTDG----VDEWPHQILDEEFQTRNSELIRIFGFSMGYGTSLLPLQQYMACKSHGGYSEIDSIMDVKPQSRTIQNVLSQVRGDELKGTNAEKREPSWTQLY 448          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Fly
Match: Ca-Ma2d (gene:FBgn0261999 transcript:FBtr0303797)

HSP 1 Score: 189.119 bits (479), Expect = 2.623e-48
Identity = 148/559 (26.48%), Postives = 241/559 (43.11%), Query Frame = 3
Query:  552 FQTLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRK--DKNNQTGNIIYNYLVMFITDGSLSLVDNFMQ-----------NDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSN--VGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNS-MKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTA--SLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTN 2171
            ++ +   PD    N P     ++ H+P+++++ S        W++ LD++FR   + D  L W+YF S +G  R YP  +W    TD+  N    D YDCR   +Y+++    K + I++D SGSM G    +    ++ IL+T + NDFF I  +   +  +       L+QAT +N      Q+ Q  DP    NL L     F +LRK  D  +   N   N  +M +TDG         Q           + +D R+FT++  +  +    I  +AC NRGY    QTL +V + VL Y+ V++    ++QN  +  T  H    K                                T  P               EK   L +S     +D+  +  NS      +LG  G D+ V +  K    +K+GVN Y F +++NG+++ HP  RP   N  M   Y ++D +EVE         +  DQ+ + P  +   +R  M+ + A  +F +  V F   D      + K++YF A +  TP+  G+ +P+ 
Sbjct:  171 YRNMELNPDTHFYNTPVDTEHSSVHVPSNIWDRSERVLKTIMWSEHLDEVFRQNYQSDPALSWQYFGSDTGILRHYPAAQW----TDTRPNRDDADTYDCRKRSWYIETATCSKDIVILLDHSGSMTGFRHHVAKFTIRSILDTFSNNDFFTILRYSSEVNDIIPCFNGALVQATPENIEVFNQQIEQLDDPEGYANLTLAYETAFQLLRKYYDSRHCVTNSTCNQAIMLVTDGVAGNTTEVFQKYNWGNGENGTSQMDTRVFTYLLGKEVTKVREIQWMACLNRGYYSHVQTLDEVHEEVLKYVDVIATP-LVLQNEQHPPTWTHAFTDK--------------------------------TYDPKT-----------SNEKRPRLMISVGVPAFDRFYRHANSTNPRARLLGVAGTDVPVEDIDKLTLPYKLGVNGYSFVVSNNGYVLLHPDLRPIGTNGKMNPNYNSIDFTEVE--------HLFEDQSPREPGESILHIRNAMVRHEA-NEFKSISVKFH-YDKMRRVSEEKQDYFFAPLPNTPFTLGIVMPSE 671          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Fly
Match: Ca-Ma2d (gene:FBgn0261999 transcript:FBtr0332356)

HSP 1 Score: 189.119 bits (479), Expect = 2.623e-48
Identity = 148/559 (26.48%), Postives = 241/559 (43.11%), Query Frame = 3
Query:  552 FQTLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRK--DKNNQTGNIIYNYLVMFITDGSLSLVDNFMQ-----------NDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSN--VGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNS-MKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTA--SLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTN 2171
            ++ +   PD    N P     ++ H+P+++++ S        W++ LD++FR   + D  L W+YF S +G  R YP  +W    TD+  N    D YDCR   +Y+++    K + I++D SGSM G    +    ++ IL+T + NDFF I  +   +  +       L+QAT +N      Q+ Q  DP    NL L     F +LRK  D  +   N   N  +M +TDG         Q           + +D R+FT++  +  +    I  +AC NRGY    QTL +V + VL Y+ V++    ++QN  +  T  H    K                                T  P               EK   L +S     +D+  +  NS      +LG  G D+ V +  K    +K+GVN Y F +++NG+++ HP  RP   N  M   Y ++D +EVE         +  DQ+ + P  +   +R  M+ + A  +F +  V F   D      + K++YF A +  TP+  G+ +P+ 
Sbjct:  171 YRNMELNPDTHFYNTPVDTEHSSVHVPSNIWDRSERVLKTIMWSEHLDEVFRQNYQSDPALSWQYFGSDTGILRHYPAAQW----TDTRPNRDDADTYDCRKRSWYIETATCSKDIVILLDHSGSMTGFRHHVAKFTIRSILDTFSNNDFFTILRYSSEVNDIIPCFNGALVQATPENIEVFNQQIEQLDDPEGYANLTLAYETAFQLLRKYYDSRHCVTNSTCNQAIMLVTDGVAGNTTEVFQKYNWGNGENGTSQMDTRVFTYLLGKEVTKVREIQWMACLNRGYYSHVQTLDEVHEEVLKYVDVIATP-LVLQNEQHPPTWTHAFTDK--------------------------------TYDPKT-----------SNEKRPRLMISVGVPAFDRFYRHANSTNPRARLLGVAGTDVPVEDIDKLTLPYKLGVNGYSFVVSNNGYVLLHPDLRPIGTNGKMNPNYNSIDFTEVE--------HLFEDQSPREPGESILHIRNAMVRHEA-NEFKSISVKFH-YDKMRRVSEEKQDYFFAPLPNTPFTLGIVMPSE 671          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Fly
Match: stj (gene:FBgn0261041 transcript:FBtr0087631)

HSP 1 Score: 186.422 bits (472), Expect = 1.969e-47
Identity = 176/746 (23.59%), Postives = 323/746 (43.30%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLD---PANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLS------LVDNFMQNDID-ARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFN-IWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSP---TVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNS-MKIFYRNVDISEVEISSNLTIAEINGDQTIQP--PNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFC------FMTPEIATLQMLS----------------PLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITXXXXXXXXXXXXXGKNFSVQQIFSMLHFGLIRYYNY------ENLYYQNFIKNHSAGIDDSLYQETI 2666
              P P   N P   + ++ H+P ++++ + +      W+++LDQ+FR   K+D  L W++F SS+GF R +P  +W+         +  VD YDCR   +Y+++   PK + I++D SGSM G+ + +   +V  IL+TL  NDF NI  F   ++ V       LIQA   N    + +L + ++   P +  N    LT+ F +L + K +  G    N  +M I DG+         + N+        R+FT++  +  ++   I  +AC N+GY V     ++V + VL Y+ V++R   + ++    IW+ V+   I+ ++ SD+     Q        +            S      +  ++ T  Q V         + +  +YD+      + + N+LG  G D+ +NE  K    + +GVN Y F +T+NG+++FHP FRP ++   +K  Y +VD+ EVE+        ++ D+  +   P   ++R  +++ +   ++   ++     D      +VKR Y+   I  TP+   ++ P    V        + + +   Q +  I+    N +    ++   +      D+ FC      F TPEI  L  L                 P      +F +  L+    F+      + NN       S +      +   + F V   F   H GL R++ +      E+   + F +N++  ID+  Y+  +
Sbjct:  166 LEPRPEFHNTPVNFSVSSVHVPVNVFDRAPDVIKAIQWSENLDQIFRDNYKNDPTLSWQFFGSSTGFMRQFPASKWR--------KDVPVDLYDCRLRSWYMEAATSPKDIVILMDGSGSMLGQRLDIAKHVVNTILDTLGTNDFVNIFTFDKEVSPVVPCFEDTLIQANLGN----IRELKEGIELFRPKSIANYTAALTKAFELLEETKLSSRGAQC-NQAIMIIGDGAPENNREVFELHNWRDPPYKPVRVFTYLIGKEVANWDDIRWMACENQGYYVHLSDTAEVREMVLNYIPVMARPLVLGRHDHPVIWSQVYA-DIEDTKLSDYLWDINQCEYQKADVLEYWQVHDRMLEPSEMHRRKYRRMKETWNQPVDSNVYQFMTTVSMPIYDRRENA--TRIANILGVAGTDVPINEIKKLLSPFTLGVNGYAFIVTNNGYVLFHPDFRPIFQGYILKPAYNSVDMIEVEL--------LDDDRPARDFNPVLMTIRDSIINQSTGSKW---MLVKNHFDEMKRVARVKRQYYWTAIKKTPFTLVISYPEQYGV--------SHMDIRADQEIHRISIKGTNLR----SVFSGKRWKIHPDWLFCKHSNRTFKTPEIELLYFLERMSEPGWRWPGSRSAMPPEHAAAMFCDRQLMQALVFDARVTGWFSNNT------SFNSKDDKGNEFKQRFGVTVAFLATHSGLTRWHEFHSNAAEESGVGETFSQNNTRAIDEIWYKRAV 866          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Fly
Match: stj (gene:FBgn0261041 transcript:FBtr0304695)

HSP 1 Score: 182.956 bits (463), Expect = 2.227e-46
Identity = 180/765 (23.53%), Postives = 329/765 (43.01%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLD---PANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLS------LVDNFMQNDID-ARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFN-IWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKS-----------PTVFAILQSTEFQFVREKPIPLY-----------VSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNS-MKIFYRNVDISEVEISSNLTIAEINGDQTIQP--PNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFC------FMTPEIATLQMLS----------------PLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITXXXXXXXXXXXXXGKNFSVQQIFSMLHFGLIRYYNY------ENLYYQNFIKNHSAGIDDSLYQETI 2666
              P P   N P   + ++ H+P ++++ + +      W+++LDQ+FR   K+D  L W++F SS+GF R +P  +W+         +  VD YDCR   +Y+++   PK + I++D SGSM G+ + +   +V  IL+TL  NDF NI  F   ++ V       LIQA   N    + +L + ++   P +  N    LT+ F +L + K +  G    N  +M I DG+         + N+        R+FT++  +  ++   I  +AC N+GY V     ++V + VL Y+ V++R   + ++    IW+ V+   I+ ++ SD+     Q        +            S            T    + S  +QF+    +P+Y           V    A+++   +T  + + N+LG  G D+ +NE  K    + +GVN Y F +T+NG+++FHP FRP ++   +K  Y +VD+ EVE+        ++ D+  +   P   ++R  +++ +   ++   ++     D      +VKR Y+   I  TP+   ++ P    V        + + +   Q +  I+    N +    ++   +      D+ FC      F TPEI  L  L                 P      +F +  L+    F+      + NN       S +      +   + F V   F   H GL R++ +      E+   + F +N++  ID+  Y+  +
Sbjct:  166 LEPRPEFHNTPVNFSVSSVHVPVNVFDRAPDVIKAIQWSENLDQIFRDNYKNDPTLSWQFFGSSTGFMRQFPASKWR--------KDVPVDLYDCRLRSWYMEAATSPKDIVILMDGSGSMLGQRLDIAKHVVNTILDTLGTNDFVNIFTFDKEVSPVVPCFEDTLIQANLGN----IRELKEGIELFRPKSIANYTAALTKAFELLEETKLSSRGAQC-NQAIMIIGDGAPENNREVFELHNWRDPPYKPVRVFTYLIGKEVANWDDIRWMACENQGYYVHLSDTAEVREMVLNYIPVMARPLVLGRHDHPVIWSQVYA-DIEDTKLSDYLWDINQCEYQKADVLEYWQVHDRMLEPSEMHRRKYRRMKETWNQPVDSNVYQFMTTVSMPIYDRRENANITEEVLINEALWEL--QTRETRIANILGVAGTDVPINEIKKLLSPFTLGVNGYAFIVTNNGYVLFHPDFRPIFQGYILKPAYNSVDMIEVEL--------LDDDRPARDFNPVLMTIRDSIINQSTGSKW---MLVKNHFDEMKRVARVKRQYYWTAIKKTPFTLVISYPEQYGV--------SHMDIRADQEIHRISIKGTNLR----SVFSGKRWKIHPDWLFCKHSNRTFKTPEIELLYFLERMSEPGWRWPGSRSAMPPEHAAAMFCDRQLMQALVFDARVTGWFSNNT------SFNSKDDKGNEFKQRFGVTVAFLATHSGLTRWHEFHSNAAEESGVGETFSQNNTRAIDEIWYKRAV 885          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Fly
Match: stj (gene:FBgn0261041 transcript:FBtr0304694)

HSP 1 Score: 183.341 bits (464), Expect = 2.258e-46
Identity = 162/644 (25.16%), Postives = 291/644 (45.19%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLD---PANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLS------LVDNFMQNDID-ARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFN-IWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKS-----------PTVFAILQSTEFQFVREKPIPLYVSTAAAVY----DQSPKT-IN---SNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNS-MKIFYRNVDISEVEISSNLTIAEINGDQTIQP--PNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFC------FMTPEIATLQMLSPL 2378
              P P   N P   + ++ H+P ++++ + +      W+++LDQ+FR   K+D  L W++F SS+GF R +P  +W+         +  VD YDCR   +Y+++   PK + I++D SGSM G+ + +   +V  IL+TL  NDF NI  F   ++ V       LIQA   N    + +L + ++   P +  N    LT+ F +L + K +  G    N  +M I DG+         + N+        R+FT++  +  ++   I  +AC N+GY V     ++V + VL Y+ V++R   + ++    IW+ V+   I+ ++ SD+     Q        +            S            T    + S  +QF+    +P+Y     A+     D +P   IN   + + N+LG  G D+ +NE  K    + +GVN Y F +T+NG+++FHP FRP ++   +K  Y +VD+ EVE+        ++ D+  +   P   ++R  +++ +   ++   ++     D      +VKR Y+   I  TP+   ++ P    V        + + +   Q +  I+    N +    ++   +      D+ FC      F TPEI  L  L  +
Sbjct:  166 LEPRPEFHNTPVNFSVSSVHVPVNVFDRAPDVIKAIQWSENLDQIFRDNYKNDPTLSWQFFGSSTGFMRQFPASKWR--------KDVPVDLYDCRLRSWYMEAATSPKDIVILMDGSGSMLGQRLDIAKHVVNTILDTLGTNDFVNIFTFDKEVSPVVPCFEDTLIQANLGN----IRELKEGIELFRPKSIANYTAALTKAFELLEETKLSSRGAQC-NQAIMIIGDGAPENNREVFELHNWRDPPYKPVRVFTYLIGKEVANWDDIRWMACENQGYYVHLSDTAEVREMVLNYIPVMARPLVLGRHDHPVIWSQVYA-DIEDTKLSDYLWDINQCEYQKADVLEYWQVHDRMLEPSEMHRRKYRRMKETWNQPVDSNVYQFMTTVSMPIYDRRENALINLTTDINPAAKINLQVTRIANILGVAGTDVPINEIKKLLSPFTLGVNGYAFIVTNNGYVLFHPDFRPIFQGYILKPAYNSVDMIEVEL--------LDDDRPARDFNPVLMTIRDSIINQSTGSKW---MLVKNHFDEMKRVARVKRQYYWTAIKKTPFTLVISYPEQYGV--------SHMDIRADQEIHRISIKGTNLR----SVFSGKRWKIHPDWLFCKHSNRTFKTPEIELLYFLERM 772          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Zebrafish
Match: cacna2d3 (calcium channel, voltage dependent, alpha2/delta subunit 3 [Source:ZFIN;Acc:ZDB-GENE-030616-133])

HSP 1 Score: 192.586 bits (488), Expect = 2.191e-49
Identity = 145/544 (26.65%), Postives = 247/544 (45.40%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNL---CLTEVFNVLRKDKNNQTG-NIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKI---FYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
              P+   +N+    + +   +PT++Y    +      W++ L+++F    + D  L W+YF S+ GF R YPG++W       + +   V  +DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   + +V+  +   L+QA   NK    +   + LD      + L    L+E F +L  ++ NQTG     +  +M ITDG+  + D+        +   RIF ++  + ++   ++  +AC+N+GY  +  TL+DV +NV+ YL V+SR   I      +WT  +   + +++  +  G                                            P P+  + A  V+  S K    N G +LG  G DI + E +K  P  K+G++ Y F ITSNG+L+ HP  RP Y+   K     Y +VD+SEVE      +                LR  M++    K  + S+   + +D       +  +Y+   I GTP+  G+A+
Sbjct:  149 LEPNDHFNNLSVNLSLSVVQVPTNMYNKDPDIVNGVYWSEALNKVFVDNFRRDPTLIWQYFGSAKGFFRQYPGVKW-------YPDEHGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIARQTVASILDTLGDDDFFNIIAYNQEIHYVEPCLNGTLVQADSTNK----DHFKEHLDKLFAKGIGLLGNALSEAFTIL--NEINQTGRGSSCSQAIMLITDGATEMYDDVFAKYNWPERKVRIFPYLIGRESAFADNLKWMACANKGYFSQISTLADVQENVMRYLHVMSRPKVIDHEHDTVWTEAY---VDSAQLGENKG--------------------------------------------PNPM-TTVAMPVF--STKNETKNQGILLGVAGTDIPIQELMKVIPKHKLGIHGYAFAITSNGYLLLHPDLRPLYQEGQKRKKPSYSSVDLSEVEWEDTEDV----------------LRTAMVNR---KTGTFSMEVKRTVDKGKRVLTMHNDYYYTDIKGTPFSVGVAL 610          

HSP 2 Score: 62.003 bits (149), Expect = 4.249e-9
Identity = 54/219 (24.66%), Postives = 97/219 (44.29%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSR----PCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAF 3470
            Q K +F+Q           +L  K  I  ++   +CY+I  +G IL +  + +   L    +  A+M   +    +     YD QALC   +  +   + L++P + +     W++ +L + +  F+L +  W   S        V +  + R    PC  + PA+    +   + G++ +C GC + F I+ I ++NLF+VVV       KC C SA 
Sbjct:  810 QMKLEFFQRKFWTASRQCNALDGKCTISCDNEDIKCYLIDNNGFILVSE-DTSQTNLFFGKVEGAVMNKLLLMGSFKKINLYDYQALCKEYAGSSDSARTLLDPFTTVK----WLLTELVIFLLEFNLYS-WWNCDS-------TVKAQRSQRTMMVPCDTEYPAFVSERTIKETTGNI-DCNGCIRTFVIQQIPSSNLFMVVV-----ENKCDCGSAL 1009          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Zebrafish
Match: cacna2d3 (calcium channel, voltage dependent, alpha2/delta subunit 3 [Source:ZFIN;Acc:ZDB-GENE-030616-133])

HSP 1 Score: 192.2 bits (487), Expect = 2.978e-49
Identity = 146/544 (26.84%), Postives = 245/544 (45.04%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNL---CLTEVFNVLRKDKNNQTG-NIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKI---FYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
              P+   +N+    + +   +PT++Y    +      W++ L+++F    + D  L W+YF S+ GF R YPG++W       + +   V  +DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   + +V+  +   L+QA   NK    +   + LD      + L    L+E F +L  ++ NQTG     +  +M ITDG+  + D+        +   RIF ++  + ++   ++  +AC+N+GY  +  TL+DV +NV+ YL V+SR   I      +WT  +                                          V + L         + P P+  + A  V+  S K    N G +LG  G DI + E +K  P  K+G++ Y F ITSNG+L+ HP  RP Y+   K     Y +VD+SEVE      +                LR  M++    K  + S+   + +D       +  +Y+   I GTP+  G+A+
Sbjct:  149 LEPNDHFNNLSVNLSLSVVQVPTNMYNKDPDIVNGVYWSEALNKVFVDNFRRDPTLIWQYFGSAKGFFRQYPGVKW-------YPDEHGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIARQTVASILDTLGDDDFFNIIAYNQEIHYVEPCLNGTLVQADSTNK----DHFKEHLDKLFAKGIGLLGNALSEAFTIL--NEINQTGRGSSCSQAIMLITDGATEMYDDVFAKYNWPERKVRIFPYLIGRESAFADNLKWMACANKGYFSQISTLADVQENVMRYLHVMSRPKVIDHEHDTVWTEAY------------------------------------------VDSALAQAHKLGENKGPNPM-TTVAMPVF--STKNETKNQGILLGVAGTDIPIQELMKVIPKHKLGIHGYAFAITSNGYLLLHPDLRPLYQEGQKRKKPSYSSVDLSEVEWEDTEDV----------------LRTAMVNR---KTGTFSMEVKRTVDKGKRVLTMHNDYYYTDIKGTPFSVGVAL 615          

HSP 2 Score: 62.003 bits (149), Expect = 5.169e-9
Identity = 54/219 (24.66%), Postives = 97/219 (44.29%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSR----PCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAF 3470
            Q K +F+Q           +L  K  I  ++   +CY+I  +G IL +  + +   L    +  A+M   +    +     YD QALC   +  +   + L++P + +     W++ +L + +  F+L +  W   S        V +  + R    PC  + PA+    +   + G++ +C GC + F I+ I ++NLF+VVV       KC C SA 
Sbjct:  815 QMKLEFFQRKFWTASRQCNALDGKCTISCDNEDIKCYLIDNNGFILVSE-DTSQTNLFFGKVEGAVMNKLLLMGSFKKINLYDYQALCKEYAGSSDSARTLLDPFTTVK----WLLTELVIFLLEFNLYS-WWNCDS-------TVKAQRSQRTMMVPCDTEYPAFVSERTIKETTGNI-DCNGCIRTFVIQQIPSSNLFMVVVEN-----KCDCGSAL 1014          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Zebrafish
Match: cacna2d4b (calcium channel, voltage-dependent, alpha 2/delta subunit 4b [Source:ZFIN;Acc:ZDB-GENE-100422-18])

HSP 1 Score: 186.808 bits (473), Expect = 8.465e-48
Identity = 144/495 (29.09%), Postives = 227/495 (45.86%), Query Frame = 3
Query:  714 KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQAT-DKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSL----SLVDNFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIF----YRNVDISEVE---ISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
            + D  L W+YFCS +GF R+YPGIRW          N +V F DCR   +Y+Q+   PK + I+VD SGSM+G  + +    +  IL+TL ENDF N+  +   +++V+      L+QA  D  + F L  L   L    +  +   + E F +L   + N  G++  N  +M ITDG++    S+ + F   D   R+FT++  +  +   ++  IAC+N+G+     TL+DV +NV+ YL V+SR   I  +   IWT                                               A + S  F+  +   +    S A  V+ +  +T++   G +LG VG DI + E +K AP +K+G + Y F IT+NG+++ HP  RP Y    K+     Y +VD+SE E      NL  A + G+       T +L  ++    AV +    L              +K +YF   I  TP+ FG+ +
Sbjct:  197 QKDPTLTWQYFCSQTGFFRLYPGIRWTPDA------NGVVSF-DCRNRNWYIQAATSPKDLVIVVDVSGSMKGLKMTIAKHTINTILDTLGENDFVNVIAYTDYVSYVEPCFKGTLVQADLDNREHFKL--LVDELHVKGEAKVKKAMKESFRILADARANGQGSLC-NQAIMLITDGAMEDFQSVFEEFNWPDKKVRVFTYLIGRDMTFSENVKWIACNNKGFYAHVSTLADVQENVMEYLHVLSRPMVINHDHDIIWTE----------------------------------------------AYMDSVVFK-SKAHSLLFMTSVAMPVFSKKKETLSH--GILLGVVGTDIPLLEVMKLAPRYKLGAHGYAFLITNNGYILAHPDLRPLYYEGKKLKPKPNYNSVDLSEAEWEDTEDNLRTAMVKGE-------TGTLALDV--RTAVDKGKRPLF-------------LKNDYFYTTIDETPFSFGMVL 610          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Zebrafish
Match: cacna2d4b (calcium channel, voltage-dependent, alpha 2/delta subunit 4b [Source:ZFIN;Acc:ZDB-GENE-100422-18])

HSP 1 Score: 187.578 bits (475), Expect = 9.784e-48
Identity = 144/495 (29.09%), Postives = 227/495 (45.86%), Query Frame = 3
Query:  714 KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQAT-DKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSL----SLVDNFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIF----YRNVDISEVE---ISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
            + D  L W+YFCS +GF R+YPGIRW          N +V F DCR   +Y+Q+   PK + I+VD SGSM+G  + +    +  IL+TL ENDF N+  +   +++V+      L+QA  D  + F L  L   L    +  +   + E F +L   + N  G++  N  +M ITDG++    S+ + F   D   R+FT++  +  +   ++  IAC+N+G+     TL+DV +NV+ YL V+SR   I  +   IWT                                               A + S  F+  +   +    S A  V+ +  +T++   G +LG VG DI + E +K AP +K+G + Y F IT+NG+++ HP  RP Y    K+     Y +VD+SE E      NL  A + G+       T +L  ++    AV +    L              +K +YF   I  TP+ FG+ +
Sbjct:  197 QKDPTLTWQYFCSQTGFFRLYPGIRWTPDA------NGVVSF-DCRNRNWYIQAATSPKDLVIVVDVSGSMKGLKMTIAKHTINTILDTLGENDFVNVIAYTDYVSYVEPCFKGTLVQADLDNREHFKL--LVDELHVKGEAKVKKAMKESFRILADARANGQGSLC-NQAIMLITDGAMEDFQSVFEEFNWPDKKVRVFTYLIGRDMTFSENVKWIACNNKGFYAHVSTLADVQENVMEYLHVLSRPMVINHDHDIIWTE----------------------------------------------AYMDSVVFK-SKAHSLLFMTSVAMPVFSKKKETLSH--GILLGVVGTDIPLLEVMKLAPRYKLGAHGYAFLITNNGYILAHPDLRPLYYEGKKLKPKPNYNSVDLSEAEWEDTEDNLRTAMVKGE-------TGTLALDV--RTAVDKGKRPLF-------------LKNDYFYTTIDETPFSFGMVL 610          

HSP 2 Score: 65.4698 bits (158), Expect = 4.142e-10
Identity = 42/181 (23.20%), Postives = 80/181 (44.20%), Query Frame = 3
Query: 2931 CYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFG 3473
            CY++ ++G IL +  +    G    +I+ ++M   + + +Y     YD QA+C      +S  + L++P   L+  + W      + +  F++  L W      +   +    VE  +PC  + P +    S +R   S+  C  C + F ++ I N+NL ++VV        C CS  + 
Sbjct:  849 CYLVDSNGFILMSK-DRGDVGRFFGEIDGSVMAQLLKSGLYKRVTLYDYQAMCKTGHHHSSGARPLLSPFYALLALIKWWFSHFVMFMLEFNICGL-WHNDYVVDA--HKQKKVELMQPCNTEYPGFMYDKS-IRETNSIIKCGRCQKMFVLQQIPNSNLVMLVV-----QADCDCSRQYA 1019          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Zebrafish
Match: cacna2d4a (calcium channel, voltage-dependent, alpha 2/delta subunit 4a [Source:ZFIN;Acc:ZDB-GENE-041210-213])

HSP 1 Score: 182.185 bits (461), Expect = 6.182e-47
Identity = 147/558 (26.34%), Postives = 247/558 (44.27%), Query Frame = 3
Query:  564 PFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQAT-DKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLS----LVDNFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIF----YRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKV---KRNYFMAGISGTPYKFGLAIPTNQMVPVYANN 2198
            P   +   +N+P    ++   +PT++Y    +       ++ L+ +F    + D  L W+YF SS+GF R+YPGI+W   +      N +V F D R   +Y+Q+   PK + I VD SGSM+G  + +    +  IL+TL ENDF N+  +   + +V+      L+QA  D  + F L  L Q L    +  +   + E F +L +      G++  N  +M ITDG++     + + F   D   R+FT++  +  +   ++  IAC+N+GY     TL+DV +NV+ YL V+SR   I  +   IWT  +   +  S                                                    + L  S A  V+ +  +T++  +  +LG VG D+ + E ++ AP +K+GV+ Y F  T+NG+++ HP  RP YK+  K+     Y +VD+SEVE            + T     TA ++ E           T  ++  +  +   G +V   K  YF   I+ TP+  G+ +       V+  N
Sbjct:  113 PLEENEHFNNLPVNTQQSVVQVPTNVYNKDPDILNGVFMSEALNDIFISNFEKDPTLTWQYFGSSTGFFRLYPGIKWTPDE------NGVVTF-DGRNRNWYIQAATSPKDIIIAVDISGSMKGLRLTIAKHTINTILDTLGENDFVNVIAYSDYVQYVEPCFKGTLVQADLDNREHFKL--LVQELQVKGEGKVKKAMKESFKILNEAAAEGRGSLC-NQAIMLITDGAMEDFQQVFEEFNWPDRKVRVFTYLIGRELTFASNVKWIACNNKGYYTHISTLADVQENVMEYLHVLSRPMVINHDHDIIWTEAYMDSVAES----------------------------------------------------LLLMTSVAMPVFSKKEETLSHGI--LLGVVGTDVPLKELMRLAPRYKLGVHGYAFLNTNNGYILSHPDLRPLYKDGKKLKPKPNYNSVDLSEVEW-----------EDTEDALRTAMVKGE-----------TGTISLDVRATVEKGKRVVFLKNEYFYTTINETPFSLGIVLTNGHGKNVFIGN 584          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Xenopus
Match: CACNA2D3 (calcium channel, voltage-dependent, alpha 2/delta subunit 3 [Source:NCBI gene;Acc:101732520])

HSP 1 Score: 203.371 bits (516), Expect = 4.880e-53
Identity = 150/538 (27.88%), Postives = 257/538 (47.77%), Query Frame = 3
Query:  573 PDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
            P+   +N+P   + +   +PT++Y    E      W++ L+++F    D D  L W+YF S+ GF R YPGI+W+  +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   + +V+  +   L+QA   NK      L++ L       L++ L E F++L +  ++  G++  +  +M I DG++   DN        D   R+FT++  + A+   ++  +AC+N+G+  +  TL+DV +NV+ YL V+SR   I Q    +WT       +A   S  P   AQ                                  +   ++ + L  + A  V+ +  +T +  V  +LG VG D+ V E +K  P +K+G++ Y F IT+NG+++ HP+ RP Y   K   K  Y +VD+SEVE      +                LR  M+ N   ++FS  +   + +D       +  +Y+   I GTP+  G+ +
Sbjct:   14 PNDHFNNLPVNVSLSDVQVPTNVYNKDPEIVNGIYWSEALNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDE------NGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEEIQYVEPCLNGTLVQADRNNKEHFREHLDK-LYAKGIGMLDIALNEAFDLLSEFNHSGEGSVC-SQAIMLIADGAVDTYDNIFAKYNWPDRKVRMFTYLIGREAAFADNMKWMACANKGFFTQISTLADVQENVMAYLHVLSRPKVIDQEHDVVWT-------EAYVDSTLP--QAQ----------------------------------KLADDQGLVLMTTVAMPVFSRQNETRSKGV--LLGVVGTDVPVKELMKAIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDV----------------LRNAMV-NRKTEKFSMEVK--KTVDKGKRVLVMTNDYYYTDIKGTPFSLGVVL 478          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Xenopus
Match: CACNA2D3 (calcium channel, voltage-dependent, alpha 2/delta subunit 3 [Source:NCBI gene;Acc:101732520])

HSP 1 Score: 202.216 bits (513), Expect = 1.123e-52
Identity = 149/538 (27.70%), Postives = 256/538 (47.58%), Query Frame = 3
Query:  573 PDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
            P+   +N+P   + +   +PT++Y    E      W++ L+++F    D D  L W+YF S+ GF R YPGI+W+  +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   + +V+  +   L+QA   NK      L++ L       L++ L E F++L +  ++  G++  +  +M I DG++   DN        D   R+FT++  + A+   ++  +AC+N+G+  +  TL+DV +NV+ YL V+SR   I Q    +WT                                       A    TV     S++     ++ + L  + A  V+ +  +T +  V  +LG VG D+ V E +K  P +K+G++ Y F IT+NG+++ HP+ RP Y   K   K  Y +VD+SEVE      +                LR  M+ N   ++FS  +   + +D       +  +Y+   I GTP+  G+ +
Sbjct:   14 PNDHFNNLPVNVSLSDVQVPTNVYNKDPEIVNGIYWSEALNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDE------NGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEEIQYVEPCLNGTLVQADRNNKEHFREHLDK-LYAKGIGMLDIALNEAFDLLSEFNHSGEGSVC-SQAIMLIADGAVDTYDNIFAKYNWPDRKVRMFTYLIGREAAFADNMKWMACANKGFFTQISTLADVQENVMAYLHVLSRPKVIDQEHDVVWT--------------------------------------EAYVDSTV-----SSQSLLADDQGLVLMTTVAMPVFSRQNETRSKGV--LLGVVGTDVPVKELMKAIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDV----------------LRNAMV-NRKTEKFSMEVK--KTVDKGKRVLVMTNDYYYTDIKGTPFSLGVVL 478          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Xenopus
Match: CACNA2D3 (calcium channel, voltage-dependent, alpha 2/delta subunit 3 [Source:NCBI gene;Acc:101732520])

HSP 1 Score: 183.726 bits (465), Expect = 1.469e-49
Identity = 129/458 (28.17%), Postives = 222/458 (48.47%), Query Frame = 3
Query:  531 EKIDDCTFQTLP----FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRP 1877
            E+ +D  F  L       P+   +N+P   + +   +PT++Y    E      W++ L+++F    D D  L W+YF S+ GF R YPGI+W+  +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   + +V+  +   L+QA   NK      L++ L       L++ L E F++L +  ++  G++  +  +M I DG++   DN        D   R+FT++  + A+   ++  +AC+N+G+  +  TL+DV +NV+ YL V+SR   I Q    +WT                                               A + ST      ++ + L  + A  V+ +  +T +  V  +LG VG D+ V E +K  P +K+G++ Y F IT+NG+++ HP+ RP
Sbjct:   28 ERDEDGNFLELGKEFLLLPNDHFNNLPVNVSLSDVQVPTNVYNKDPEIVNGIYWSEALNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDE------NGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEEIQYVEPCLNGTLVQADRNNKEHFREHLDK-LYAKGIGMLDIALNEAFDLLSEFNHSGEGSVC-SQAIMLIADGAVDTYDNIFAKYNWPDRKVRMFTYLIGREAAFADNMKWMACANKGFFTQISTLADVQENVMAYLHVLSRPKVIDQEHDVVWTE----------------------------------------------AYVDST---LADDQGLVLMTTVAMPVFSRQNETRSKGV--LLGVVGTDVPVKELMKAIPKYKLGIHGYAFAITNNGYILTHPELRP 425          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Xenopus
Match: CACNA2D4 (calcium channel, voltage-dependent, alpha 2/delta subunit 4 [Source:NCBI gene;Acc:100488361])

HSP 1 Score: 185.267 bits (469), Expect = 5.772e-47
Identity = 146/508 (28.74%), Postives = 227/508 (44.69%), Query Frame = 3
Query:  720 DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIF----YRNVDISEVEISSN---LTIAEINGDQTIQPPNTASLRQEM---LDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNT 2201
            D  L W+YF SSSGF R+YPGI+W   +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +    +  +L+TL ENDF NI  +   + +++      L+QA   N+     QL   L       +N  L E F +L++ +    G +  N  +M ITDG++   +   +     D   R+FT++  +  +   ++  IAC+N+GY  +  TL+DV +NV+ YL V+SR   I  +   IWT  +          D   F++Q                                       + + L  + A  V+  S K    + G +LG VG D+ + E +K AP +K+GV+ Y F  T+NG+++ HP  RP YK   K+     Y +VD+SEVE       L  A ING+       T SL  ++   +D      F TS                  +YF   I  TP+  G+ +       +   NT
Sbjct:  216 DPTLTWQYFGSSSGFFRLYPGIKWVPDE------NGVISF-DCRNRGWYIQAATSPKDIVIVVDISGSMKGLRMTIAKHTISTLLDTLGENDFVNIIAYNDYVHYIEPCFKGILVQADRDNREH-FKQLVDELHAKGVGTVNKALIEAFKILKEFREAGQGGLC-NQAIMLITDGAVEEYEPVFEKYNFPDRKVRLFTYLIGREVTFSSNVKWIACNNKGYYTQISTLADVQENVMEYLHVLSRPMVINHDHDIIWTEAYM---------DSALFASQA--------------------------------------QSLLLMTTVAMPVF--SKKNETRSEGILLGVVGSDVPLRELLKLAPRYKLGVHGYAFLNTNNGYILSHPDLRPLYKEGKKLRPKPNYNSVDLSEVEWEDKDEILRTAMINGE-------TGSLTMDVKVPVDKGKRVLFLTS------------------DYFYTHIDDTPFSLGVVLSRGHGEYILIGNT 640          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Xenopus
Match: CACNA2D4 (calcium channel, voltage-dependent, alpha 2/delta subunit 4 [Source:NCBI gene;Acc:100488361])

HSP 1 Score: 141.739 bits (356), Expect = 2.740e-35
Identity = 86/257 (33.46%), Postives = 136/257 (52.92%), Query Frame = 3
Query:  720 DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWT 1478
            D  L W+YF SSSGF R+YPGI+W   +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +    +  +L+TL ENDF NI  +   + +++      L+QA   N+     QL   L       +N  L E F +L++ +    G +  N  +M ITDG++   +   +     D   R+FT++  +  +   ++  IAC+N+GY  +  TL+DV +NV+ YL V+SR   I  +   IWT
Sbjct:   78 DPTLTWQYFGSSSGFFRLYPGIKWVPDE------NGVISF-DCRNRGWYIQAATSPKDIVIVVDISGSMKGLRMTIAKHTISTLLDTLGENDFVNIIAYNDYVHYIEPCFKGILVQADRDNREH-FKQLVDELHAKGVGTVNKALIEAFKILKEFREAGQGGLC-NQAIMLITDGAVEEYEPVFEKYNFPDRKVRLFTYLIGREVTFSSNVKWIACNNKGYYTQISTLADVQENVMEYLHVLSRPMVINHDHDIIWT 325          

HSP 2 Score: 53.1434 bits (126), Expect = 2.179e-6
Identity = 27/69 (39.13%), Postives = 41/69 (59.42%), Query Frame = 3
Query: 1671 LYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRP 1877
            L + T  A+   S K    + G +LG VG D+ + E +K AP +K+GV+ Y F  T+NG+++ HP  RP
Sbjct:  333 LLLMTTVAMPVFSKKNETRSEGILLGVVGSDVPLRELLKLAPRYKLGVHGYAFLNTNNGYILSHPDLRP 401          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Mouse
Match: Cacna2d3 (calcium channel, voltage-dependent, alpha2/delta subunit 3 [Source:MGI Symbol;Acc:MGI:1338890])

HSP 1 Score: 207.223 bits (526), Expect = 7.368e-54
Identity = 156/540 (28.89%), Postives = 255/540 (47.22%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
              P+   +N+P   + +   +PT++Y           W++ L+++F    D D  L W+YF S+ GF R YPGI+W+  +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ L E FN+L  D N+     I +  +M ITDG++   D         D   RIFT++  + A+   ++  +AC+N+G+  +  TL+DV +NV+ YL V+SR   I Q    +WT       +A   S  P   AQ                                  +   ++ + L  + A  V+ +  +T   + G +LG VG D+ V E +KT P +K+G++ Y F IT+NG+++ HP+ RP Y   K   K  Y +VD+SEVE      +                LR  M+ N    +FS  +   + +D       +  +Y+   I GTP+  G+A+
Sbjct:  154 LAPNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDE------NGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIITYNEELHYVEPCLNGTLVQADRTNKEHFREHLDK-LFAKGIGMLDIALNEAFNIL-SDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWT-------EAYIDSTLP--QAQ----------------------------------KLADDQGLVLMTTVAMPVFSKQNET--RSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDV----------------LRNAMV-NRKTGKFSMEVK--KTVDKGKRVLVMTNDYYYTDIKGTPFSLGVAL 620          

HSP 2 Score: 72.7886 bits (177), Expect = 2.860e-12
Identity = 53/213 (24.88%), Postives = 94/213 (44.13%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSS 3464
            Q K +F+Q           SL  K  I  +     CY+I  +G IL +  + T  G    ++  A+M   +    +     YD QA+C    + +     L++P    +    W++ +L L +  F+L +  W  S           ++E   PC  + PA+    +   + G+++ C  C+++F I+ I ++NLF+VVV  S     C+C S
Sbjct:  821 QMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSE-DYTQTGDFFGEVEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDSAHGLLDPYKAFLSAAKWIMTELVLFLVEFNLCS--WWHSDMTAKAQKLKQTLE---PCDTEYPAFVSERTIKETTGNIA-CEDCSKSFVIQQIPSSNLFMVVVDSS-----CLCES 1021          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Mouse
Match: Cacna2d1 (calcium channel, voltage-dependent, alpha2/delta subunit 1 [Source:MGI Symbol;Acc:MGI:88295])

HSP 1 Score: 152.525 bits (384), Expect = 7.862e-37
Identity = 132/530 (24.91%), Postives = 215/530 (40.57%), Query Frame = 3
Query:  612 RTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPA---NKTNLNLCLTEV--FNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQ---NDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFN--IWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPT 2168
                HIPT +YE S       NWT  LD++F+  +D D  L W+ F S++G  R YP   W     D+    + +D YD R   +Y+Q  A PK M I+VD SGS+ G ++ +    V E+L TL+++DF N+  F  N    D +  + L+QA  +NK  L + +N          K   +    ++  +NV R + N          ++M  TDG              D   R+FT    Q   DR  I  +AC N+GY  E  ++  +  N   YL V+ R   +  +      WT V+                                              L + E   V    +P++  T      QS    N     +LG +G+D+ + +  +  P + +  N Y F I  NG+++ HP  +P+   S +     +D  + E+ + + +                +R +M+D  + ++   +LV  Q  + +I   K  R Y    ++GT Y   L +PT
Sbjct:  163 HAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPW----VDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQ--DVSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNK---------IIMLFTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVY----------------------------------------------LDALELGLVITGTLPVFNVTG-----QSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPV--TLDFLDAELENEIKV---------------EIRNKMIDGESGEKTFRTLVKSQD-ERYID--KGNRTYTWTPVNGTDYSLALVLPT 606          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Mouse
Match: Cacna2d1 (calcium channel, voltage-dependent, alpha2/delta subunit 1 [Source:MGI Symbol;Acc:MGI:88295])

HSP 1 Score: 152.525 bits (384), Expect = 8.926e-37
Identity = 132/530 (24.91%), Postives = 215/530 (40.57%), Query Frame = 3
Query:  612 RTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPA---NKTNLNLCLTEV--FNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQ---NDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFN--IWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPT 2168
                HIPT +YE S       NWT  LD++F+  +D D  L W+ F S++G  R YP   W     D+    + +D YD R   +Y+Q  A PK M I+VD SGS+ G ++ +    V E+L TL+++DF N+  F  N    D +  + L+QA  +NK  L + +N          K   +    ++  +NV R + N          ++M  TDG              D   R+FT    Q   DR  I  +AC N+GY  E  ++  +  N   YL V+ R   +  +      WT V+                                              L + E   V    +P++  T      QS    N     +LG +G+D+ + +  +  P + +  N Y F I  NG+++ HP  +P+   S +     +D  + E+ + + +                +R +M+D  + ++   +LV  Q  + +I   K  R Y    ++GT Y   L +PT
Sbjct:  163 HAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPW----VDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQ--DVSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNK---------IIMLFTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVY----------------------------------------------LDALELGLVITGTLPVFNVTG-----QSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPV--TLDFLDAELENEIKV---------------EIRNKMIDGESGEKTFRTLVKSQD-ERYID--KGNRTYTWTPVNGTDYSLALVLPT 606          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Mouse
Match: Cacna2d1 (calcium channel, voltage-dependent, alpha2/delta subunit 1 [Source:MGI Symbol;Acc:MGI:88295])

HSP 1 Score: 152.14 bits (383), Expect = 1.008e-36
Identity = 132/530 (24.91%), Postives = 215/530 (40.57%), Query Frame = 3
Query:  612 RTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPA---NKTNLNLCLTEV--FNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQ---NDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFN--IWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPT 2168
                HIPT +YE S       NWT  LD++F+  +D D  L W+ F S++G  R YP   W     D+    + +D YD R   +Y+Q  A PK M I+VD SGS+ G ++ +    V E+L TL+++DF N+  F  N    D +  + L+QA  +NK  L + +N          K   +    ++  +NV R + N          ++M  TDG              D   R+FT    Q   DR  I  +AC N+GY  E  ++  +  N   YL V+ R   +  +      WT V+                                              L + E   V    +P++  T      QS    N     +LG +G+D+ + +  +  P + +  N Y F I  NG+++ HP  +P+   S +     +D  + E+ + + +                +R +M+D  + ++   +LV  Q  + +I   K  R Y    ++GT Y   L +PT
Sbjct:  163 HAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPW----VDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQ--DVSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNK---------IIMLFTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVY----------------------------------------------LDALELGLVITGTLPVFNVTG-----QSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPV--TLDFLDAELENEIKV---------------EIRNKMIDGESGEKTFRTLVKSQD-ERYID--KGNRTYTWTPVNGTDYSLALVLPT 606          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Mouse
Match: Cacna2d1 (calcium channel, voltage-dependent, alpha2/delta subunit 1 [Source:MGI Symbol;Acc:MGI:88295])

HSP 1 Score: 150.214 bits (378), Expect = 4.526e-36
Identity = 131/530 (24.72%), Postives = 214/530 (40.38%), Query Frame = 3
Query:  612 RTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPA---NKTNLNLCLTEV--FNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQ---NDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFN--IWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPT 2168
                HIPT +YE S       NWT  LD++F+  +D D  L W+ F S++G  R YP   W     D+    + +D YD R   +Y+Q  A PK M I+VD SGS+ G ++ +    V E+L TL+++DF N+  F  N    D +  + L+QA  +NK  L + +N          K   +    ++  +NV R + N          ++M  TDG              D   R+FT    Q   DR  I  +AC N+GY  E  ++  +  N   YL V+ R   +  +      WT V+                                              L + E   V    +P++  T      QS    N     +LG +G+D+ + +  +  P + +  N Y F I  NG+++ HP  +P+   ++       D  + E+ + + +                +R +M+D  + ++   +LV  Q  + +I   K  R Y    ++GT Y   L +PT
Sbjct:  163 HAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPW----VDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQ--DVSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNK---------IIMLFTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVY----------------------------------------------LDALELGLVITGTLPVFNVTG-----QSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKEPVTL-------DFLDAELENEIKV---------------EIRNKMIDGESGEKTFRTLVKSQD-ERYID--KGNRTYTWTPVNGTDYSLALVLPT 601          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. UniProt/SwissProt
Match: sp|Q9Z1L5|CA2D3_MOUSE (Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Mus musculus OX=10090 GN=Cacna2d3 PE=1 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 5.154e-53
Identity = 156/540 (28.89%), Postives = 255/540 (47.22%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
              P+   +N+P   + +   +PT++Y           W++ L+++F    D D  L W+YF S+ GF R YPGI+W+  +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ L E FN+L  D N+     I +  +M ITDG++   D         D   RIFT++  + A+   ++  +AC+N+G+  +  TL+DV +NV+ YL V+SR   I Q    +WT       +A   S  P   AQ                                  +   ++ + L  + A  V+ +  +T   + G +LG VG D+ V E +KT P +K+G++ Y F IT+NG+++ HP+ RP Y   K   K  Y +VD+SEVE      +                LR  M+ N    +FS  +   + +D       +  +Y+   I GTP+  G+A+
Sbjct:  154 LAPNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDE------NGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIITYNEELHYVEPCLNGTLVQADRTNKEHFREHLDK-LFAKGIGMLDIALNEAFNIL-SDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWT-------EAYIDSTLP--QAQ----------------------------------KLADDQGLVLMTTVAMPVFSKQNET--RSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDV----------------LRNAMV-NRKTGKFSMEVK--KTVDKGKRVLVMTNDYYYTDIKGTPFSLGVAL 620          

HSP 2 Score: 72.7886 bits (177), Expect = 2.000e-11
Identity = 53/213 (24.88%), Postives = 94/213 (44.13%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSS 3464
            Q K +F+Q           SL  K  I  +     CY+I  +G IL +  + T  G    ++  A+M   +    +     YD QA+C    + +     L++P    +    W++ +L L +  F+L +  W  S           ++E   PC  + PA+    +   + G+++ C  C+++F I+ I ++NLF+VVV  S     C+C S
Sbjct:  821 QMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSE-DYTQTGDFFGEVEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDSAHGLLDPYKAFLSAAKWIMTELVLFLVEFNLCS--WWHSDMTAKAQKLKQTLE---PCDTEYPAFVSERTIKETTGNIA-CEDCSKSFVIQQIPSSNLFMVVVDSS-----CLCES 1021          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. UniProt/SwissProt
Match: sp|Q8CFG5|CA2D3_RAT (Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Rattus norvegicus OX=10116 GN=Cacna2d3 PE=1 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 9.801e-52
Identity = 153/540 (28.33%), Postives = 251/540 (46.48%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
              P+   +N+P   + +   +PT++Y           W++ L+++F    D D  L W+YF S+ GF R YPGI+W+  +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ L E FNVL  D N+     I +  +M ITDG++   D         +   RIFT++  + A+   ++  +AC+N+G+  +  TL+DV +NV+ YL V+SR   I Q    +WT                                               A + ST      ++ + L  + A  V+ +  +T   + G +LG VG D+ V E +KT P +K+G++ Y F IT+NG+++ HP+ RP Y   K   K  Y +VD+SEVE      +                LR  M+ N    +FS  +   + +D       +  +Y+   I G P+  G+A+
Sbjct:  154 LAPNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDE------NGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIITYNEELHYVEPCLNGTLVQADRTNKEHFREHLDK-LFAKGIGMLDIALNEAFNVL-SDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPERKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTE----------------------------------------------AYIDST---LADDQGLVLMTTVAMPVFSKQNET--RSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDV----------------LRNAMV-NRKTGKFSMEVK--KTVDKGKRVLVMTNDYYYTDIKGAPFSLGVAL 614          

HSP 2 Score: 73.1738 bits (178), Expect = 1.471e-11
Identity = 53/213 (24.88%), Postives = 94/213 (44.13%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSS 3464
            Q K +F+Q           SL  K  I  +     CY+I  +G IL +  + T  G    ++  A+M   +    +     YD QA+C    + +     L++P    +    W++ +L L +  F+L +  W  S           ++E   PC  + PA+    +   + G+++ C  C+++F I+ I ++NLF+VVV  S     C+C S
Sbjct:  815 QMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSE-DYTQTGDFFGEVEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDSAHGLLDPYKAFLSAAKWIVTELVLFLVEFNLCS--WWHSDMTAKAQKLKQTLE---PCDTEYPAFVSERTIKETTGNIA-CEDCSKSFVIQQIPSSNLFMVVVDSS-----CLCES 1015          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. UniProt/SwissProt
Match: sp|Q8IZS8|CA2D3_HUMAN (Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Homo sapiens OX=9606 GN=CACNA2D3 PE=1 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.259e-51
Identity = 154/541 (28.47%), Postives = 255/541 (47.13%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAA-AVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
              P+   +N+P   + +   +PT++Y           W++ L+++F    D D  L W+YF S+ GF R YPGI+W+  +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ L E FN+L  D N+     I +  +M ITDG++   D         D   RIFT++  + A+   ++  +AC+N+G+  +  TL+DV +NV+ YL V+SR   I Q    +WT       +A   S  P                                     + Q + +   P+ ++T A  V+ +  +T +  +  +LG VG D+ V E +KT P +K+G++ Y F IT+NG+++ HP+ R  Y   K   K  Y +VD+SEVE      +                LR  M+ N    +FS  +   + +D       +  +Y+   I GTP+  G+A+
Sbjct:  154 LAPNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDE------NGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEHFREHLDK-LFAKGIGMLDIALNEAFNIL-SDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWT-------EAYIDSTLP-------------------------------------QAQKLTDDQGPVLMTTVAMPVFSKQNETRSKGI--LLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRLLYEEGKKRRKPNYSSVDLSEVEWEDRDDV----------------LRNAMV-NRKTGKFSMEVK--KTVDKGKRVLVMTNDYYYTDIKGTPFSLGVAL 620          

HSP 2 Score: 73.9442 bits (180), Expect = 7.737e-12
Identity = 54/213 (25.35%), Postives = 96/213 (45.07%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSS 3464
            Q K +F+Q           SL  K  I  +     CY+I  +G IL +  + T  G    +I  A+M   +    +     YD QA+C    + +     L++P +  +  + W++ +L L +  F+L +  W  S           ++E   PC  + PA+    +   + G+++ C  C+++F I+ I ++NLF+VVV  S     C+C S
Sbjct:  821 QMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSE-DYTQTGDFFGEIEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCS--WWHSDMTAKAQKLKQTLE---PCDTEYPAFVSERTIKETTGNIA-CEDCSKSFVIQQIPSSNLFMVVVDSS-----CLCES 1021          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. UniProt/SwissProt
Match: sp|Q7Z3S7|CA2D4_HUMAN (Voltage-dependent calcium channel subunit alpha-2/delta-4 OS=Homo sapiens OX=9606 GN=CACNA2D4 PE=1 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 4.727e-44
Identity = 145/536 (27.05%), Postives = 245/536 (45.71%), Query Frame = 3
Query:  591 NIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLS----LVDNFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIF----YRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKV---KRNYFMAGISGTPYKFGLAI 2162
            N+P   + ++  +PT++Y    +       ++ L+ +F    + D  L W+YF S++GF RIYPGI+W   +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +    +  IL+TL ENDF NI  +   + +++      L+QA D++       L + L       ++  L E F +L++ +  + G++  N  +M I+DG++     + + +   D   R+FT++  +  S    +  IAC+N+GY  +  TL+D  +NV+ YL V+SR   I  +   IWT  +          D    S+Q                                       + + L  + A  V+  S K    + G +LG VG D+ + E +K AP +K+GV+ Y F  T+NG+++ HP  RP Y+   K+     Y +VD+SEVE            DQ        SLR  M++        T  ++  +      G +V     +YF   IS TP+  G+ +
Sbjct:  197 NLPVNTSISSVQLPTNVYNKDPDILNGVYMSEALNAVFVENFQRDPTLTWQYFGSATGFFRIYPGIKWTPDE------NGVITF-DCRNRGWYIQAATSPKDIVILVDVSGSMKGLRMTIAKHTITTILDTLGENDFINIIAYNDYVHYIEPCFKGILVQA-DRDNREHFKLLVEELMVKGVGVVDQALREAFQILKQFQEAKQGSLC-NQAIMLISDGAVEDYEPVFEKYNWPDCKVRVFTYLIGREVSFADRMKWIACNNKGYYTQISTLADTQENVMEYLHVLSRPMVINHDHDIIWTEAYM---------DSKLLSSQA--------------------------------------QSLTLLTTVAMPVF--SKKNETRSHGILLGVVGSDVALRELMKLAPRYKLGVHGYAFLNTNNGYILSHPDLRPLYREGKKLKPKPNYNSVDLSEVEWE----------DQ------AESLRTAMINRE------TGTLSMDVKVPMDKGKRVLFLTNDYFFTDISDTPFSLGVVL 652          

HSP 2 Score: 65.0846 bits (157), Expect = 4.565e-9
Identity = 45/185 (24.32%), Postives = 92/185 (49.73%), Query Frame = 3
Query: 2907 CANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENS---RPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKC 3452
            C +S + +C++I  +G IL +  +    G  L +++ A++   ++  +++    YD QA+C   S   S  + L++PIS  +    W++ +L L +  +S+    +   +  ++ F++    +     +PC  + P +   P+   +NG V  C  C + F ++ I N+NL L+V   + P C C
Sbjct:  883 CEDSDL-DCFVIDNNGFILISKRSRE-TGRFLGEVDGAVLTQLLSMGVFSQVTMYDYQAMCKPSSHHHSAAQPLVSPISAFLTATRWLLQELVLFLLEWSVWGSWYDRGAEAKSVFHHSHKHKKQDPLQPCDTEYPVFVYQPAIREANGIV-ECGPCQKVFVVQQIPNSNLLLLV---TDPTCDC 1061          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. UniProt/SwissProt
Match: sp|O08532|CA2D1_MOUSE (Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Mus musculus OX=10090 GN=Cacna2d1 PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.922e-35
Identity = 132/534 (24.72%), Postives = 219/534 (41.01%), Query Frame = 3
Query:  612 RTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPA---NKTNLNLCLTEV--FNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQ---NDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFN--IWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKN----SMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPT 2168
                HIPT +YE S       NWT  LD++F+  +D D  L W+ F S++G  R YP   W     D+    + +D YD R   +Y+Q  A PK M I+VD SGS+ G ++ +    V E+L TL+++DF N+  F  N    D +  + L+QA  +NK  L + +N          K   +    ++  +NV R + N          ++M  TDG              D   R+FT    Q   DR  I  +AC N+GY  E  ++  +  N   YL V+ R   +  +      WT V+                                              L + E   V    +P++  T      QS    N     +LG +G+D+ + +  +  P + +  N Y F I  NG+++ HP  +P+       ++ +  R  ++   +    +T+  +  D  ++      +R +M+D  + ++   +LV  Q  + +I   K  R Y    ++GT Y   L +PT
Sbjct:  163 HAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPW----VDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQ--DVSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNK---------IIMLFTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVY----------------------------------------------LDALELGLVITGTLPVFNVTG-----QSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKPIGVGIPTINLRKRRPNVQNPKSQEPVTLDFL--DAELENEIKVEIRNKMIDGESGEKTFRTLVKSQD-ERYID--KGNRTYTWTPVNGTDYSLALVLPT 625          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. TrEMBL
Match: A0A4Z2DHK5 (Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Schistosoma japonicum OX=6182 GN=EWB00_000886 PE=4 SV=1)

HSP 1 Score: 464.151 bits (1193), Expect = 2.793e-137
Identity = 313/1027 (30.48%), Postives = 529/1027 (51.51%), Query Frame = 3
Query:  210 QANIDSLVTTIETAFSGLSNFLNADLLSANF--VNLSATSVNDSVAINILSNSKSDTEQLITKANGVINQIQSNLTSKYSHYESPILYPNCSVKVITYFQTKSITNFT-YEKIDDCTFQ-TLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRV-TKDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN---DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTG--VHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI---PTNQM---VPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLS------ENQSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITXXXXXXXXXXXXXGKN----FSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQGXXXXXXXXXXXXVFMNVNNWNSLVFTVSTPLXXXXXXXXXXXXQAKFDFYQS--LLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALC-NILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNF 3203
            + N D  V  +  +FS L        L + +   N  +  +N++VA   L  +    + ++ + + +++ I+          E   +  + +     Y++ K++T      + D+C+ +  +P    P  DN   C N +  H+PT++Y+ S + +   NWT +LD++F++  + D  LKW+YF SS+GF R YPG  W+IQ     ++   +DF+DCR + +YLQ++AYPK+M I++D+SGSM+GRS I++     EILNTLTEND+FN+ +F  N  + D  +T  L+QAT  NK  ++    +   P    +    +TEVF +  K   N   N   N +VM ITD +    ++  +      + R+FT++  Q +S    + ++AC NRGY+V   TL+DV +NVL YL V++R NA+  + + +WTG  VHQ   K  +  +F       T +S S +               +  ++ S E     E P  +Y S A AVYD++ K      GN+LG  G+D+ +  F  T   WKIGVN YLF + +NGF++FHP +RP YK  +K +Y+NVDI+EVE+   + I   +G     P    +LR  M++    ++ S  +    ++D++ T F+VK+ +F++ I  TP+  GLAI   PT      +P Y  N+  +L     +NL   +F+ F  + G  N        ++Q G  I  YEFC    ++A+L +   LC    + +NS+L+++   +      YL+ +Y +   +   +  W   +  +    +++QQ FS  H GLIR+YN+    Y +FI +H  G++DSLY ET+ T++Y   + +LV  + PN          +   V +  + +      V TP+   G+ I    +Q +F+   +     +  +C +    +CYII  + ++L +N+     G +LK+INCA++E  VN+++ N  Y YD Q +C   + +  + G  L  P+  ++  +IW I +  L +  F
Sbjct:   31 KQNFDRWVIELSQSFSELQTVSAEPYLKSIYKTANFESKEINETVATGYLQTAIEKIQNIVNEKSKLVDNIKIAA-------EEAFVNRDGNEPTGCYYRAKALTIVPPLNETDNCSVKFYIPLKQSPQHDNQYVCYNFSVAHVPTNVYDLSDKLKRIGNWTTELDKVFKLNAQSDPTLKWQYFGSSTGFFRYYPGAMWEIQ-----LDEYRLDFFDCRSQPWYLQASAYPKEMIILIDKSGSMKGRSDIISNATAAEILNTLTENDYFNVMMFSDNTMYADPLITDRLVQATKYNKDKMIKTFRK-FTPNGTASYENAITEVFRLFNKVDENFHTNHKCNRMVMIITDSAPGSYEHLFKEFNPQKNVRVFTYLLGQHSSAEEYVQELACLNRGYAVNIATLADVKENVLKYLDVIARSNALQDDAYFVWTGATVHQFNFKKLKRENFTNPYLMNTHSSRSFMNGFMQNMLLEPDPVRIDTMIASKE-----ELP-KMYTSVAKAVYDKTNKAKRLKEGNLLGVAGVDVPLQSFQDTLRGWKIGVNNYLFAVDNNGFVLFHPNYRPVYKALLKSYYQNVDINEVEVMKEVKIDPWSG----TPEYNTTLRNAMINR---ERTSVDMDVNMVVDNYHTTFEVKKKFFISPIDQTPFTLGLAIQWDPTTNKGYPIPEYRFNSQELL-----RNLHVNDFSCFAPKYGEQNTDCNSHGNDSQIGSTIIPYEFCQFNKDLASLYLKDRLCAFRQILLNSSLISRLKCDEE----YLSRIYLDAKMTCDLSNYWFKQSKSHLITKWNIQQAFSFHHSGLIRFYNFTTPAYPHFITDHIGGVEDSLYSETVQTSRYLSEDNVLVFHTPPNDLFRHFSSEKLDVPVTLTTSVFRE---PVKTPMGIIGLQITHSAIQNEFNRITNTCFTGECHVCGSPGF-DCYIINQAAMVLVSNVGEKEVGQNLKEINCALVEDLVNHSVLNETYLYDFQGICIETVQETPNAGNHLYPPLQFVLKIIIWFINETVLFVFGF 1018          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. TrEMBL
Match: A0A5K4EMS9 (Putative dihydropyridine-sensitive l-type calcium channel OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 1.176e-134
Identity = 320/1052 (30.42%), Postives = 524/1052 (49.81%), Query Frame = 3
Query:  210 QANIDSLVTTIETAFSGLSNFLNADLLSANF--VNLSATSVNDSVAINILSNSKSDTEQLITKANGVINQIQSNLTSKYSHYESPILYPNCSVKVITYFQTKSITNFT-YEKIDDCTFQ-TLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRV-TKDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN---DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGV--HQIQIKASETSDF--PGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQ------MVPVYANNTFTVLTLSVFQNLFGINFATF-----NQQCGVINLSEN-QSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITXXXXXXXXXXXXXGKN----FSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQGXXXXXXXXXXXXVFMNVNNWNSLVFTVSTPLXXXXXXXXXXXXQAKFDFYQS--LLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPT-SFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTL--------MWGFSSFEEN 3248
            + N D  VT +  +FS L        L + +   N  A  +N+++A   L  +    E ++ + + ++  I+          E   +    +  +  Y++ K++T      + D+C+ +  +P    P  DN   C N +  H+PT++Y+ S + +   NWT +LD++F++  + D  LKW+YF SS+GF R YPG  W IQ     ++   +DF+DCR + +YLQ++AYPK+M I++D+SGSM+GRS I++     EILNTLTEND+FN+ +F  +  + D  +T  LIQ T  NK  ++    +   P    +    +TEVF +  K   N   N   N ++M ITD +    ++  +      + R+FT++  Q +S    + ++AC NRGY+V   TL+DV +NVL YL V++R NA+  + +  WTGV   Q  +K  +  +F  P      + +  +             +  T+ A          +E+   +Y S A AV+D++ K      GN+LG  G+DI +  F  T   WKIG N YLF + +NGF++FHP +RP YK  +K +Y+NVDI+EVE+  ++ I   +G     P    +LR  M++    ++ S  + T  ++D++ T F+  + YF+A I  TP+  GLAI  +        +P Y  N     +  +F NL   +F+ F     +QQ    + + N Q G+ I  YEFC    ++A++ +   LC L  V +N +++ K   +      YL  +Y +   +      W   +  +    + +QQ FS  H GLIR+YN+    Y NFI +H  G++DSLY  TILT++Y   + +LV  + PN          +   V +    ++       TP+   G+ I    +Q +F+   +     K  +C      +CYII  + +IL +N+     G SLK+INCA++E  V ++I N  Y YD Q +C   SQ T +FG  L  P   +   +IW + ++ L +  F    L         WG  S  E+
Sbjct:   30 KQNFDRWVTELSKSFSELHTITGEPYLKSIYKTANFGAEEINETIATKYLDIAVKKLENIVNEKSKLVENIKVAA-------EEAFVKRAENEPIGCYYRAKALTIVPPLNETDNCSIKFYIPLKQSPHHDNQYVCYNFSVVHVPTNVYDLSDKLKRIGNWTTELDKVFKLNAESDPTLKWQYFGSSTGFFRYYPGAMWDIQ-----LDEYRLDFFDCRSQPWYLQASAYPKEMIILIDKSGSMKGRSDIISNATAAEILNTLTENDYFNVMMFSDSTMYADPLITDRLIQGTKFNKDKMIKTFRK-FSPNGTASYENAITEVFKLFNKTDENFPSNHKCNRMIMIITDSAPGSYEHLFKEFNPQKNVRVFTYLLGQHSSAEEYVQELACLNRGYAVNIATLADVKENVLKYLDVIARSNALQDDAYFTWTGVTVRQFNLKKLKPENFSNPYILNIPSRSFMNGFMQNMLMEPEPVRIDTMIA---------SKEELPKMYTSVAKAVFDKTNKAKRLKEGNLLGVAGVDIPLQSFQDTLRGWKIGANNYLFAVDNNGFVLFHPDYRPVYKALLKSYYQNVDINEVEVMRDVKIDPWSG----TPDYNTTLRNAMINR---EKTSLDMDTNIVVDNYHTMFEASKKYFIAPIDQTPFTLGLAIQWDSNTQKGYPIPEYRFN-----SKELFNNLHVNDFSCFAPKYGDQQVNCDSHNNNSQIGVTIIPYEFCQFNNDLASIYLNDRLCALRQVLLNLSMINKLKCDEE----YLGRIYLDAKETRDLPAYWYKQSKSSSITKWKIQQAFSFHHSGLIRFYNFTVPAYPNFITDHIGGVEDSLYSATILTSRYLSEDNVLVFHTPPNDLFRHFSSEKLNVPVTLTTTVFHE---PSKTPMGIVGLQITHTQIQNEFNRITNTCFTGKCHVCGEPGF-DCYIINQAAMILASNVGEKEVGQSLKEINCALVEDLVKHSILNEIYLYDFQGICIETSQETPNFGNHLYPPFRIVWKIIIWFVNEITLFMFGFVEDLLSYRITFGQKWGLYSETED 1039          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. TrEMBL
Match: A0A3Q0KM99 (Putative dihydropyridine-sensitive l-type calcium channel OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 2.803e-134
Identity = 320/1052 (30.42%), Postives = 524/1052 (49.81%), Query Frame = 3
Query:  210 QANIDSLVTTIETAFSGLSNFLNADLLSANF--VNLSATSVNDSVAINILSNSKSDTEQLITKANGVINQIQSNLTSKYSHYESPILYPNCSVKVITYFQTKSITNFT-YEKIDDCTFQ-TLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRV-TKDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN---DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGV--HQIQIKASETSDF--PGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQ------MVPVYANNTFTVLTLSVFQNLFGINFATF-----NQQCGVINLSEN-QSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITXXXXXXXXXXXXXGKN----FSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQGXXXXXXXXXXXXVFMNVNNWNSLVFTVSTPLXXXXXXXXXXXXQAKFDFYQS--LLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPT-SFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTL--------MWGFSSFEEN 3248
            + N D  VT +  +FS L        L + +   N  A  +N+++A   L  +    E ++ + + ++  I+          E   +    +  +  Y++ K++T      + D+C+ +  +P    P  DN   C N +  H+PT++Y+ S + +   NWT +LD++F++  + D  LKW+YF SS+GF R YPG  W IQ     ++   +DF+DCR + +YLQ++AYPK+M I++D+SGSM+GRS I++     EILNTLTEND+FN+ +F  +  + D  +T  LIQ T  NK  ++    +   P    +    +TEVF +  K   N   N   N ++M ITD +    ++  +      + R+FT++  Q +S    + ++AC NRGY+V   TL+DV +NVL YL V++R NA+  + +  WTGV   Q  +K  +  +F  P      + +  +             +  T+ A          +E+   +Y S A AV+D++ K      GN+LG  G+DI +  F  T   WKIG N YLF + +NGF++FHP +RP YK  +K +Y+NVDI+EVE+  ++ I   +G     P    +LR  M++    ++ S  + T  ++D++ T F+  + YF+A I  TP+  GLAI  +        +P Y  N     +  +F NL   +F+ F     +QQ    + + N Q G+ I  YEFC    ++A++ +   LC L  V +N +++ K   +      YL  +Y +   +      W   +  +    + +QQ FS  H GLIR+YN+    Y NFI +H  G++DSLY  TILT++Y   + +LV  + PN          +   V +    ++       TP+   G+ I    +Q +F+   +     K  +C      +CYII  + +IL +N+     G SLK+INCA++E  V ++I N  Y YD Q +C   SQ T +FG  L  P   +   +IW + ++ L +  F    L         WG  S  E+
Sbjct:   30 KQNFDRWVTELSKSFSELHTITGEPYLKSIYKTANFGAEEINETIATKYLDIAVKKLENIVNEKSKLVENIKVAA-------EEAFVKRAENEPIGCYYRAKALTIVPPLNETDNCSIKFYIPLKQSPHHDNQYVCYNFSVVHVPTNVYDLSDKLKRIGNWTTELDKVFKLNAESDPTLKWQYFGSSTGFFRYYPGAMWDIQ-----LDEYRLDFFDCRSQPWYLQASAYPKEMIILIDKSGSMKGRSDIISNATAAEILNTLTENDYFNVMMFSDSTMYADPLITDRLIQGTKFNKDKMIKTFRK-FSPNGTASYENAITEVFKLFNKTDENFPSNHKCNRMIMIITDSAPGSYEHLFKEFNPQKNVRVFTYLLGQHSSAEEYVQELACLNRGYAVNIATLADVKENVLKYLDVIARSNALQDDAYFTWTGVTVRQFNLKKLKPENFSNPYILNIPSRSFMNGFMQNMLMEPEPVRIDTMIA---------SKEELPKMYTSVAKAVFDKTNKAKRLKEGNLLGVAGVDIPLQSFQDTLRGWKIGANNYLFAVDNNGFVLFHPDYRPVYKALLKSYYQNVDINEVEVMRDVKIDPWSG----TPDYNTTLRNAMINR---EKTSLDMDTNIVVDNYHTMFEASKKYFIAPIDQTPFTLGLAIQWDSNTQKGYPIPEYRFN-----SKELFNNLHVNDFSCFAPKYGDQQVNCDSHNNNSQIGVTIIPYEFCQFNNDLASIYLNDRLCALRQVLLNLSMINKLKCDEE----YLGRIYLDAKETRDLPAYWYKQSKSSSITKWKIQQAFSFHHSGLIRFYNFTVPAYPNFITDHIGGVEDSLYSATILTSRYLSEDNVLVFHTPPNDLFRHFSSEKLNVPVTLTTTVFHE---PSKTPMGIVGLQITHTQIQNEFNRITNTCFTGKCHVCGEPGF-DCYIINQAAMILASNVGEKEVGQSLKEINCALVEDLVKHSILNEIYLYDFQGICIETSQETPNFGNHLYPPFRIVWKIIIWFVNEITLFMFGFVEDLLSYRITFGQKWGLYSETED 1039          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. TrEMBL
Match: A0A158QTC3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2553 PE=4 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 1.390e-117
Identity = 286/1019 (28.07%), Postives = 491/1019 (48.18%), Query Frame = 3
Query:  249 AFSGLSNFLNADLLSANFVNLS--ATSVNDSVAINILSNSKSDTEQLITKANGVINQIQSNLTSKYSHYESPILYPNCSVKVITYFQTKSITNFTYEKIDDCT-------FQTLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN---DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEF-QFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIP----TNQMVPVYANNTFTVLTLSVFQNLFGINFA-------TFNQQCGVINLSENQS-GIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLT--KCTFNNSDKLAYLNNVYTEITXXXXXXXXXXXXXGKNFSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQGXXXXXXXXXXXXVFMNVNNWNSLVFTVSTPLXXXXXXXXXXXXQAK-FDFYQSLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALC-NILSQPTSFGKRLINPIS---ELIGHLI----------WVIG 3176
            + S L   +  + L+  + N S     + DS A  +L  +  +  Q+I K    + +++ N+  +Y   + P+ Y  C      Y + K+++ F Y   ++ T        Q LP   D    +    RN +  HIPT++Y+ S E +   NWT  LD +F+   + D  LKW+YFCSS+G+ + YPG  WK+Q  D  +     DF+DCR   +Y+ + +YP +M I+ D+SGSM+GR   +    + E+LNTLT++DFFN+  F  ++ F +  VT  LIQAT  NK  ++      + P   +N    LT  F++L   +N  TG    N ++M ITDG     ++  +    +   R+FT +  Q ++D   + KI C+NRG       L+DV +NVL YL +V+R NA++ + F  W+GV ++QI   E +    F+        + +           +  +  A  ++    +F + K    +++ + A YD++  T+ +N+G +LG  GLDI + +       WK G  +Y FG+ +NGF++FHP +RP +   +K +YRNVDI E+E S   T+       T  P   ++LR+ ++D       ST   T +  + F++G  + +  + A +  TP+ FGLA+     TN+ VP+   +T        F    G+  A        F       ++ E    G  +    FC    ++  + +  PLC L NV ++  L    +C  ++  ++A  +   T+I +      S  +   + F +QQ+FS+   GL+RYYN+    Y  F+   + G + +LY+  +L + +++N ++LV    P Q  +          V M V +  S   + + P+   G  I     Q + FD   +      +  N S  +C++ T +G I+ +         ++K+I+CA+ME+ V+  I   Q  YD  A+C + ++   +FG RL +PI+    LIG  +          W++G
Sbjct:   27 SISSLREVIGTEQLNKMYKNSSFGVQEMTDSYARGLLDEAIVELTQIIRKKEKALEKLRDNIEEEYKK-QDPLEYDEC------YIRAKAVSLFPYPTDENGTNAVPCNESQYLPMEADSMFGHYYVSRNISAAHIPTNVYDLSKEIRTVGNWTHHLDDVFKENIQQDPLLKWQYFCSSTGYFKFYPGAMWKVQLVDLKL-----DFFDCRSTAWYVGAASYPIEMIILADKSGSMKGRRNTICNATISELLNTLTDDDFFNVIYFSESIKFAEEYVTDRLIQATTPNKDRIVRGFADHM-PNGTSNFRAALTAAFSLLNISRNG-TGINRCNKMIMLITDGIPDSFEDLFKEYNPEKSVRVFTFLIGQHSADENIVRKITCANRGMDANIANLADVKENVLKYLDIVARSNAVLDDSFVRWSGVTELQINLMELTP-ENFTRPPEDALNATLPENRTVVEEGIQEDSPEASEETPPLVKFHKPKNSQFFITLSRAAYDKTNATVENNLGILLGVTGLDIPMEDLEDVLRSWKTGPLSYFFGLNNNGFVLFHPNYRPLHGTQLKRYYRNVDIDELEQSLGSTL----NPHTALPVYNSTLRKLLIDRATA---STVETTLETPEDFLSGLPLTKKIYTAPLPETPFVFGLAVRWMPNTNRGVPIPKYDT------GGFWRQGGVRAADTRVLNPQFMDPARSCDVDETLPYGAKLAPVRFCKFRRQLLDVFIDQPLCALRNVAIDKQLREENECDLDHIARIALDSRATTKIYDYWRRMGSHQTT--RRFGIQQVFSLHQSGLLRYYNFSQPTYNEFLDEINMGSESALYKSAVLHSTFYENMKMLVFRPPPKQ--IFRNFLEENVSVPMAVVSVISNPASEAVPMGIAGAQINYRKFQEEFFDLVNTCSEAGCLKCNDSGVQCFLTTTAGQIILSTAGEKAVSQNVKEIDCALMEALVDAGIIREQEVYDFHAICIDAVTPDMNFGSRLFSPIAFLFTLIGRAMKEFITAVSTWWLLG 1013          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. TrEMBL
Match: A0A4S2LRU9 (VWFA domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005587 PE=4 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 2.934e-111
Identity = 242/737 (32.84%), Postives = 384/737 (52.10%), Query Frame = 3
Query:  609 NRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRV-TKDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNF------MQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGV--HQIQIKASETSDFP-GFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQIL-DSFITGFKVKRNYFMAGISGTPYKFGLAIPTN------QMVPVY------ANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTK--CTFN-------NSDKLAYLNNVYTEITXXXXXXXXXXXXXGKNFSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPN 2723
            N +  H+PT++Y+ S       NWT  LD +FR     D  LKW+YF SS+GF + YPG  W++Q     ++   +DF+DCR + +YL +++Y K+M I+VD+SGSM+GRS I++   V EILNTLTENDFFNI +F     + D  +   LIQA   NK  ++ +  Q  +P    +    LTE F+++ K + NQT +   + ++M ITD   S+ D++      +  D + RIF ++  Q +     + ++AC NRGY+V   TL+DV +NVL YL VV+R NAI+ + F  W+GV   Q  +K     +F   F        +     +   S    + P +  ++   E     E+P+ +Y S A AVYD++ K +    GN+LG  G+D+ +  F      W+ GVN YLF + +NGF++FHP +RP YK+++K  Y+NVD++EVE+  ++ I    G     P     LR+ M++    ++  T+ +  QI+ D+F T F+  R YF   +  TP+  GLA+  N        +P +      AN       +  F  ++  +  +    C  I+   +Q G  +  Y+FC     +A L    P+C L  + ++  L  +  C  +       ++ +   L   +T++ +S              + VQQ FS  H GLIR++N+ +  Y NFIK+H  G++D LY ET+LT QYF   ++ V    PN
Sbjct:  128 NYSVAHVPTNVYDLSKTIVSVGNWTGALDAVFRENAASDPTLKWQYFGSSTGFFQFYPGSMWEVQ-----LDELRLDFFDCRSQPWYLSASSYAKEMLILVDKSGSMKGRSDIISNATVTEILNTLTENDFFNIIMFTDTPRYADPAIQDRLIQAFKYNKDRMVRRF-QNFNPNGTAHYERALTEAFSLMNKTRENQTNSKHCSQMLMIITD---SVPDSYKELLEKLDPDKNVRIFVYLLGQHSYAEPYVEELACLNRGYAVTIATLADVKENVLKYLNVVARSNAILNHGFITWSGVTVQQFNLKRLTPDNFTMQFITPAYKLRSMHSEPSDSASDIKLEEPKIDTMIALKE-----EEPV-MYTSVAEAVYDRTKKAMRLKQGNLLGVAGIDVPLQSFRDALRGWQAGVNNYLFAVDNNGFVLFHPGYRPVYKSTLKSHYQNVDLNEVEVPQDVKIDPNTG----TPDYATPLRETMIE----RERKTNELPAQIVTDNFHTTFQATRKYFSTPLEQTPFTLGLAVQWNAETGRGDPIPEFVGARAMANEEVKRSDMDRFAPIYAEDTGS---DCSAIHNHSHQ-GATLSPYQFCQFDQALAALWQADPICALRRILLDGELQQRMMCDMDYLLQIRLDAKETQPLQKFWTQVHSSPLI---------SKWGVQQAFSFHHSGLIRFHNFSSPVYPNFIKDHIFGVEDPLYAETVLTNQYFHAQKLTVFHPPPN 828          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Cavefish
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:NCBI gene;Acc:103032408])

HSP 1 Score: 195.282 bits (495), Expect = 1.864e-50
Identity = 152/539 (28.20%), Postives = 248/539 (46.01%), Query Frame = 3
Query:  573 PDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTG-NIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
            P+   +N+    + +   +PT++Y           W++ L+++F    + D  L W+YF S+ GF R YPGI+W   +      + ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ LTE F +L     NQTG   + +  +M +TDG++   D         D   RIF ++  + ++   ++  +AC+N+GY  +  TL+DV +NV+ YL V+SR   I Q    +WT  + I     E +  PG                                               L  + A  V+  S K    N G +LG VG D+ V+E +KT P +K+G++ Y F IT+NG+++ HP  RP Y   K   K  Y +VD+SEVE      +                LR  M++    K  + S+   + +D       +  +Y+   I GTP+  G+A+
Sbjct:   71 PNDHFNNLSVNLSLSVVQVPTNMYNKDSAIVNGVYWSEALNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGIKWTPDE------HGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADVTNKDHFREHLDK-LFAKGIGMLDVALTEAFELLT--DFNQTGRGSVCSQAIMLVTDGAVDTYDTVFAKYNWPDRKVRIFPYLIGRESAFADNLKWMACANKGYFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAY-IDNTQMEDNQGPG-----------------------------------------------LMTTVAMPVF--STKNETKNKGILLGVVGTDVPVSELLKTIPKYKLGIHGYAFAITNNGYILTHPDLRPLYEEGKKRRKPNYSSVDLSEVEWEDKDDV----------------LRNAMVNR---KTGTFSMEVKKTVDKGKRVLVLHNDYYYTDIRGTPFSLGVAL 530          

HSP 2 Score: 71.2478 bits (173), Expect = 5.243e-12
Identity = 56/220 (25.45%), Postives = 99/220 (45.00%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSR----PCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFG 3473
            Q K +F+Q           +L  K  I  ++    CY+I  +G IL    + +  G+   +   A+M   +    +     YD QA+C I ++ +    RL++P       + W++ +L + +  F+L    W +S F       V +  N R    PC  + PA+    +   + G++ +C  C ++F I+ I ++NLF+VVV     + KC C   FG
Sbjct:  730 QMKLEFFQRKFWTASRQCPALDGKCSISCDNDDINCYLIDNNGFILVAE-DSSLTGVFFGEAEGAVMSRLLAMGSFKRVTLYDYQAICRIYAESSDGSSRLLDPYFAFYATVKWLLTELVIFLLEFNLYG--WWYSDF------TVKAHRNGRTMLVPCDTEYPAFISERTIKETTGNI-DCDDCIKSFVIQQIPSSNLFMVVV-----DNKCECRD-FG 933          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Cavefish
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:NCBI gene;Acc:103032408])

HSP 1 Score: 195.667 bits (496), Expect = 1.967e-50
Identity = 152/539 (28.20%), Postives = 248/539 (46.01%), Query Frame = 3
Query:  573 PDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTG-NIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
            P+   +N+    + +   +PT++Y           W++ L+++F    + D  L W+YF S+ GF R YPGI+W   +      + ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ LTE F +L     NQTG   + +  +M +TDG++   D         D   RIF ++  + ++   ++  +AC+N+GY  +  TL+DV +NV+ YL V+SR   I Q    +WT  + I     E +  PG                                               L  + A  V+  S K    N G +LG VG D+ V+E +KT P +K+G++ Y F IT+NG+++ HP  RP Y   K   K  Y +VD+SEVE      +                LR  M++    K  + S+   + +D       +  +Y+   I GTP+  G+A+
Sbjct:  104 PNDHFNNLSVNLSLSVVQVPTNMYNKDSAIVNGVYWSEALNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGIKWTPDE------HGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADVTNKDHFREHLDK-LFAKGIGMLDVALTEAFELLT--DFNQTGRGSVCSQAIMLVTDGAVDTYDTVFAKYNWPDRKVRIFPYLIGRESAFADNLKWMACANKGYFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAY-IDNTQMEDNQGPG-----------------------------------------------LMTTVAMPVF--STKNETKNKGILLGVVGTDVPVSELLKTIPKYKLGIHGYAFAITNNGYILTHPDLRPLYEEGKKRRKPNYSSVDLSEVEWEDKDDV----------------LRNAMVNR---KTGTFSMEVKKTVDKGKRVLVLHNDYYYTDIRGTPFSLGVAL 563          

HSP 2 Score: 72.0182 bits (175), Expect = 3.360e-12
Identity = 56/220 (25.45%), Postives = 99/220 (45.00%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSR----PCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFG 3473
            Q K +F+Q           +L  K  I  ++    CY+I  +G IL    + +  G+   +   A+M   +    +     YD QA+C I ++ +    RL++P       + W++ +L + +  F+L    W +S F       V +  N R    PC  + PA+    +   + G++ +C  C ++F I+ I ++NLF+VVV     + KC C   FG
Sbjct:  763 QMKLEFFQRKFWTASRQCPALDGKCSISCDNDDINCYLIDNNGFILVAE-DSSLTGVFFGEAEGAVMSRLLAMGSFKRVTLYDYQAICRIYAESSDGSSRLLDPYFAFYATVKWLLTELVIFLLEFNLYG--WWYSDF------TVKAHRNGRTMLVPCDTEYPAFISERTIKETTGNI-DCDDCIKSFVIQQIPSSNLFMVVV-----DNKCECRD-FG 966          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Cavefish
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:NCBI gene;Acc:103032408])

HSP 1 Score: 195.282 bits (495), Expect = 3.079e-50
Identity = 152/539 (28.20%), Postives = 248/539 (46.01%), Query Frame = 3
Query:  573 PDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTG-NIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
            P+   +N+    + +   +PT++Y           W++ L+++F    + D  L W+YF S+ GF R YPGI+W   +      + ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ LTE F +L     NQTG   + +  +M +TDG++   D         D   RIF ++  + ++   ++  +AC+N+GY  +  TL+DV +NV+ YL V+SR   I Q    +WT  + I     E +  PG                                               L  + A  V+  S K    N G +LG VG D+ V+E +KT P +K+G++ Y F IT+NG+++ HP  RP Y   K   K  Y +VD+SEVE      +                LR  M++    K  + S+   + +D       +  +Y+   I GTP+  G+A+
Sbjct:  156 PNDHFNNLSVNLSLSVVQVPTNMYNKDSAIVNGVYWSEALNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGIKWTPDE------HGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADVTNKDHFREHLDK-LFAKGIGMLDVALTEAFELLT--DFNQTGRGSVCSQAIMLVTDGAVDTYDTVFAKYNWPDRKVRIFPYLIGRESAFADNLKWMACANKGYFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAY-IDNTQMEDNQGPG-----------------------------------------------LMTTVAMPVF--STKNETKNKGILLGVVGTDVPVSELLKTIPKYKLGIHGYAFAITNNGYILTHPDLRPLYEEGKKRRKPNYSSVDLSEVEWEDKDDV----------------LRNAMVNR---KTGTFSMEVKKTVDKGKRVLVLHNDYYYTDIRGTPFSLGVAL 615          

HSP 2 Score: 72.0182 bits (175), Expect = 3.890e-12
Identity = 56/220 (25.45%), Postives = 99/220 (45.00%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSR----PCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFG 3473
            Q K +F+Q           +L  K  I  ++    CY+I  +G IL    + +  G+   +   A+M   +    +     YD QA+C I ++ +    RL++P       + W++ +L + +  F+L    W +S F       V +  N R    PC  + PA+    +   + G++ +C  C ++F I+ I ++NLF+VVV     + KC C   FG
Sbjct:  815 QMKLEFFQRKFWTASRQCPALDGKCSISCDNDDINCYLIDNNGFILVAE-DSSLTGVFFGEAEGAVMSRLLAMGSFKRVTLYDYQAICRIYAESSDGSSRLLDPYFAFYATVKWLLTELVIFLLEFNLYG--WWYSDF------TVKAHRNGRTMLVPCDTEYPAFISERTIKETTGNI-DCDDCIKSFVIQQIPSSNLFMVVV-----DNKCECRD-FG 1018          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Cavefish
Match: CACNA2D3 (calcium voltage-gated channel auxiliary subunit alpha2delta 3 [Source:NCBI gene;Acc:103032408])

HSP 1 Score: 194.897 bits (494), Expect = 3.735e-50
Identity = 154/545 (28.26%), Postives = 250/545 (45.87%), Query Frame = 3
Query:  573 PDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTG-NIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVH------QIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
            P+   +N+    + +   +PT++Y           W++ L+++F    + D  L W+YF S+ GF R YPGI+W   +      + ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L++ LTE F +L     NQTG   + +  +M +TDG++   D         D   RIF ++  + ++   ++  +AC+N+GY  +  TL+DV +NV+ YL V+SR   I Q    +WT  +      Q Q K  E +  PG                                               L  + A  V+  S K    N G +LG VG D+ V+E +KT P +K+G++ Y F IT+NG+++ HP  RP Y   K   K  Y +VD+SEVE      +                LR  M++    K  + S+   + +D       +  +Y+   I GTP+  G+A+
Sbjct:  156 PNDHFNNLSVNLSLSVVQVPTNMYNKDSAIVNGVYWSEALNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGIKWTPDE------HGVIAF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADVTNKDHFREHLDK-LFAKGIGMLDVALTEAFELLT--DFNQTGRGSVCSQAIMLVTDGAVDTYDTVFAKYNWPDRKVRIFPYLIGRESAFADNLKWMACANKGYFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDNTLPQAQ-KQMEDNQGPG-----------------------------------------------LMTTVAMPVF--STKNETKNKGILLGVVGTDVPVSELLKTIPKYKLGIHGYAFAITNNGYILTHPDLRPLYEEGKKRRKPNYSSVDLSEVEWEDKDDV----------------LRNAMVNR---KTGTFSMEVKKTVDKGKRVLVLHNDYYYTDIRGTPFSLGVAL 621          

HSP 2 Score: 72.0182 bits (175), Expect = 4.033e-12
Identity = 56/220 (25.45%), Postives = 99/220 (45.00%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSR----PCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFG 3473
            Q K +F+Q           +L  K  I  ++    CY+I  +G IL    + +  G+   +   A+M   +    +     YD QA+C I ++ +    RL++P       + W++ +L + +  F+L    W +S F       V +  N R    PC  + PA+    +   + G++ +C  C ++F I+ I ++NLF+VVV     + KC C   FG
Sbjct:  821 QMKLEFFQRKFWTASRQCPALDGKCSISCDNDDINCYLIDNNGFILVAE-DSSLTGVFFGEAEGAVMSRLLAMGSFKRVTLYDYQAICRIYAESSDGSSRLLDPYFAFYATVKWLLTELVIFLLEFNLYG--WWYSDF------TVKAHRNGRTMLVPCDTEYPAFISERTIKETTGNI-DCDDCIKSFVIQQIPSSNLFMVVV-----DNKCECRD-FG 1024          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Cavefish
Match: cacna2d3 (calcium channel, voltage dependent, alpha2/delta subunit 3 [Source:ZFIN;Acc:ZDB-GENE-030616-133])

HSP 1 Score: 192.2 bits (487), Expect = 2.445e-49
Identity = 143/542 (26.38%), Postives = 250/542 (46.13%), Query Frame = 3
Query:  573 PDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNL---CLTEVFNVLRKDKNNQTG-NIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSM---KIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
            P+   +N+    + +   +PT++Y    +      W++ L+++F    + D  L W+YF S+ GF R YPG++W   +      + ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   + +V+  +   L+QA   NK    +   + LD      + L    LTE F +L  ++ NQ G   + +  +M +TDG+  + D+        +   RIF ++  + ++   ++  +AC+N+GY  +  TL+DV +NV+ YL V+SR   I      +WT  +                                          V + L+S      +  P P+  + A  V+    +T+  ++G +LG  G DI + E +KT P  K+G++ Y F IT+NG+++ HP  RP Y+      K  Y +VD+SEVE                       LR  M++    K  + S+   + +D       +  +Y+   I GTP+  G+A+
Sbjct:  117 PNDHFNNLSVNLSLSVVQVPTNMYNKDPDIVNGVYWSEALNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGVKWHPDE------HGVISF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIARQTVSSILDTLGDDDFFNIIAYNQEIHYVEPCLNGTLVQADRTNK----DHFREHLDKLFAKGIGLLGEALTEAFTIL--NEFNQAGRGSVCSRAIMLVTDGATEMYDDVFAKYNWPERKVRIFPYLIGRESAFADNLKWMACANKGYFSQISTLADVQENVMRYLHVMSRPKVIDHEHDTVWTEAY------------------------------------------VDSALKS------KRGPNPM-TTVAMPVFSTKNETV--SLGILLGVAGTDIPIQELMKTVPKHKLGIHGYAFAITNNGYILMHPDLRPLYQEGQKRRKAHYSSVDLSEVEWEDTDDF----------------LRTAMVNR---KTGTFSMEVKRTVDKGKRVLSMHNDYYFTDIKGTPFSVGVAL 575          

HSP 2 Score: 51.9878 bits (123), Expect = 5.142e-6
Identity = 57/213 (26.76%), Postives = 92/213 (43.19%), Query Frame = 3
Query: 2859 QAKFDFYQSLLNKSLICANSSVTECYIITASGVILFNNINLTF---NGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGH-LIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSR------PCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSA 3467
            Q K DF+Q    +    A+  V+     TA    L     ++F    GL   +   A+M   +    +     YD QALC   +  +     L++ +S L  H +I  +   FLL   F+L +            ++NV S  N++      PC  + PA+ V+   ++      +C GC + F I+ I ++NLF+VVV       KC CSS+
Sbjct:  767 QMKLDFFQ----RKFWTASRQVS-----TAKNTYLLRLNFISFCKGTGLFFGEAEGAVMNKLLLMGSFKRITLYDYQALCREYAGSSDSAHTLLD-VSILYRHIMICFVHHRFLL--EFNLYS------------WWNVDSTVNAQRRTMLVPCDTEYPAF-VSERTIKETAGNIDCEGCLRTFVIQQIPSSNLFMVVV-----ENKCDCSSS 949          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Sea Lamprey
Match: cacna2d4b (calcium channel, voltage-dependent, alpha 2/delta subunit 4b [Source:ZFIN;Acc:ZDB-GENE-100422-18])

HSP 1 Score: 117.087 bits (292), Expect = 1.484e-27
Identity = 81/292 (27.74%), Postives = 143/292 (48.97%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTG-NIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYL 1424
              P+   +N+    + +   +PT++Y         A W++ L+ +F    + D+ L W+Y+ SS+GF R YPGI+W   +      N ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + +  IL+TL +NDF N+  +   L +++      ++QA   N+     QL + +      +L   L E F +L  D+ N TG     N  +M +TDG++   +   +     D   RIFT++  +  +    I  +AC+N+ +      L D   NV+  +
Sbjct:   88 LEPNAHFNNLAVNTSLSNVQVPTNVYNKEPNIVNGAFWSEALNPVFEDNFERDATLTWQYYGSSTGFFRQYPGIKWTPDE------NGVISF-DCRNRGWYIQAATSPKDIVILVDVSGSMKGLRLTIAKQTISTILDTLGDNDFVNVIAYNEQLHYIEPCFEGGMVQANRDNREH-FKQLLEDMHAQGVADLANALEEGFVIL--DQFNATGQGSSCNQALMVVTDGAVETFEEVFEKYNSPDKKVRIFTYLIGRELAFANPIKWMACANKAHFTRIIVLKDTTNNVVCLI 369          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Sea Lamprey
Match: cacna2d1a (calcium channel, voltage-dependent, alpha 2/delta subunit 1a [Source:ZFIN;Acc:ZDB-GENE-041210-215])

HSP 1 Score: 110.923 bits (276), Expect = 7.907e-25
Identity = 76/260 (29.23%), Postives = 123/260 (47.31%), Query Frame = 3
Query:  675 NWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSR 1439
            NWT  LD++F++ K+ D  L W+ F S++G  R YP   W        +    VD +D R   +Y+Q  + PK M I++D SGS+ G ++ +  K V E+L TL+++D+ N+  F      V  +    L+QA  +NK  +L++  + L     TN     T  F  L    N        N ++M  TDG      +  +N      + R+FT    Q   +   I  +AC+N+G+  E  ++  +  N   YL V+ R
Sbjct:   26 NWTAGLDEVFKLNKEEDPTLLWQVFGSATGLTRFYPATPW--------VAPGDVDLFDVRRRPWYIQGASSPKDMVIIIDVSGSVSGLTLKLMKKSVSEMLETLSDDDYVNVASFHNEAVPV--SCFNHLVQANVRNKQ-MLSESVEKLTAKGMTNYKAAFTYAFEQLL---NTNVTRANCNKMIMMFTDGGEDRAQDVFENYNWPKKEVRVFTFSVGQHNYNVAPIQWMACANKGFYFEIPSIGAIRINTQDYLDVLGR 271          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005528.1 (pep scaffold:Pmarinus_7.0:GL479261:19245:30070:1 gene:ENSPMAG00000005001.1 transcript:ENSPMAT00000005528.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 6.493e-6
Identity = 39/158 (24.68%), Postives = 79/158 (50.00%), Query Frame = 3
Query:  783 IRWKIQKTDSFINNSLVDFYDCRFEIFYLQS--TAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLF--GMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDG 1244
            +R+ +++ +      +V+ Y   F  F+     +A PK +  ++D SGSM+G  +  T + + +IL  L   D FNI  F  G+N  + +R + K   ++ +  K F+      T+     TN+   L+E  ++L+  + ++  ++    L++ +TDG
Sbjct:  212 VRYDVERAEEAGQLEIVNGY---FAHFFAPKHLSALPKSIVFVIDVSGSMDGTKIKQTKEAMLKILGDLRPKDHFNIVTFSYGVN-KWANRGLVKASAESIEGAKKFV-----STMVADGGTNIKDALSEAVSLLKYQEVSKETSV---PLIILLTDG 357          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Nematostella
Match: EDO38678 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCF0])

HSP 1 Score: 84.3445 bits (207), Expect = 3.135e-19
Identity = 42/111 (37.84%), Postives = 60/111 (54.05%), Query Frame = 3
Query:  678 WTQDLDQLF-RVTKDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNI 1007
            W++ L++ F    K+D  L W+YF   +GF R+YPG  W          N  VD YD R  I+Y+Q    PK + IMVD SGSM G  + +       +++T  +NDFFN+
Sbjct:    7 WSEALNEAFTENQKNDPTLAWQYFGHDNGFMRVYPGSAWNQP-------NGQVDLYDARKRIWYIQGATSPKDVIIMVDASGSMRGVPMRIAKLSAMALIDTFEDNDFFNV 110          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Nematostella
Match: EDO29939 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T278])

HSP 1 Score: 76.2554 bits (186), Expect = 1.267e-16
Identity = 40/113 (35.40%), Postives = 60/113 (53.10%), Query Frame = 3
Query:  672 ANWTQDLDQLFRVTKD-DSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNI 1007
            A WT+ LD+ FR   + +  L W+   +S+G  R YPG +W+             D YD R   +Y+Q ++ PK M I++D SGSM G  + +       +L+TL ENDF N+
Sbjct:    6 AKWTEGLDKYFRENMEKEPSLLWQLAGTSTGVYRAYPGYKWRTPNDK--------DMYDHRRRGWYIQGSSSPKDMVILLDLSGSMTGSKIAIVKLAATYLLDTLQENDFVNV 110          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Nematostella
Match: EDO44603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV93])

HSP 1 Score: 77.411 bits (189), Expect = 2.783e-14
Identity = 40/111 (36.04%), Postives = 63/111 (56.76%), Query Frame = 3
Query:  678 WTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNI 1007
            W+  LD++F+    DD +L+W+ F S  G  R YP   W+       I+      YD R   +Y+ +T+ PK + I++D S SM+G+ + M  +I K +LNTLT+ DF N+
Sbjct:  175 WSSKLDEMFKKNLADDPELRWQNFGSVEGVLRQYPSSEWQTNFAGFHID------YDPRMRPWYIGATSGPKDIVIILDCSLSMKGKRLRMAKEIAKTVLNTLTKQDFVNV 279          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Nematostella
Match: EDO48210 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKA1])

HSP 1 Score: 58.9214 bits (141), Expect = 1.476e-8
Identity = 48/182 (26.37%), Postives = 82/182 (45.05%), Query Frame = 3
Query:  729 LKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTA-YPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTEND-----FFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLD---PANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGS 1247
            L W+YF S  G    YP IR          ++S    YD R+  +Y+++ +  PK + ++VD SGSM G  + +  +  K +L+TL   D      F  G+  + +T  D    K    +  K     ++ L + LD    +  T   +     F++L  DK  +  N     +++F+TDG+
Sbjct:  167 LTWQYFGSEEGLYTNYPMIR----------DSSSCSSYDPRYRPWYVEAASPQPKDVILVVDYSGSMGGSRLPIAKEAAKTVLDTLNPRDRVAFLAFESGVRRVKVTSGDAKDEKCFESSLAKASPVNIDILKKFLDGEYASGGTMYAIAFNAAFDIL--DKYYKEKNTTRRPVILFMTDGA 336          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Nematostella
Match: EDO48211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKA2])

HSP 1 Score: 56.9954 bits (136), Expect = 3.662e-8
Identity = 48/182 (26.37%), Postives = 82/182 (45.05%), Query Frame = 3
Query:  729 LKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTA-YPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTEND-----FFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLD---PANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGS 1247
            L W+YF S  G    YP IR          ++S    YD R+  +Y+++ +  PK + ++VD SGSM G  + +  +  K +L+TL   D      F  G+  + +T  D    K    +  K     ++ L + LD    +  T   +     F++L  DK  +  N     +++F+TDG+
Sbjct:  167 LTWQYFGSEEGLYTNYPMIR----------DSSSCSSYDPRYRPWYVEAASPQPKDVILVVDYSGSMGGSRLPIAKEAAKTVLDTLNPRDRVAFLAFESGVRRVKVTSGDAKDEKCFESSLAKASPVNIDILKKFLDGEYASGGTMYAVAFNAAFDIL--DKYYKEKNTTRRPVILFMTDGA 336          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Medaka
Match: CACNA2D3 (voltage-dependent calcium channel subunit alpha-2/delta-3 [Source:NCBI gene;Acc:101159822])

HSP 1 Score: 203.756 bits (517), Expect = 8.218e-53
Identity = 179/676 (26.48%), Postives = 295/676 (43.64%), Query Frame = 3
Query:  192 GNCQTTQANIDSLVTTIETAFSGL-----SNFLNADLLSANFVNLS-ATSVNDSVAINILSNSKSDTEQLI-TKANGVINQIQSNLTSKYSHYESPILYPNCSVKVITYFQTKSITNFTYEKIDDCTFQTLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVD----NFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAA-AVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKV---KRNYFMAGISGTPYKFGLAI 2162
            G   T Q+   S+V    +AF G      + +  + LL   +     A  V +   + ++     + E++   KA  +   +++   +   H E P L          YF    I     E  +          P+   +N+    + +   +PT++Y           W++ L+++F    + D  L W+YF S+ GF R YPGI+WK  +         V  +DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L+L LTE F++L  D N        +  +M +TDG++   D     F   D   RIF ++  + ++   ++  +AC+N+GY  +  TL+DV +NV+ YL V+SR   I +    +WT       +A   S  P                                     + Q + +   P+ ++T A  V+  S K    N G +LG VG D+ V+E +KT P  K+G++ Y F IT+NG+++ HP  RP Y   K   K  Y +VD+SEVE          + D T++              NA+    T   + ++  S   G +V     +YF   I GTP+  G+A+
Sbjct:   31 GQGGTHQSIPPSVVKLWASAFGGEMKSISAKYSGSQLLQKKYKEFERAVQVEEIDGLQLVKKLAKNMEEMFHKKAQAMKRLVEAAEEAHLQHEEEPDLQ-------YEYFNAVLINEVNEEGNNVELGGEFILQPNDHFNNLSVNLSLSVVQVPTNMYNKDSAIVNGVYWSEALNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGIKWKPDEHG-------VIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIARQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADVTNKDHFREHLDK-LFAQGIGMLDLALTEAFSLL-GDFNKTGRGSECSQAIMLVTDGAVDTYDAIFAKFNWPDRKVRIFPYLIGRESAFAENLKWMACANKGYFTQVSTLADVQENVMEYLHVLSRPKVIDREHDTVWT-------EAYIDSTLP-------------------------------------QAQKLEDGQGPVLMTTVAMPVF--STKNETRNHGILLGVVGTDVPVSELLKTIPKHKLGIHGYAFAITNNGYILTHPDLRPLYGDGKKRRKPNYSSVDLSEVEWE--------DKDDTLR--------------NAMVNRKTGTFSMEVTKSVDKGKRVLVLHNDYFYTDIKGTPFSLGVAL 622          

HSP 2 Score: 73.559 bits (179), Expect = 1.292e-12
Identity = 55/214 (25.70%), Postives = 96/214 (44.86%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSR--PCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICS 3461
            Q K +F+Q           +L  K  I  +     CY+I  +G IL    N +  G    +   A+M   +    +     YD QALC + S+ +  G  L++P    +  + W++ +L + +  F+L      +S +  + F        S   PC  + PA+ ++   ++ N    +C GC ++F I+ I ++NLF+VVV     + KC CS
Sbjct:  822 QMKLEFFQRKFWTACRQCTALDGKCSISCDDENVNCYLIDNNGFILVAEDN-SLTGTFFGEPEGAVMNKLLQMGSFKRVTLYDYQALCWVYSESSDSGHTLLDPYFAFLSAVKWILTELVIFLFEFNL------YSWWNSDLFAKAQRTGRSMQLPCDTEYPAF-ISERTIKENMGNIDCDGCFKSFVIQQIPSSNLFMVVV-----DNKCDCS 1022          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Medaka
Match: CACNA2D3 (voltage-dependent calcium channel subunit alpha-2/delta-3 [Source:NCBI gene;Acc:101159822])

HSP 1 Score: 201.06 bits (510), Expect = 5.921e-52
Identity = 178/676 (26.33%), Postives = 293/676 (43.34%), Query Frame = 3
Query:  192 GNCQTTQANIDSLVTTIETAFSGL-----SNFLNADLLSANFVNLS-ATSVNDSVAINILSNSKSDTEQLI-TKANGVINQIQSNLTSKYSHYESPILYPNCSVKVITYFQTKSITNFTYEKIDDCTFQTLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVD----NFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAA-AVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKV---KRNYFMAGISGTPYKFGLAI 2162
            G   T Q+   S+V    +AF G      + +  + LL   +     A  V +   + ++     + E++   KA  +   +++   +   H E P L          YF    I     E  +          P+   +N+    + +   +PT++Y           W++ L+++F    + D  L W+YF S+ GF R YPGI+WK  +         V  +DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L+L LTE F++L  D N        +  +M +TDG++   D     F   D   RIF ++  + ++   ++  +AC+N+GY  +  TL+DV +NV+ YL V+SR   I +    +WT                                               A + ST    + +   P+ ++T A  V+  S K    N G +LG VG D+ V+E +KT P  K+G++ Y F IT+NG+++ HP  RP Y   K   K  Y +VD+SEVE          + D T++              NA+    T   + ++  S   G +V     +YF   I GTP+  G+A+
Sbjct:   31 GQGGTHQSIPPSVVKLWASAFGGEMKSISAKYSGSQLLQKKYKEFERAVQVEEIDGLQLVKKLAKNMEEMFHKKAQAMKRLVEAAEEAHLQHEEEPDLQ-------YEYFNAVLINEVNEEGNNVELGGEFILQPNDHFNNLSVNLSLSVVQVPTNMYNKDSAIVNGVYWSEALNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGIKWKPDEHG-------VIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIARQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADVTNKDHFREHLDK-LFAQGIGMLDLALTEAFSLL-GDFNKTGRGSECSQAIMLVTDGAVDTYDAIFAKFNWPDRKVRIFPYLIGRESAFAENLKWMACANKGYFTQVSTLADVQENVMEYLHVLSRPKVIDREHDTVWTE----------------------------------------------AYIDST----LEDGQGPVLMTTVAMPVF--STKNETRNHGILLGVVGTDVPVSELLKTIPKHKLGIHGYAFAITNNGYILTHPDLRPLYGDGKKRRKPNYSSVDLSEVEWE--------DKDDTLR--------------NAMVNRKTGTFSMEVTKSVDKGKRVLVLHNDYFYTDIKGTPFSLGVAL 616          

HSP 2 Score: 73.559 bits (179), Expect = 1.345e-12
Identity = 55/214 (25.70%), Postives = 96/214 (44.86%), Query Frame = 3
Query: 2859 QAKFDFYQ-----------SLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSR--PCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICS 3461
            Q K +F+Q           +L  K  I  +     CY+I  +G IL    N +  G    +   A+M   +    +     YD QALC + S+ +  G  L++P    +  + W++ +L + +  F+L      +S +  + F        S   PC  + PA+ ++   ++ N    +C GC ++F I+ I ++NLF+VVV     + KC CS
Sbjct:  816 QMKLEFFQRKFWTACRQCTALDGKCSISCDDENVNCYLIDNNGFILVAEDN-SLTGTFFGEPEGAVMNKLLQMGSFKRVTLYDYQALCWVYSESSDSGHTLLDPYFAFLSAVKWILTELVIFLFEFNL------YSWWNSDLFAKAQRTGRSMQLPCDTEYPAF-ISERTIKENMGNIDCDGCFKSFVIQQIPSSNLFMVVV-----DNKCDCS 1016          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Medaka
Match: CACNA2D3 (voltage-dependent calcium channel subunit alpha-2/delta-3 [Source:NCBI gene;Acc:101159822])

HSP 1 Score: 198.364 bits (503), Expect = 2.244e-51
Identity = 175/667 (26.24%), Postives = 290/667 (43.48%), Query Frame = 3
Query:  219 IDSLVTTIETAFSGL-----SNFLNADLLSANFVNLS-ATSVNDSVAINILSNSKSDTEQLI-TKANGVINQIQSNLTSKYSHYESPILYPNCSVKVITYFQTKSITNFTYEKIDDCTFQTLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVD----NFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAA-AVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQY---KNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKV---KRNYFMAGISGTPYKFGLAI 2162
            I ++V    +AF G      + +  + LL   +     A  V +   + ++     + E++   KA  +   +++   +   H E P L          YF    I     E  +          P+   +N+    + +   +PT++Y           W++ L+++F    + D  L W+YF S+ GF R YPGI+WK  +         V  +DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   L +V+  +   L+QA   NK      L++ L       L+L LTE F++L  D N        +  +M +TDG++   D     F   D   RIF ++  + ++   ++  +AC+N+GY  +  TL+DV +NV+ YL V+SR   I +    +WT                                               A + ST    + +   P+ ++T A  V+  S K    N G +LG VG D+ V+E +KT P  K+G++ Y F IT+NG+++ HP  RP Y   K   K  Y +VD+SEVE          + D T++              NA+    T   + ++  S   G +V     +YF   I GTP+  G+A+
Sbjct:    3 IGAVVKLWASAFGGEMKSISAKYSGSQLLQKKYKEFERAVQVEEIDGLQLVKKLAKNMEEMFHKKAQAMKRLVEAAEEAHLQHEEEPDLQ-------YEYFNAVLINEVNEEGNNVELGGEFILQPNDHFNNLSVNLSLSVVQVPTNMYNKDSAIVNGVYWSEALNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGIKWKPDEHG-------VIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIARQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADVTNKDHFREHLDK-LFAQGIGMLDLALTEAFSLL-GDFNKTGRGSECSQAIMLVTDGAVDTYDAIFAKFNWPDRKVRIFPYLIGRESAFAENLKWMACANKGYFTQVSTLADVQENVMEYLHVLSRPKVIDREHDTVWTE----------------------------------------------AYIDST----LEDGQGPVLMTTVAMPVF--STKNETRNHGILLGVVGTDVPVSELLKTIPKHKLGIHGYAFAITNNGYILTHPDLRPLYGDGKKRRKPNYSSVDLSEVEWE--------DKDDTLR--------------NAMVNRKTGTFSMEVTKSVDKGKRVLVLHNDYFYTDIKGTPFSLGVAL 579          

HSP 2 Score: 67.781 bits (164), Expect = 6.351e-11
Identity = 51/182 (28.02%), Postives = 86/182 (47.25%), Query Frame = 3
Query: 2931 CYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSR-----PCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICS 3461
            CY+I  +G IL    N +  G    +   A+M   +    +     YD QALC + S+ +  G  L++P    +  + W++ +LF L  +F        F+S        VSS + +      PC  + PA+ ++   ++ N    +C GC ++F I+ I ++NLF+VVV     + KC CS
Sbjct:  810 CYLIDNNGFILVAEDN-SLTGTFFGEPEGAVMNKLLQMGSFKRVTLYDYQALCWVYSESSDSGHTLLDPYFAFLSAVKWILTELFHL--HF--------FASL-------VSSAQRTGRSMQLPCDTEYPAF-ISERTIKENMGNIDCDGCFKSFVIQQIPSSNLFMVVV-----DNKCDCS 967          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Medaka
Match: cacna2d3 (voltage-dependent calcium channel subunit alpha-2/delta-3 [Source:NCBI gene;Acc:101158014])

HSP 1 Score: 193.356 bits (490), Expect = 7.120e-50
Identity = 146/544 (26.84%), Postives = 251/544 (46.14%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNL---CLTEVFNVLRKDKNNQTG-NIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKI---FYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
              P+   +N+    + +   +PT++Y    +      W++ L+++F    + D  L W+YF S+ GF R YPG++W   +      + ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   + +V+  +   L++A   NK    +   + LD      + L    L+E F +L  +  NQTG   + +  +M +TDG+  + D+  +     +   RIF ++  + ++   ++  +AC+N+GY  +  TL+DV +NV+ YL V+SR   I      +WT  +                                          V + L       V+  P  L  + A  V+  S K    N G +LG VG DI + E +K  P   +G++ Y+F IT+NG+++ HP  RP Y+ S K     Y +VD+SEVE      I                LR  M++    +  + S+ T + +D      K+  +Y+   I GTP+  G+A+
Sbjct:   60 LEPNDHFNNLSVNLSHSVVQVPTNMYNKDPDIVNGVYWSEALNKVFVDNFETDPTLIWQYFGSAKGFFRQYPGVKWHPDE------HGVIGF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIARQTVSSILDTLGDDDFFNIIAYNQEIHYVEPCLNGTLVRADRTNK----DHFREHLDKLFAKGIGLLGEALSEAFTIL--NDFNQTGRGSVCSQAIMLVTDGATEMYDDVFEKFNWPERKVRIFPYLIGRESAFADNLKWMACANKGYFSQISTLADVQENVMRYLHVMSRPKVIDHEHDTVWTEAY------------------------------------------VDSALSQAHKLKVKSGP-SLTTTVAMPVF--STKNETKNQGILLGVVGTDIPLQELMKLIPKHMLGIHGYVFAITNNGYILIHPDLRPLYQGSQKRRKPHYSSVDLSEVEWEDKDDI----------------LRNAMVNR---RTGTFSMETKKTVDRGRRVLKMHYDYYYTDIKGTPFSVGVAL 526          

HSP 2 Score: 62.003 bits (149), Expect = 4.027e-9
Identity = 53/198 (26.77%), Postives = 89/198 (44.95%), Query Frame = 3
Query: 2898 SLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVS---SVENSR------PCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSS 3464
            S+ C N  V  CY+I  +G IL      +  GL   ++  A+M   +    +     YD QALC   S  +   + L +P S     + W++ +L + +  F+L +            ++NV      + SR      PC  + PA+    +   + G++  C  C ++F I+ I ++NLF+VVV     + KC CSS
Sbjct:  751 SISCDNDDVN-CYLIDNNGFILVTE-EQSQTGLFFGEVEGAVMNKLLQMGSFKRITLYDYQALCRDYSGSSDSARTLSDPFSV----VRWLLTELVIFLLEFNLYS------------WWNVDLTVKAQRSRGKTMMVPCDTEYPAFVSERTIKETTGNI-QCDNCVRSFVIQQIPSSNLFMVVV-----DNKCDCSS 924          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Medaka
Match: cacna2d3 (voltage-dependent calcium channel subunit alpha-2/delta-3 [Source:NCBI gene;Acc:101158014])

HSP 1 Score: 189.889 bits (481), Expect = 1.129e-48
Identity = 145/544 (26.65%), Postives = 252/544 (46.32%), Query Frame = 3
Query:  567 FTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVT-KDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNL---CLTEVFNVLRKDKNNQTG-NIIYNYLVMFITDGSLSLVDNFMQN----DIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKI---FYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAI 2162
              P+   +N+    + +   +PT++Y    +      W++ L+++F    + D  L W+YF S+ GF R YPG++W   +      + ++ F DCR   +Y+Q+   PK + I+VD SGSM+G  + +  + V  IL+TL ++DFFNI  +   + +V+  +   L++A   NK    +   + LD      + L    L+E F +L  +  NQTG   + +  +M +TDG+  + D+  +     +   RIF ++  + ++   ++  +AC+N+GY  +  TL+DV +NV+ YL V+SR   I      +WT  +                                          V + L+      V+  P  L  + A  V+    +T N   G +LG VG DI + E +K  P   +G++ Y+F IT+NG+++ HP  RP Y+ S K     Y +VD+SEVE      I                LR  M++    +  + S+ T + +D      K+  +Y+   I GTP+  G+A+
Sbjct:   60 LEPNDHFNNLSVNLSHSVVQVPTNMYNKDPDIVNGVYWSEALNKVFVDNFETDPTLIWQYFGSAKGFFRQYPGVKWHPDE------HGVIGF-DCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIARQTVSSILDTLGDDDFFNIIAYNQEIHYVEPCLNGTLVRADRTNK----DHFREHLDKLFAKGIGLLGEALSEAFTIL--NDFNQTGRGSVCSQAIMLVTDGATEMYDDVFEKFNWPERKVRIFPYLIGRESAFADNLKWMACANKGYFSQISTLADVQENVMRYLHVMSRPKVIDHEHDTVWTEAY------------------------------------------VDSALK------VKSGP-SLTTTVAMPVFSTKNETKNQ--GILLGVVGTDIPLQELMKLIPKHMLGIHGYVFAITNNGYILIHPDLRPLYQGSQKRRKPHYSSVDLSEVEWEDKDDI----------------LRNAMVNR---RTGTFSMETKKTVDRGRRVLKMHYDYYYTDIKGTPFSVGVAL 520          

HSP 2 Score: 62.003 bits (149), Expect = 4.265e-9
Identity = 53/198 (26.77%), Postives = 89/198 (44.95%), Query Frame = 3
Query: 2898 SLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVS---SVENSR------PCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSS 3464
            S+ C N  V  CY+I  +G IL      +  GL   ++  A+M   +    +     YD QALC   S  +   + L +P S     + W++ +L + +  F+L +            ++NV      + SR      PC  + PA+    +   + G++  C  C ++F I+ I ++NLF+VVV     + KC CSS
Sbjct:  745 SISCDNDDVN-CYLIDNNGFILVTE-EQSQTGLFFGEVEGAVMNKLLQMGSFKRITLYDYQALCRDYSGSSDSARTLSDPFSV----VRWLLTELVIFLLEFNLYS------------WWNVDLTVKAQRSRGKTMMVPCDTEYPAFVSERTIKETTGNI-QCDNCVRSFVIQQIPSSNLFMVVV-----DNKCDCSS 918          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Planmine SMEST
Match: SMESG000020654.1 (SMESG000020654.1)

HSP 1 Score: 2099.32 bits (5438), Expect = 0.000e+0
Identity = 1093/1109 (98.56%), Postives = 1094/1109 (98.65%), Query Frame = 3
Query:  177 FILPFGNCQTTQANIDSLVTTIETAFSGLSNFLNADLLSANFVNLSATSVNDSVAINILSNSKSDTEQLITKANGVINQIQSNLTSKYSHYESPILYPNCSVKVITYFQTKSITNFTYEKIDDCTFQTLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQXXXXXXXXXXXXXXXXXXATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITXXXXXXXXXXXXXGKNFSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQGXXXXXXXXXXXXVFMNVNNWNSLVFTVSTPLXXXXXXXXXXXXQAKFDFYQSLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFGKRDELTRNIL 3503
            FILPFGNCQTTQANIDSLVTTIETAFSGLSNFLNADLLSANFVNLSATSVNDSVAINILSNSKSDTEQLITKANGVINQIQSNLTSKYSHYESPILYPNCSVKVITYFQTKSITNFTYEKIDDCTFQTLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQTTSTSTSKVFSTTFPSSTATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITNSSSFNISWSSLNGKNFSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQ             VFMNVNNWNSLVFTVSTPLVNNGIYIGVVGVQAKFDFYQSLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFGKRDELT  +L
Sbjct:   10 FILPFGNCQTTQANIDSLVTTIETAFSGLSNFLNADLLSANFVNLSATSVNDSVAINILSNSKSDTEQLITKANGVINQIQSNLTSKYSHYESPILYPNCSVKVITYFQTKSITNFTYEKIDDCTFQTLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASETSDFPGFSAQTTSTSTSKVFSTTFPSSTATKSPTVFAILQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITNSSSFNISWSSLNGKNFSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQ-------------VFMNVNNWNSLVFTVSTPLVNNGIYIGVVGVQAKFDFYQSLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFGKRDELTNILL 1105          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Planmine SMEST
Match: SMESG000020654.1 (SMESG000020654.1)

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 532/551 (96.55%), Postives = 533/551 (96.73%), Query Frame = 3
Query: 1851 LIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITXXXXXXXXXXXXXGKNFSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQGXXXXXXXXXXXXVFMNVNNWNSLVFTVSTPLXXXXXXXXXXXXQAKFDFYQSLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFGKRDELTRNIL 3503
            LIFH K  PQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITNSSSFNISWSSLNGKNFSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQ             VFMNVNNWNSLVFTVSTPLVNNGIYIGVVGVQAKFDFYQSLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFGKRDELT  +L
Sbjct:    3 LIFHIKLEPQYKNSMKIFYRNVDISEVEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITNSSSFNISWSSLNGKNFSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQ-------------VFMNVNNWNSLVFTVSTPLVNNGIYIGVVGVQAKFDFYQSLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFGKRDELTNILL 540          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Planmine SMEST
Match: SMESG000020648.1 (SMESG000020648.1)

HSP 1 Score: 864.759 bits (2233), Expect = 0.000e+0
Identity = 500/1132 (44.17%), Postives = 702/1132 (62.01%), Query Frame = 3
Query:  201 QTTQANIDSLVTTIETAFSGLSNFLNADLLSANFVNLSATSVNDSVAINILSNSKSDTEQLITKANGVINQIQSNLTS---KYSHYESPILYPNCSV--KVITYFQTKSITNFTYEKIDDCTFQTLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGS----LSLVDNFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASE---------TSDFPGF---SAQXXXXXXXXXXXXXXXXXXATKSPTVFAI--LQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLT--IAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITXXXXXXXXXXXXXGKNFSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQGXXXXXXXXXXXXVFMNVNNWNSLVFTVSTPLXX-XXXXXXXXXXQAKFDFYQSLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALC-NILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPCYLKIPAYTVTPSNVR---SNGSVSNCL-GCNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFGKRDELTRNIL 3503
            Q    ++D+L  ++E  F  L   +N  +      N  + SV++   INIL  SK+D+E+++ K N V++ +Q  LT    +YS   S     +C V    I YF+ K++   +     +C  QTLP   DP+L NI T R  +TTH+PT++Y+ S E Q  ANWT DLDQ F++ KDDSQLKW++FCS++G  +IYPGIRW +Q  DS  ++SLVDF+DCR E +YL++T+YPKKM IMVD+SGSM+GR  I+    + EILNTLTENDFFNI LF     F D   +  L+QATDKNK ++L+QL     P      +  LTE F VLR DK N T +  YNYL+M ITDGS      L++N+   D+ ARIFT++  QG ++R  +  +AC N+GY+VE  TL+DV +NV  YL VV+RKNA+++N FN+WTGVH+ Q++ +E         T+  P     SA + + + +   +    ++ +  S T   I  +Q T+ +   +KPI L+V+ + AVYD++ +T     G +LG+ G+D+ +NEF+KTAPFWKIGVNAYLFG+TSNGF++FHPK+ PQYK  +K FYRNVDISE+EI S  T  I  I  DQT+Q   T  LR+ ++D     + + SL TFQILD F T FKV+R YF+AGI  T YKFGLA+P NQMVP Y++     +T S F   FG N  T    C VI   +N+ G  +K++EFC + P IA LQM  PLC LI  F N T+   C  +      YL N+Y E+  S +   +W  +  K   +QQIFS  HFGLIRYYN E L YQ+FI NHS GI+D LYQET+L +Q  ++  +L+A  LP++            +V  N+   +SL+FTV+TP+    G  +GV+G+QAK++ + ++L K  +C N+   +CY++T SG+IL NN++L  NG  L +I+CA+ME+ V+N I+ +Q  +D QALC N   QP SF  RL+NP +++   L+W+I + +++++NFS++ ++W  S+ EE     V SV   RPC     +Y +  SN+    SN ++S     C Q +Y R I NTNL LVVV KS   C C C S FGK  EL +NIL
Sbjct:   21 QDLSQDVDTLGKSLENYFDQLRKIMNEAIPEEYVKNAKSKSVSEKEIINILQTSKADSEKIVNKTNIVVDILQQKLTQAFNEYSQTPSKKYRLDCVVNDSFIFYFRAKALRASSSVNETNCNIQTLPLDKDPYLGNIVTNREMSTTHVPTNVYDASQEIQSVANWTADLDQTFQMRKDDSQLKWQFFCSNTGLFKIYPGIRWNLQIEDSDRDSSLVDFFDCRSEQWYLEATSYPKKMMIMVDKSGSMKGRRKIIANHTIYEILNTLTENDFFNILLFTKEYCFADNYTSGILMQATDKNKKYILDQLATVFIPDGIAEYDFGLTESFKVLRNDKMNDTDSKYYNYLLMIITDGSPLDYQQLIENY-NKDLGARIFTYLIGQGTTEREMVTNMACKNQGYAVEIATLADVKENVQKYLNVVARKNALMRNAFNVWTGVHKNQMQPTEEIVISNNTDTTFMPMIMNPSASSVTFAPNITTTFATSTTRSLLSNTTVNIPPIQMTKIEIFEDKPIELFVTASKAVYDETNETAALKSGILLGAAGVDVPINEFIKTAPFWKIGVNAYLFGVTSNGFVLFHPKYAPQYKKHVKYFYRNVDISELEIDSEATDNITFIRNDQTVQAGKTDQLRKSLIDQKDQVKEAGSLTTFQILDDFKTVFKVERTYFIAGIKDTSYKFGLAVPLNQMVPNYSDEISLPITESKFYEEFGENLETLRNSCSVIFSEKNEMGTSMKNHEFCTLNPYIAGLQMQGPLCVLIEAFTNQTIFEHCVKDKESSREYLKNMYMEMKTSKNVLKTWRVI--KEPIIQQIFSFHHFGLIRYYNLETLTYQHFIANHSLGIEDPLYQETVLVSQSLKSPNVLMARPLPSE------------VVKKNLAQ-SSLIFTVTTPINGFEGNVLGVIGIQAKYNDFLAVLMKDALCNNTLQYDCYVLTESGLILLNNMDLRHNGDLLTEIDCALMETLVHNKIFKSQSVFDFQALCPNPSKQPDSFSNRLLNPFTQIFRLLMWLIYEFWIVMQNFSISNIIWSISAQEE----LVKSVYTWRPCV--NVSYVMIISNLSGTLSNNTMSKTFCTCQQKWYARQIFNTNLLLVVVEKSNAACTCDCKSEFGKPREL-KNIL 1129          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Planmine SMEST
Match: SMESG000020648.1 (SMESG000020648.1)

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 467/1057 (44.18%), Postives = 662/1057 (62.63%), Query Frame = 3
Query:  201 QTTQANIDSLVTTIETAFSGLSNFLNADLLSANFVNLSATSVNDSVAINILSNSKSDTEQLITKANGVINQIQSNLTS---KYSHYESPILYPNCSV--KVITYFQTKSITNFTYEKIDDCTFQTLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGS----LSLVDNFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASE---------TSDFPGF---SAQXXXXXXXXXXXXXXXXXXATKSPTVFAI--LQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLT--IAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITXXXXXXXXXXXXXGKNFSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQGXXXXXXXXXXXXVFMNVNNWNSLVFTVSTPLXX-XXXXXXXXXXQAKFDFYQSLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALC-NILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVENSRPC 3290
            Q    ++D+L  ++E  F  L   +N  +      N  + SV++   INIL  SK+D+E+++ K N V++ +Q  LT    +YS   S     +C V    I YF+ K++   +     +C  QTLP   DP+L NI T R  +TTH+PT++Y+ S E Q  ANWT DLDQ F++ KDDSQLKW++FCS++G  +IYPGIRW +Q  DS  ++SLVDF+DCR E +YL++T+YPKKM IMVD+SGSM+GR  I+    + EILNTLTENDFFNI LF     F D   +  L+QATDKNK ++L+QL     P      +  LTE F VLR DK N T +  YNYL+M ITDGS      L++N+   D+ ARIFT++  QG ++R  +  +AC N+GY+VE  TL+DV +NV  YL VV+RKNA+++N FN+WTGVH+ Q++ +E         T+  P     SA + + + +   +    ++ +  S T   I  +Q T+ +   +KPI L+V+ + AVYD++ +T     G +LG+ G+D+ +NEF+KTAPFWKIGVNAYLFG+TSNGF++FHPK+ PQYK  +K FYRNVDISE+EI S  T  I  I  DQT+Q   T  LR+ ++D     + + SL TFQILD F T FKV+R YF+AGI  T YKFGLA+P NQMVP Y++     +T S F   FG N  T    C VI   +N+ G  +K++EFC + P IA LQM  PLC LI  F N T+   C  +      YL N+Y E+  S +   +W  +  K   +QQIFS  HFGLIRYYN E L YQ+FI NHS GI+D LYQET+L +Q  ++  +L+A  LP++            +V  N+   +SL+FTV+TP+    G  +GV+G+QAK++ + ++L K  +C N+   +CY++T SG+IL NN++L  NG  L +I+CA+ME+ V+N I+ +Q  +D QALC N   QP SF  RL+NP +++   L+W+I + +++++NFS++ ++W  S+ EE     V SV   RPC
Sbjct:   21 QDLSQDVDTLGKSLENYFDQLRKIMNEAIPEEYVKNAKSKSVSEKEIINILQTSKADSEKIVNKTNIVVDILQQKLTQAFNEYSQTPSKKYRLDCVVNDSFIFYFRAKALRASSSVNETNCNIQTLPLDKDPYLGNIVTNREMSTTHVPTNVYDASQEIQSVANWTADLDQTFQMRKDDSQLKWQFFCSNTGLFKIYPGIRWNLQIEDSDRDSSLVDFFDCRSEQWYLEATSYPKKMMIMVDKSGSMKGRRKIIANHTIYEILNTLTENDFFNILLFTKEYCFADNYTSGILMQATDKNKKYILDQLATVFIPDGIAEYDFGLTESFKVLRNDKMNDTDSKYYNYLLMIITDGSPLDYQQLIENY-NKDLGARIFTYLIGQGTTEREMVTNMACKNQGYAVEIATLADVKENVQKYLNVVARKNALMRNAFNVWTGVHKNQMQPTEEIVISNNTDTTFMPMIMNPSASSVTFAPNITTTFATSTTRSLLSNTTVNIPPIQMTKIEIFEDKPIELFVTASKAVYDETNETAALKSGILLGAAGVDVPINEFIKTAPFWKIGVNAYLFGVTSNGFVLFHPKYAPQYKKHVKYFYRNVDISELEIDSEATDNITFIRNDQTVQAGKTDQLRKSLIDQKDQVKEAGSLTTFQILDDFKTVFKVERTYFIAGIKDTSYKFGLAVPLNQMVPNYSDEISLPITESKFYEEFGENLETLRNSCSVIFSEKNEMGTSMKNHEFCTLNPYIAGLQMQGPLCVLIEAFTNQTIFEHCVKDKESSREYLKNMYMEMKTSKNVLKTWRVI--KEPIIQQIFSFHHFGLIRYYNLETLTYQHFIANHSLGIEDPLYQETVLVSQSLKSPNVLMARPLPSE------------VVKKNLAQ-SSLIFTVTTPINGFEGNVLGVIGIQAKYNDFLAVLMKDALCNNTLQYDCYVLTESGLILLNNMDLRHNGDLLTEIDCALMETLVHNKIFKSQSVFDFQALCPNPSKQPDSFSNRLLNPFTQIFRLLMWLIYEFWIVMQNFSISNIIWSISAQEE----LVKSVYTWRPC 1057          

HSP 2 Score: 53.1434 bits (126), Expect = 1.562e-6
Identity = 32/57 (56.14%), Postives = 36/57 (63.16%), Query Frame = 3
Query: 3336 SNGSVSNCLG-CNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFGKRDELTRNIL 3503
            SNG+V  C G C + +Y R I NTNL LVVV KS   C C C S FGK  EL +NIL
Sbjct: 1276 SNGTV--CFGTCIKKWYARQIFNTNLLLVVVEKSNAACTCDCKSEFGKPREL-KNIL 1329          
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Planmine SMEST
Match: SMESG000020648.1 (SMESG000020648.1)

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 463/1052 (44.01%), Postives = 662/1052 (62.93%), Query Frame = 3
Query:  201 QTTQANIDSLVTTIETAFSGLSNFLNADLLSANFVNLSATSVNDSVAINILSNSKSDTEQLITKANGVINQIQSNLTS---KYSHYESPILYPNCSV--KVITYFQTKSITNFTYEKIDDCTFQTLPFTPDPFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKDDSQLKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQSTAYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNLTFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLRKDKNNQTGNIIYNYLVMFITDGS----LSLVDNFMQNDIDARIFTHITQQGASDRFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWTGVHQIQIKASE---------TSDFPGF---SAQXXXXXXXXXXXXXXXXXXATKSPTVFAI--LQSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNEFVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISEVEISSNLT--IAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILDSFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVFQNLFGINFATFNQQCGVINLSENQSGIFIKDYEFCFMTPEIATLQMLSPLCTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITXXXXXXXXXXXXXGKNFSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQYFQNNRILVATSLPNQGXXXXXXXXXXXXVFMNVNNWNSLVFTVSTPLXX-XXXXXXXXXXQAKFDFYQSLLNKSLICANSSVTECYIITASGVILFNNINLTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALC-NILSQPTSFGKRLINPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEE-NPFYNVSSV 3272
            Q    ++D+L  ++E  F  L   +N  +      N  + SV++   INIL  SK+D+E+++ K N V++ +Q  LT    +YS   S     +C V    I YF+ K++   +     +C  QTLP   DP+L NI T R  +TTH+PT++Y+ S E Q  ANWT DLDQ F++ KDDSQLKW++FCS++G  +IYPGIRW +Q  DS  ++SLVDF+DCR E +YL++T+YPKKM IMVD+SGSM+GR  I+    + EILNTLTENDFFNI LF     F D   +  L+QATDKNK ++L+QL     P      +  LTE F VLR DK N T +  YNYL+M ITDGS      L++N+   D+ ARIFT++  QG ++R  +  +AC N+GY+VE  TL+DV +NV  YL VV+RKNA+++N FN+WTGVH+ Q++ +E         T+  P     SA + + + +   +    ++ +  S T   I  +Q T+ +   +KPI L+V+ + AVYD++ +T     G +LG+ G+D+ +NEF+KTAPFWKIGVNAYLFG+TSNGF++FHPK+ PQYK  +K FYRNVDISE+EI S  T  I  I  DQT+Q   T  LR+ ++D     + + SL TFQILD F T FKV+R YF+AGI  T YKFGLA+P NQMVP Y++     +T S F   FG N  T    C VI   +N+ G  +K++EFC + P IA LQM  PLC LI  F N T+   C  +      YL N+Y E+  S +   +W  +  K   +QQIFS  HFGLIRYYN E L YQ+FI NHS GI+D LYQET+L +Q  ++  +L+A  LP++            +V  N+   +SL+FTV+TP+    G  +GV+G+QAK++ + ++L K  +C N+   +CY++T SG+IL NN++L  NG  L +I+CA+ME+ V+N I+ +Q  +D QALC N   QP SF  RL+NP +++   L+W+I + +++++NFS++ ++W  S+ EE +P  ++S+ 
Sbjct:   21 QDLSQDVDTLGKSLENYFDQLRKIMNEAIPEEYVKNAKSKSVSEKEIINILQTSKADSEKIVNKTNIVVDILQQKLTQAFNEYSQTPSKKYRLDCVVNDSFIFYFRAKALRASSSVNETNCNIQTLPLDKDPYLGNIVTNREMSTTHVPTNVYDASQEIQSVANWTADLDQTFQMRKDDSQLKWQFFCSNTGLFKIYPGIRWNLQIEDSDRDSSLVDFFDCRSEQWYLEATSYPKKMMIMVDKSGSMKGRRKIIANHTIYEILNTLTENDFFNILLFTKEYCFADNYTSGILMQATDKNKKYILDQLATVFIPDGIAEYDFGLTESFKVLRNDKMNDTDSKYYNYLLMIITDGSPLDYQQLIENY-NKDLGARIFTYLIGQGTTEREMVTNMACKNQGYAVEIATLADVKENVQKYLNVVARKNALMRNAFNVWTGVHKNQMQPTEEIVISNNTDTTFMPMIMNPSASSVTFAPNITTTFATSTTRSLLSNTTVNIPPIQMTKIEIFEDKPIELFVTASKAVYDETNETAALKSGILLGAAGVDVPINEFIKTAPFWKIGVNAYLFGVTSNGFVLFHPKYAPQYKKHVKYFYRNVDISELEIDSEATDNITFIRNDQTVQAGKTDQLRKSLIDQKDQVKEAGSLTTFQILDDFKTVFKVERTYFIAGIKDTSYKFGLAVPLNQMVPNYSDEISLPITESKFYEEFGENLETLRNSCSVIFSEKNEMGTSMKNHEFCTLNPYIAGLQMQGPLCVLIEAFTNQTIFEHCVKDKESSREYLKNMYMEMKTSKNVLKTWRVI--KEPIIQQIFSFHHFGLIRYYNLETLTYQHFIANHSLGIEDPLYQETVLVSQSLKSPNVLMARPLPSE------------VVKKNLAQ-SSLIFTVTTPINGFEGNVLGVIGIQAKYNDFLAVLMKDALCNNTLQYDCYVLTESGLILLNNMDLRHNGDLLTEIDCALMETLVHNKIFKSQSVFDFQALCPNPSKQPDSFSNRLLNPFTQIFRLLMWLIYEFWIVMQNFSISNIIWSISAQEEQDPHIDISTA 1056          

HSP 2 Score: 53.5286 bits (127), Expect = 1.392e-6
Identity = 32/57 (56.14%), Postives = 36/57 (63.16%), Query Frame = 3
Query: 3336 SNGSVSNCLG-CNQNFYIRSINNTNLFLVVVVKSVPNCKCICSSAFGKRDELTRNIL 3503
            SNG+V  C G C + +Y R I NTNL LVVV KS   C C C S FGK  EL +NIL
Sbjct: 1238 SNGTV--CFGTCIKKWYARQIFNTNLLLVVVEKSNAACTCDCKSEFGKPREL-KNIL 1291          
The following BLAST results are available for this feature:
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA2D33.340e-5230.17calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D33.340e-5230.17calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D33.678e-5228.65calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D36.786e-5228.47calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D36.786e-5228.47calcium voltage-gated channel auxiliary subunit al... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
unc-364.932e-3626.11Voltage-dependent calcium channel unc-36 [Source:... [more]
unc-363.834e-2826.12Voltage-dependent calcium channel unc-36 [Source:... [more]
tag-1804.296e-1123.31pep chromosome:WBcel235:II:11323051:11329429:-1 ge... [more]
tag-1804.676e-1123.31pep chromosome:WBcel235:II:11323051:11329147:-1 ge... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ca-Ma2d2.623e-4826.48gene:FBgn0261999 transcript:FBtr0303797[more]
Ca-Ma2d2.623e-4826.48gene:FBgn0261999 transcript:FBtr0332356[more]
stj1.969e-4723.59gene:FBgn0261041 transcript:FBtr0087631[more]
stj2.227e-4623.53gene:FBgn0261041 transcript:FBtr0304695[more]
stj2.258e-4625.16gene:FBgn0261041 transcript:FBtr0304694[more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna2d32.191e-4926.65calcium channel, voltage dependent, alpha2/delta s... [more]
cacna2d32.978e-4926.84calcium channel, voltage dependent, alpha2/delta s... [more]
cacna2d4b8.465e-4829.09calcium channel, voltage-dependent, alpha 2/delta ... [more]
cacna2d4b9.784e-4829.09calcium channel, voltage-dependent, alpha 2/delta ... [more]
cacna2d4a6.182e-4726.34calcium channel, voltage-dependent, alpha 2/delta ... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA2D34.880e-5327.88calcium channel, voltage-dependent, alpha 2/delta ... [more]
CACNA2D31.123e-5227.70calcium channel, voltage-dependent, alpha 2/delta ... [more]
CACNA2D31.469e-4928.17calcium channel, voltage-dependent, alpha 2/delta ... [more]
CACNA2D45.772e-4728.74calcium channel, voltage-dependent, alpha 2/delta ... [more]
CACNA2D42.740e-3533.46calcium channel, voltage-dependent, alpha 2/delta ... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cacna2d37.368e-5428.89calcium channel, voltage-dependent, alpha2/delta s... [more]
Cacna2d17.862e-3724.91calcium channel, voltage-dependent, alpha2/delta s... [more]
Cacna2d18.926e-3724.91calcium channel, voltage-dependent, alpha2/delta s... [more]
Cacna2d11.008e-3624.91calcium channel, voltage-dependent, alpha2/delta s... [more]
Cacna2d14.526e-3624.72calcium channel, voltage-dependent, alpha2/delta s... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z1L5|CA2D3_MOUSE5.154e-5328.89Voltage-dependent calcium channel subunit alpha-2/... [more]
sp|Q8CFG5|CA2D3_RAT9.801e-5228.33Voltage-dependent calcium channel subunit alpha-2/... [more]
sp|Q8IZS8|CA2D3_HUMAN3.259e-5128.47Voltage-dependent calcium channel subunit alpha-2/... [more]
sp|Q7Z3S7|CA2D4_HUMAN4.727e-4427.05Voltage-dependent calcium channel subunit alpha-2/... [more]
sp|O08532|CA2D1_MOUSE3.922e-3524.72Voltage-dependent calcium channel subunit alpha-2/... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DHK52.793e-13730.48Voltage-dependent calcium channel subunit alpha-2/... [more]
A0A5K4EMS91.176e-13430.42Putative dihydropyridine-sensitive l-type calcium ... [more]
A0A3Q0KM992.803e-13430.42Putative dihydropyridine-sensitive l-type calcium ... [more]
A0A158QTC31.390e-11728.07Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4S2LRU92.934e-11132.84VWFA domain-containing protein OS=Opisthorchis fel... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA2D31.864e-5028.20calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D31.967e-5028.20calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D33.079e-5028.20calcium voltage-gated channel auxiliary subunit al... [more]
CACNA2D33.735e-5028.26calcium voltage-gated channel auxiliary subunit al... [more]
cacna2d32.445e-4926.38calcium channel, voltage dependent, alpha2/delta s... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cacna2d4b1.484e-2727.74calcium channel, voltage-dependent, alpha 2/delta ... [more]
cacna2d1a7.907e-2529.23calcium channel, voltage-dependent, alpha 2/delta ... [more]
ENSPMAT00000005528.16.493e-624.68pep scaffold:Pmarinus_7.0:GL479261:19245:30070:1 g... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO386783.135e-1937.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299391.267e-1635.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446032.783e-1436.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482101.476e-826.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482113.662e-826.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA2D38.218e-5326.48voltage-dependent calcium channel subunit alpha-2/... [more]
CACNA2D35.921e-5226.33voltage-dependent calcium channel subunit alpha-2/... [more]
CACNA2D32.244e-5126.24voltage-dependent calcium channel subunit alpha-2/... [more]
cacna2d37.120e-5026.84voltage-dependent calcium channel subunit alpha-2/... [more]
cacna2d31.129e-4826.65voltage-dependent calcium channel subunit alpha-2/... [more]
back to top
BLAST of Voltage-dependent calcium channel subunit alpha-2/delta-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020654.10.000e+098.56SMESG000020654.1[more]
SMESG000020654.10.000e+096.55SMESG000020654.1[more]
SMESG000020648.10.000e+044.17SMESG000020648.1[more]
SMESG000020648.11.562e-644.18SMESG000020648.1[more]
SMESG000020648.11.392e-644.01SMESG000020648.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007566 ID=SMED30007566|Name=Voltage-dependent calcium channel subunit alpha-2/delta-3|organism=Schmidtea mediterranea sexual|type=transcript|length=3698bp
ACAGTATATAAGATTTGAGCGTGAAAAAATCAGCAAAGAATTCCGCCACG
CTTGATTGGTCAATTCAGATTCAATATTGATTATTGACGCTATCTATTAC
AGTTGTTGGATTTTATTGGATCATCGCAATGATTTCCAGTTCTCATTTAA
TGATCTCTTTATCGGTGATTTTACATTTCATTTTACCTTTTGGAAATTGT
CAAACTACTCAAGCAAACATAGACAGTTTAGTTACAACAATAGAAACTGC
TTTCAGTGGCTTGTCCAATTTTTTAAATGCTGATTTATTGTCTGCGAATT
TTGTTAACCTTAGTGCAACTTCGGTTAATGATAGCGTCGCAATAAATATT
CTGTCCAATAGTAAATCGGATACGGAACAATTAATAACCAAAGCCAATGG
CGTTATAAACCAAATTCAGTCCAACTTAACTTCGAAATATTCGCATTACG
AATCACCCATACTTTATCCAAATTGCTCAGTCAAAGTAATAACTTATTTC
CAAACTAAATCTATCACAAATTTTACCTATGAAAAAATTGATGATTGCAC
ATTTCAAACGCTGCCCTTTACACCTGACCCTTTCCTGGATAATATTCCCA
CGTGCAGAAACAGAACCACAACGCATATTCCAACATCGCTCTATGAATAT
TCAATCGAAGCCCAAATATTTGCCAACTGGACCCAAGATCTCGATCAACT
GTTCCGAGTAACAAAAGATGATTCACAACTTAAATGGAAATATTTTTGCA
GCTCATCAGGATTTGAAAGAATATATCCAGGAATCCGGTGGAAAATTCAA
AAAACAGACTCGTTTATCAATAATTCTCTTGTGGACTTTTATGACTGTCG
ATTTGAGATATTTTATTTACAATCTACAGCTTATCCTAAAAAAATGTTTA
TCATGGTTGATCAAAGTGGAAGCATGGAAGGTCGGAGTGTCATTATGACA
CTCAAAATAGTGAAAGAAATTCTCAATACCCTCACGGAGAATGATTTCTT
TAACATTGGATTATTTGGAATGAATTTAACTTTTGTTGATAGAAATGTAA
CTAAATTTCTTATTCAAGCCACAGATAAAAATAAATGGTTTTTATTGAAT
CAATTAAATCAAACTCTTGATCCTGCCAATAAAACAAATCTCAATTTATG
TTTAACCGAAGTATTCAATGTATTAAGAAAGGATAAAAATAATCAAACTG
GGAATATTATATATAATTACTTGGTGATGTTCATCACTGATGGGTCACTG
AGTCTGGTGGACAATTTCATGCAAAACGATATTGATGCAAGGATTTTTAC
CCATATAACGCAACAAGGAGCTTCTGACCGTTTTTCTATTAATAAAATCG
CGTGTAGCAATAGAGGGTATTCAGTTGAGAGTCAAACGTTATCTGATGTT
GTTCAAAACGTATTAACTTATTTGAAAGTTGTCTCAAGAAAGAATGCAAT
AATCCAAAATATTTTCAATATTTGGACTGGAGTACATCAAATCCAAATCA
AAGCTTCTGAAACATCCGATTTCCCAGGTTTCAGTGCGCAGACAACTAGT
ACAAGCACTTCCAAAGTATTCTCGACAACATTCCCGTCTTCTACTGCGAC
AAAATCTCCAACAGTATTCGCAATTCTGCAATCAACAGAATTTCAATTTG
TCCGGGAAAAACCAATACCCCTTTACGTTTCCACGGCAGCTGCTGTATAT
GACCAAAGCCCAAAAACAATCAACTCAAATGTTGGAAATGTTCTCGGGTC
AGTCGGACTTGATATATACGTCAACGAATTTGTTAAAACAGCCCCATTTT
GGAAGATTGGAGTTAACGCGTACTTATTTGGAATAACAAGCAATGGTTTT
CTGATCTTTCATCCAAAATTCAGACCCCAATACAAAAATTCCATGAAAAT
CTTTTACAGAAATGTTGACATTAGTGAAGTAGAAATTAGTTCAAATCTGA
CAATAGCTGAAATAAATGGCGATCAAACTATTCAACCGCCGAATACAGCA
TCGTTAAGACAAGAAATGCTTGATAATAATGCCGTGAAGCAATTTTCTAC
AAGTCTTGTAACATTTCAAATTTTGGATTCTTTTATAACAGGTTTCAAGG
TAAAACGGAATTATTTTATGGCGGGAATTAGTGGCACTCCATACAAATTT
GGGTTGGCTATACCAACCAATCAGATGGTTCCTGTTTACGCAAACAATAC
ATTCACCGTTTTAACATTAAGTGTTTTCCAAAATCTTTTTGGGATAAATT
TTGCCACATTTAACCAACAGTGCGGAGTTATAAATCTCAGTGAAAATCAA
AGCGGAATATTTATAAAGGATTATGAATTCTGTTTCATGACCCCGGAAAT
CGCAACATTACAGATGCTCAGTCCATTATGCACACTGATCAATGTTTTCG
TGAACAGCACCTTGTTGACAAAATGCACGTTCAATAACAGCGATAAGCTG
GCCTATTTAAACAATGTATACACAGAAATTACTAATTCTAGCAGCTTTAA
TATCAGCTGGTCAAGTTTAAATGGAAAAAATTTTTCTGTGCAACAAATAT
TTTCGATGCTTCATTTTGGTTTGATTCGTTACTACAACTATGAGAATTTG
TATTACCAGAATTTCATAAAAAATCACAGTGCCGGTATTGATGACTCTCT
GTACCAAGAAACGATTTTAACTGCACAATATTTTCAAAACAATCGGATTC
TTGTAGCCACGTCCTTGCCTAATCAAGGTTTGTTATTGCCATTTATTTGT
TTAATTTTGTTTTTAGTTTTTATGAATGTCAACAATTGGAATTCATTGGT
TTTCACAGTATCCACTCCATTAGTAAACAATGGGATTTATATTGGAGTTG
TAGGGGTTCAGGCTAAATTTGATTTTTATCAATCACTACTGAACAAAAGT
TTGATTTGTGCCAATAGTTCCGTAACGGAATGCTATATCATTACGGCGTC
TGGTGTGATTCTTTTCAATAATATCAATCTTACTTTTAACGGATTATCTT
TGAAAGACATCAACTGTGCAATAATGGAGAGCTTTGTAAATAACAATATA
TACAATACCCAATATTTCTACGACATGCAAGCTTTGTGCAACATTCTCTC
ACAACCAACGAGTTTCGGTAAAAGATTAATCAATCCGATTTCGGAACTTA
TTGGCCACCTAATTTGGGTGATTGGGCAACTATTTTTACTTATTAAGAAT
TTTTCATTAACAACATTAATGTGGGGTTTCTCATCATTTGAAGAAAATCC
ATTTTATAACGTATCCTCGGTGGAGAACTCCAGACCTTGCTATCTTAAAA
TCCCGGCGTACACAGTGACACCTTCAAACGTCCGAAGTAACGGGAGTGTA
TCAAATTGTCTGGGATGCAATCAAAATTTTTATATCCGATCCATCAACAA
TACAAATTTATTTCTTGTTGTCGTCGTGAAATCCGTCCCGAATTGTAAGT
GCATCTGTTCCAGCGCGTTTGGGAAGAGAGATGAATTGACAAGGAATATA
TTGAAACCTCTAGCAAATCCTTATCAAGTCAACCCAAATTTTTATTCGAA
GTTTGCAAATTTCTCAAAAATAGAAAACTCATCCGTCTGTAGCCACAGCT
TCAGGTCAAATTCGGCAAGCACAACGTTAATAAGTTCCATATTAATTGTG
TTGGCGGCAATTCATTGAATCCAAGATTTTCAACTGCTAGATCGGAAG
back to top

protein sequence of SMED30007566-orf-1

>SMED30007566-orf-1 ID=SMED30007566-orf-1|Name=SMED30007566-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1180bp
MISSSHLMISLSVILHFILPFGNCQTTQANIDSLVTTIETAFSGLSNFLN
ADLLSANFVNLSATSVNDSVAINILSNSKSDTEQLITKANGVINQIQSNL
TSKYSHYESPILYPNCSVKVITYFQTKSITNFTYEKIDDCTFQTLPFTPD
PFLDNIPTCRNRTTTHIPTSLYEYSIEAQIFANWTQDLDQLFRVTKDDSQ
LKWKYFCSSSGFERIYPGIRWKIQKTDSFINNSLVDFYDCRFEIFYLQST
AYPKKMFIMVDQSGSMEGRSVIMTLKIVKEILNTLTENDFFNIGLFGMNL
TFVDRNVTKFLIQATDKNKWFLLNQLNQTLDPANKTNLNLCLTEVFNVLR
KDKNNQTGNIIYNYLVMFITDGSLSLVDNFMQNDIDARIFTHITQQGASD
RFSINKIACSNRGYSVESQTLSDVVQNVLTYLKVVSRKNAIIQNIFNIWT
GVHQIQIKASETSDFPGFSAQTTSTSTSKVFSTTFPSSTATKSPTVFAIL
QSTEFQFVREKPIPLYVSTAAAVYDQSPKTINSNVGNVLGSVGLDIYVNE
FVKTAPFWKIGVNAYLFGITSNGFLIFHPKFRPQYKNSMKIFYRNVDISE
VEISSNLTIAEINGDQTIQPPNTASLRQEMLDNNAVKQFSTSLVTFQILD
SFITGFKVKRNYFMAGISGTPYKFGLAIPTNQMVPVYANNTFTVLTLSVF
QNLFGINFATFNQQCGVINLSENQSGIFIKDYEFCFMTPEIATLQMLSPL
CTLINVFVNSTLLTKCTFNNSDKLAYLNNVYTEITNSSSFNISWSSLNGK
NFSVQQIFSMLHFGLIRYYNYENLYYQNFIKNHSAGIDDSLYQETILTAQ
YFQNNRILVATSLPNQGLLLPFICLILFLVFMNVNNWNSLVFTVSTPLVN
NGIYIGVVGVQAKFDFYQSLLNKSLICANSSVTECYIITASGVILFNNIN
LTFNGLSLKDINCAIMESFVNNNIYNTQYFYDMQALCNILSQPTSFGKRL
INPISELIGHLIWVIGQLFLLIKNFSLTTLMWGFSSFEENPFYNVSSVEN
SRPCYLKIPAYTVTPSNVRSNGSVSNCLGCNQNFYIRSINNTNLFLVVVV
KSVPNCKCICSSAFGKRDELTRNILKPLANPYQVNPNFYSKFANFSKIEN
SSVCSHSFRSNSASTTLISSILIVLAAIH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036465vWFA_dom_sf
IPR013680VDCC_a2/dsu
IPR002035VWF_A
IPR013608VWA_N
Vocabulary: molecular function
TermDefinition
GO:0005244voltage-gated ion channel activity
GO:0005262calcium channel activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0034765regulation of ion transmembrane transport
GO:0070588calcium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013680Voltage-dependent calcium channel, alpha-2/delta subunit, conserved regionPFAMPF08473VGCC_alpha2coord: 927..1108
e-value: 9.3E-8
score: 31.3
NoneNo IPR availableGENE3DG3DSA:3.30.450.20coord: 525..681
e-value: 8.3E-10
score: 40.6
NoneNo IPR availablePANTHERPTHR10166:SF60STRAIGHTJACKET, ISOFORM Ccoord: 139..1142
NoneNo IPR availablePANTHERPTHR10166VOLTAGE-DEPENDENT CALCIUM CHANNEL SUBUNIT ALPHA-2/DELTA-RELATEDcoord: 139..1142
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.792
NoneNo IPR availableTMHMMTMhelixcoord: 888..910
NoneNo IPR availableTMHMMTMhelixcoord: 859..881
IPR036465von Willebrand factor A-like domain superfamilyGENE3DG3DSA:3.40.50.410coord: 255..432
e-value: 2.4E-11
score: 45.9
IPR036465von Willebrand factor A-like domain superfamilySUPERFAMILYSSF53300vWA-likecoord: 255..426
IPR002035von Willebrand factor, type APFAMPF00092VWAcoord: 257..422
e-value: 7.2E-6
score: 26.4
IPR013608VWA N-terminalPFAMPF08399VWA_Ncoord: 118..221
e-value: 8.0E-18
score: 65.1