ATP-binding cassette sub-family A member 1

Overview
NameATP-binding cassette sub-family A member 1
Smed IDSMED30007539
Length (bp)2554
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007539

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30007539SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007539SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007539SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30007539SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30007539SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30007539SMESG000032891.1 SMESG000029537.1 Contig8654newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30007539SMESG000032891.1 SMESG000029537.1 Contig8654uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30007539SMESG000032896.1 SMESG000029537.1 SMESG000029534.1 dd_Smed_v4_2300_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:29])

HSP 1 Score: 375.17 bits (962), Expect = 1.296e-110
Identity = 292/929 (31.43%), Postives = 472/929 (50.81%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG--------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWS--PIP--------NGNIPL--ISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF-----QRLSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF-------YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 ++  ++++  +  S++G                +   I+ H+ +A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG+S+T+LEE+F++VA++ + ++ ET +  L P   NR A +GD ++   PF   D  D N      +S    L+S    +    ++G+ L +QQ + L  KR   A+R++KG FA+++LP + + + +    +V P    P++E+ PW+            +  +   ++       G    +N LT         D G  G RCM  +    T  +   E    +W+  P+P        NGN  +   SP C C++   +    +C     G P    R   ++D L +LTG NISDYL+K +     + L  KI      +GG+   + N  A         P    + D++ Q +      ++    RFL     F      T N  ++W N+KG+ ++ ++ N+++N +LR+ ++  +N  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L  INDILK VFLIFP F LGRG++D+  N         +  N  V    + L WD+ G  LF++    + ++++ ++I+     R      K S L      N ED DV  ER+R+      +D+L +  LTKIY                     + R+ AV+ +C G+  GECFGLLGVNGAGK++TF
Sbjct: 1098 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE-SGVDAETSDGTL-PARRNRRA-FGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWM------------YNEQYTFVSNDAPEDTGTLELLNALT--------KDPG-FGTRCMEGNPIPDTPCQAGEE----EWTTAPVPQTIMDLFQNGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGLP-PPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNTQAL--------PPSQEVNDAIKQMKKHLKLAKDSSADRFLNSLGRFMT-GLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTDN--KLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFV----SPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVNAKLSPL------NDEDEDVRRERQRILDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTF 1956          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA7 (ATP binding cassette subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:37])

HSP 1 Score: 343.969 bits (881), Expect = 6.552e-100
Identity = 274/915 (29.95%), Postives = 453/915 (49.51%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-------------------NFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAK---INEETKNEKL--------IPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGN-IP-LISPECDCNTTGYQ-ICND--PRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRK-----------IFGGYQFLLPNDFAQSSKLIAQS---------PTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNS--NSIVKHEYNA-LQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRN-----TEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DR+A+++ G+L CCGS +FL+R  G GY L LVK                   +   +K+N  +G      +LL  ++  +P A++  E   +   VLP   ++   F+ LF  LD  +  L    YG+SDTSLEE+F++V ++ A    + + +  + L        +   L        +EN EP     + +Q +  D         R    ++G+ L +QQ+  L +KRF  A+R+++G+FA+++LP L + L +    +V P    PA+ +SP             T Y    Q++F   +  G+      L   L+        E+G+    P +  S+H    PE        + +GN  P   SP C C+  G + +  D    +GGPP    +  S + + NLTG N+SD+L+K + RL R+            +GG+     +    S + + +S         P   G  D             R LK    + + S    +  +IW N+KG+ SM A+ N  SN +LR+ +        + I+  N+P+  ++ ++S+   +   ++V ++I V+ A+SF+ ASF + LI+ER++ +K  Q + G++P +YW+ NFLWD+  Y++P  I+++IF+AF  ++Y+   N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G   +++TF+L++   + + L+E++ ILK+VFLIFP F LGRG++D+  N         +   ++ + L+W++ G+ L +           ++I     +   +  + ++  L +  +R+      ED DV  ERER+       DVL + NLTK+Y            +G+        R  AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1005 GDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGSCGQHLCTGIAGLDVTLRLKMPPQETALENGEPAGSAPETDQGSGPDA------VGR----VQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSP-------------TMYGA--QVSFFSEDAPGDPGRARLLEALLQ--------EAGLE--EPPVQHSSHRFSAPEVPAEVAKVLASGNWTPESPSPACQCSRPGARRLLPDCPAAAGGPPPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELWALLSPLPGGALD-------------RVLKNLTAWAH-SLDAQDSLKIWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHAHSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELF--SDQKLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDRQFQSPLRWEVVGKNLLA-----------MVIQGPLFLLFTLLLQHRSQLLPQPRVRSLPLLGEEDEDVARERERVVQGATQGDVLVLRNLTKVY------------RGQ--------RMPAVDRLCLGIPPGECFGLLGVNGAGKTSTF 1837          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA4 (ATP binding cassette subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:34])

HSP 1 Score: 333.954 bits (855), Expect = 1.497e-96
Identity = 269/919 (29.27%), Postives = 441/919 (47.99%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILV---KNFNAQKENFR-------KGISNS---------------GD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHK--------------LLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKE-NQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYR--STHYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSR-----------KIFGGYQF--LLPNDFAQSSKLIAQSPTWDGIRDSVNQ--SQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYN---SNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESG-IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAII+QG+L C G+ +FLK  FG G  L LV   KN  +Q++          KG S +               GD  +L+  +  H+P+AK+      +  F+LP  +     ++ LF  L+E + +L   S+G+SDT LEE+F++V +D           +   +N+N          + P L   +   Q   D ++ S      H               L  G  L+ Q +  L +KRF +  R+ K   A+++LP   + L + L  ++ P    PA+ + PW+   +    +++    ++   L   + N+ G  N    L +    EY          C N + ++  S        ++  KW+ +        SP C C+T    T    C +  +GG P   R   S++ L +LT  NISD+L+K +  L R           + +GG      LP        L+        I +      ++  + E   FLK+ +        T +  ++W N+KG+ ++ ++ N+  N +LR+ +   ++   YGI+V + P+  ++ ++S+   L   ++  +AI VI ++SF+ ASFV++LI ER++ SK  QF+SG++P  YWV+NFLWDIM Y +   +++ IFI F  ++Y   +N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TFIL++ E N   L+  N +L+K+ ++FP F LGRG++DL  +       +    +H  N   WD+ G+ LF++    + ++++ ++++    +++ I    K   +        ED DV  ER+R+ +     D+LR+  LTKIY                          AV+ LC GVR GECFGLLGVNGAGKTTTF
Sbjct: 1127 GDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVN---------PRHPCLGPREKAGQTPQDSNVCSPGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWIYGQQYTFFSMDEPGSEQFTVLADVLLNKPGFGNRC--LKEGWLPEYP---------CGNSTPWKTPSVSPNITQLFQKQKWTQVNP------SPSCRCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPVVPITGEALVGFLSDLGRIMNVSGGPITREASKEIPDFLKHLE--------TEDNIKVWFNNKGWHALVSFLNVAHNAILRASLPKDRSPEEYGITVISQPLNLTKEQLSEITVLTTSVDAVVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFENNRTLLR-FNAVLRKLLIVFPHFCLGRGLIDLALSQAVTDVYARFGEEHSANPFHWDLIGKNLFAMVVEGVVYFLLTLLVQRHFFLSQWIAEPTKEPIVD-------EDDDVAEERQRIITGGNKTDILRLHELTKIY--------------------PGTSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTF 1982          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA4 (ATP binding cassette subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:34])

HSP 1 Score: 303.523 bits (776), Expect = 5.291e-88
Identity = 240/837 (28.67%), Postives = 403/837 (48.15%), Query Frame = 2
Query:  167 LQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHK--------------LLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKE-NQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYR--STHYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSR-----------KIFGGYQF--LLPNDFAQSSKLIAQSPTWDGIRDSVNQ--SQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYN---SNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESG-IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            +  +  H+P+AK+      +  F+LP  +     ++ LF  L+E + +L   S+G+SDT LEE+F++V +D           +   +N+N          + P L   +   Q   D ++ S      H               L  G  L+ Q +  L +KRF +  R+ K   A+++LP   + L + L  ++ P    PA+ + PW+   +    +++    ++   L   + N+ G  N    L +    EY          C N + ++  S        ++  KW+ +        SP C C+T    T    C +  +GG P   R   S++ L +LT  NISD+L+K +  L R           + +GG      LP        L+        I +      ++  + E   FLK+ +        T +  ++W N+KG+ ++ ++ N+  N +LR+ +   ++   YGI+V + P+  ++ ++S+   L   ++  +AI VI ++SF+ ASFV++LI ER++ SK  QF+SG++P  YWV+NFLWDIM Y +   +++ IFI F  ++Y   +N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TFIL++ E N   L+  N +L+K+ ++FP F LGRG++DL  +       +    +H  N   WD+ G+ LF++    + ++++ ++++    +++ I    K   +        ED DV  ER+R+ +     D+LR+  LTKIY                          AV+ LC GVR GECFGLLGVNGAGKTTTF
Sbjct:    1 MDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVN---------PRHPCLGPREKAGQTPQDSNVCSPGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWIYGQQYTFFSMDEPGSEQFTVLADVLLNKPGFGNRC--LKEGWLPEYP---------CGNSTPWKTPSVSPNITQLFQKQKWTQVNP------SPSCRCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPVVPITGEALVGFLSDLGRIMNVSGGPITREASKEIPDFLKHLE--------TEDNIKVWFNNKGWHALVSFLNVAHNAILRASLPKDRSPEEYGITVISQPLNLTKEQLSEITVLTTSVDAVVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFENNRTLLR-FNAVLRKLLIVFPHFCLGRGLIDLALSQAVTDVYARFGEEHSANPFHWDLIGKNLFAMVVEGVVYFLLTLLVQRHFFLSQWIAEPTKEPIVD-------EDDDVAEERQRIITGGNKTDILRLHELTKIY--------------------PGTSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTF 774          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA2 (ATP binding cassette subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:32])

HSP 1 Score: 276.944 bits (707), Expect = 2.465e-77
Identity = 175/541 (32.35%), Postives = 278/541 (51.39%), Query Frame = 2
Query:  965 PEYKNNKWSPIPNGNIPLISPE---CDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQ-NSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNAL----QWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNT---EDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            P      W+  P+  +P +  E   C C+  G         GG P   R++T  D L ++TG+N+S+YLL    R     +G   F           ++   P   G R       P  +  +   +  Q F+              N+KGY SMP Y N L+N +LR+ +  S+ N   YGI+VTN+P+  +   +S    L   +V +AI++I+A+SF+ ASFV+FL+ E+ + +K  QFVSG NP +YW++N++WD++ Y++P    +II   FD  +Y    N  A + L + YG +I P MYP SF+   PS+A+V L   NL +G   T++TF+L + E + + LK +N  LK  FLIFP +NLG G+M++ +N + N       +++ +    +WDI    L ++    +  +++ I+ +   + R           +R+ +      +D DV  ER+R+      +D++++ NLTK+Y                   +   R +AV+ LC GVR GECFGLLGVNGAGKT+TF
Sbjct: 1618 PTAGPEMWTSAPS--LPRLVREPVRCTCSAQGTGFSCPSSVGGHPPQMRVVTG-DILTDITGHNVSEYLLFTSDRFRLHRYGAITF---------GNVLKSIPASFGTR------APPMVRKIAVRRAAQVFY--------------NNKGYHSMPTYLNSLNNAILRANLPKSKGNPAAYGITVTNHPMNKTSASLSLDYLLQGTDVVIAIFIIVAMSFVPASFVVFLVAEKSTKAKHLQFVSGCNPIIYWLANYVWDMLNYLVPATCCVIILFVFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITATVATFLLQLFEHDKD-LKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEYYAKIGQFDKMKSPFEWDIVTRGLVAMAVEGVVGFLLTIMCQYNFLRRP----------QRMPVSTKPVEDDVDVASERQRVLRGDADNDMVKIENLTKVYKS-----------------RKIGRILAVDRLCLGVRPGECFGLLGVNGAGKTSTF 2098          

HSP 2 Score: 116.316 bits (290), Expect = 1.094e-25
Identity = 91/308 (29.55%), Postives = 147/308 (47.73%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGD-----------KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD-------PAKINEETKNEKLIP------------DNLNRIA----------------------------VYGDIENQEPFLD-LEDLNQQAFVDKSLISLN-FNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISP 748
            DRIAIIS GKL+CCGS +FLK  +GDGYRL LVK           G+++S             ++ QFI+ H+    + ++T T+ S++LP   +    F  LF +L+  +D L+  S+GL DT+LEEVF++V+++        A + E  K+  ++P             NL R +                            VYGD     P  D  +D +  +  +    +L+   +  + L G  L  +Q  GL +KRFH A+RN K +F++++LP   + + + +   V  +  LP + +SP
Sbjct: 1190 DRIAIISHGKLKCCGSPLFLKGTYGDGYRLTLVKRPAEPGGPQEPGLASSPPGRAPLSSCSELQVSQFIRKHVASCLLVSDTSTELSYILPSEAAKKGAFERLFQHLERSLDALHLSSFGLMDTTLEEVFLKVSEEDQSLENSEADVKESRKD--VLPGAEGPASGEGHAGNLARCSELTQSQASLQSASSVGSARGDEGAGYTDVYGDY---RPLFDNPQDPDNVSLQEVEAEALSRVGQGSRKLDGGWLKVRQFHGLLVKRFHCARRNSKALFSQILLPAFFVCVAMTVALSVPEIGDLPPLVLSP 1492          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 143.28 bits (360), Expect = 1.912e-34
Identity = 154/556 (27.70%), Postives = 255/556 (45.86%), Query Frame = 2
Query: 1031 CDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDY-LLKNFQRLSRKI----FGGYQFLLPNDFAQSSKLIAQSPT-W-DGIRD-------------SVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFS---RIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIY----VILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIC-SKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLG----RGIMDLFFNYFYNSNSIVKHEY----------NALQWDIAGEKLFSLFSLSIGWWIVLI---IIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSS---DQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            C C   G+    +       N  R+ T+ D++ +LTG N++ + L+  F +L+        GG+     N  AQS   I  S   W + I+D              +  + P+ L+P        +  N   + ++     ++W N+K +   P  +NILSN LLR     + +  + GI   N+P+  + ++    N L   +  LA++    ++L LS I A F ++L+++RI  +   Q V G+    YWV+++L+D++ Y + II+I++I++ F    +        AF+LL   +G++ I + Y F    S  + +FV++   +  VG +  ++  +L+ L V    L   + +   VFL+ PQ+NLG    RG+M ++      SN + +             + L +D  G  +  LF   I   I LI   + E G V R     L ++ + R E    +D DV  ER+R+ +   D   +  L V NL K YN  L                     +AV  + F V  GECFGLLG+NGAGKTTTF
Sbjct: 1317 CGCEDFGWNCTLEDWKWNETNWLRLNTT-DRIFDLTGRNLTQFRLITRFAQLANTTAPFFLGGFSLGHVNQRAQSQADIDTSKRGWLETIKDIAQSMRIINLNTTGIEPATPKVLDPFAQNITLNQVVNDLLQNLDVRENVKVWFNNKIWPGFPIASNILSNALLRQE-DYAIDPEDLGILTMNHPMNKTISQTLDQNALKFTQA-LAVFRITILLLVLSMIPAGFTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLGIAIFRGLM-IYQVRAIGSNFLQQMNRPDMINQLPLPSLLAFDQMGIHIMCLFIHVIIATICLIFSQMDEFGFV-RKRERNLTDAMMLR-EPSTCDDEDVVKERQRVDAIPMDSSDNHALIVRNLAKAYNPEL---------------------LAVKGISFAVEPGECFGLLGLNGAGKTTTF 1845          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 143.28 bits (360), Expect = 2.089e-34
Identity = 154/556 (27.70%), Postives = 255/556 (45.86%), Query Frame = 2
Query: 1031 CDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDY-LLKNFQRLSRKI----FGGYQFLLPNDFAQSSKLIAQSPT-W-DGIRD-------------SVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFS---RIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIY----VILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYIC-SKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLG----RGIMDLFFNYFYNSNSIVKHEY----------NALQWDIAGEKLFSLFSLSIGWWIVLI---IIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSS---DQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            C C   G+    +       N  R+ T+ D++ +LTG N++ + L+  F +L+        GG+     N  AQS   I  S   W + I+D              +  + P+ L+P        +  N   + ++     ++W N+K +   P  +NILSN LLR     + +  + GI   N+P+  + ++    N L   +  LA++    ++L LS I A F ++L+++RI  +   Q V G+    YWV+++L+D++ Y + II+I++I++ F    +        AF+LL   +G++ I + Y F    S  + +FV++   +  VG +  ++  +L+ L V    L   + +   VFL+ PQ+NLG    RG+M ++      SN + +             + L +D  G  +  LF   I   I LI   + E G V R     L ++ + R E    +D DV  ER+R+ +   D   +  L V NL K YN  L                     +AV  + F V  GECFGLLG+NGAGKTTTF
Sbjct: 1280 CGCEDFGWNCTLEDWKWNETNWLRLNTT-DRIFDLTGRNLTQFRLITRFAQLANTTAPFFLGGFSLGHVNQRAQSQADIDTSKRGWLETIKDIAQSMRIINLNTTGIEPATPKVLDPFAQNITLNQVVNDLLQNLDVRENVKVWFNNKIWPGFPIASNILSNALLRQE-DYAIDPEDLGILTMNHPMNKTISQTLDQNALKFTQA-LAVFRITILLLVLSMIPAGFTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLGIAIFRGLM-IYQVRAIGSNFLQQMNRPDMINQLPLPSLLAFDQMGIHIMCLFIHVIIATICLIFSQMDEFGFV-RKRERNLTDAMMLR-EPSTCDDEDVVKERQRVDAIPMDSSDNHALIVRNLAKAYNPEL---------------------LAVKGISFAVEPGECFGLLGLNGAGKTTTF 1808          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 118.627 bits (296), Expect = 8.405e-27
Identity = 90/340 (26.47%), Postives = 168/340 (49.41%), Query Frame = 2
Query: 1565 LLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIF-YGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFL-IFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDF--------DVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            L++V LA  +IL  + ++++FV+FLI+ER      QQF++GI+P  ++ ++ ++D + Y +  +I + +F+AF +       + LA ++L  F Y  + +P +Y  SF   +PS A V+L  + +++     ++ F++ ++    E+LK    IL  +F+ + P +  G  I+ +      N+  ++      + WD  G+  + + +  +  + + ++++   V R +    +   ++R    N +           V+ ERER+      +  L + +LTK +                       R  AVN LC  V + ECFGLLGVNGAGKTTTF
Sbjct: 1175 LIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLK---SILVNIFMFLLPSYAFGSAIITI------NTYGMILPSEELMNWDHCGKNAWLMGTFGVCSFALFVLLQFKFVRRFLS---QVWTVRRSSHNNVQPMMGDLPVCESVSEERERVHRVNSQNSALVIKDLTKTF----------------------GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTF 1475          

HSP 2 Score: 57.3806 bits (137), Expect = 5.334e-8
Identity = 59/233 (25.32%), Postives = 100/233 (42.92%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISN----------SGDKLLQFIKSHIPDA-KMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFL-----DLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAE 655
            D + I+S GKL   G++ +LK+KFG GY L +V + N  K      +++           G+   Q I+  +P+A K E   + Q    +   +  S  F  +   L  ++  L   S+GLS  +LE+VFI + D   K     +N ++  ++ N           EP L     D +   + A   + L+        K   G   +  Q I +  K+F Y++RN   +F +
Sbjct:  799 DWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSRNA---------SEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEK--SGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 1020          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 118.242 bits (295), Expect = 1.088e-26
Identity = 90/340 (26.47%), Postives = 168/340 (49.41%), Query Frame = 2
Query: 1565 LLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIF-YGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFL-IFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDF--------DVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            L++V LA  +IL  + ++++FV+FLI+ER      QQF++GI+P  ++ ++ ++D + Y +  +I + +F+AF +       + LA ++L  F Y  + +P +Y  SF   +PS A V+L  + +++     ++ F++ ++    E+LK    IL  +F+ + P +  G  I+ +      N+  ++      + WD  G+  + + +  +  + + ++++   V R +    +   ++R    N +           V+ ERER+      +  L + +LTK +                       R  AVN LC  V + ECFGLLGVNGAGKTTTF
Sbjct: 1106 LIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLK---SILVNIFMFLLPSYAFGSAIITI------NTYGMILPSEELMNWDHCGKNAWLMGTFGVCSFALFVLLQFKFVRRFLS---QVWTVRRSSHNNVQPMMGDLPVCESVSEERERVHRVNSQNSALVIKDLTKTF----------------------GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTF 1406          

HSP 2 Score: 57.3806 bits (137), Expect = 5.485e-8
Identity = 59/233 (25.32%), Postives = 100/233 (42.92%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISN----------SGDKLLQFIKSHIPDA-KMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFL-----DLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAE 655
            D + I+S GKL   G++ +LK+KFG GY L +V + N  K      +++           G+   Q I+  +P+A K E   + Q    +   +  S  F  +   L  ++  L   S+GLS  +LE+VFI + D   K     +N ++  ++ N           EP L     D +   + A   + L+        K   G   +  Q I +  K+F Y++RN   +F +
Sbjct:  732 DWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSRNA---------SEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEK--SGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 953          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 117.857 bits (294), Expect = 1.231e-26
Identity = 90/340 (26.47%), Postives = 168/340 (49.41%), Query Frame = 2
Query: 1565 LLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIF-YGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFL-IFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDF--------DVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            L++V LA  +IL  + ++++FV+FLI+ER      QQF++GI+P  ++ ++ ++D + Y +  +I + +F+AF +       + LA ++L  F Y  + +P +Y  SF   +PS A V+L  + +++     ++ F++ ++    E+LK    IL  +F+ + P +  G  I+ +      N+  ++      + WD  G+  + + +  +  + + ++++   V R +    +   ++R    N +           V+ ERER+      +  L + +LTK +                       R  AVN LC  V + ECFGLLGVNGAGKTTTF
Sbjct: 1121 LIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLK---SILVNIFMFLLPSYAFGSAIITI------NTYGMILPSEELMNWDHCGKNAWLMGTFGVCSFALFVLLQFKFVRRFLS---QVWTVRRSSHNNVQPMMGDLPVCESVSEERERVHRVNSQNSALVIKDLTKTF----------------------GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTF 1421          

HSP 2 Score: 57.3806 bits (137), Expect = 5.730e-8
Identity = 59/233 (25.32%), Postives = 100/233 (42.92%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISN----------SGDKLLQFIKSHIPDA-KMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFL-----DLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAE 655
            D + I+S GKL   G++ +LK+KFG GY L +V + N  K      +++           G+   Q I+  +P+A K E   + Q    +   +  S  F  +   L  ++  L   S+GLS  +LE+VFI + D   K     +N ++  ++ N           EP L     D +   + A   + L+        K   G   +  Q I +  K+F Y++RN   +F +
Sbjct:  745 DWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSRNA---------SEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEK--SGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 966          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: CG34120 (gene:FBgn0083956 transcript:FBtr0110827)

HSP 1 Score: 122.865 bits (307), Expect = 4.769e-28
Identity = 105/402 (26.12%), Postives = 195/402 (48.51%), Query Frame = 2
Query: 1382 SRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEV---TLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN------ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGE--KGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            + +W N+KGY SM A+ N L++ LLR+ +  S++S    I   N P      ++S   + IL +    ++   +++A   + AS  ++L++ER++G K QQ + G++   YW+   +WD +  ++ +I+ +++ + F    ++  +  +  I L + +  A +P ++      S  S A V +   NL+V  +T     IL ++     +  +    L + FLIFP   LG G ++L  NY     ++V   Y+       L  D+ G    +L  + +   I+ ++IE  ++ R+          +R+E       D    RE     Q     L+++N+  I+   +    + GE  + ++ ++  +    AV N+ F V+ GECFGLLG NGAGK+T F
Sbjct: 1324 ATVWYNNKGYHSMMAWLNDLNSELLRTTMNDSESS----ILTLNEPWKLGFAELS--TSSILRQAGDGSMVFILLIAFGLVVASGSVYLVNERVNGEKLQQRLCGVSAVTYWLVALVWDYLVMVLGLIVCLVVILMFGMPVFVDRQQLVGIIGLSLAFSFACVPSVHVAEKIFSDSSIAIVSIFCANLIVPLVTMGIILILGVVGDGPAW-DDWRHALNQAFLIFPIHALGDGFLELCKNYMV---ALVFRRYDIDSYKHPLASDLLGRHFTALLLVGVAALIINVLIEWHLLRRL---------WQRVE----RLLDCTYRRELDKLGQ-----LKLVNIQSIFKSCV----DTGEAVRAENLWLAYRRGHYAVRNVNFSVQRGECFGLLGKNGAGKSTIF 1693          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: CG34120 (gene:FBgn0083956 transcript:FBtr0343018)

HSP 1 Score: 122.865 bits (307), Expect = 5.065e-28
Identity = 105/402 (26.12%), Postives = 195/402 (48.51%), Query Frame = 2
Query: 1382 SRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEV---TLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN------ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGE--KGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            + +W N+KGY SM A+ N L++ LLR+ +  S++S    I   N P      ++S   + IL +    ++   +++A   + AS  ++L++ER++G K QQ + G++   YW+   +WD +  ++ +I+ +++ + F    ++  +  +  I L + +  A +P ++      S  S A V +   NL+V  +T     IL ++     +  +    L + FLIFP   LG G ++L  NY     ++V   Y+       L  D+ G    +L  + +   I+ ++IE  ++ R+          +R+E       D    RE     Q     L+++N+  I+   +    + GE  + ++ ++  +    AV N+ F V+ GECFGLLG NGAGK+T F
Sbjct: 1325 ATVWYNNKGYHSMMAWLNDLNSELLRTTMNDSESS----ILTLNEPWKLGFAELS--TSSILRQAGDGSMVFILLIAFGLVVASGSVYLVNERVNGEKLQQRLCGVSAVTYWLVALVWDYLVMVLGLIVCLVVILMFGMPVFVDRQQLVGIIGLSLAFSFACVPSVHVAEKIFSDSSIAIVSIFCANLIVPLVTMGIILILGVVGDGPAW-DDWRHALNQAFLIFPIHALGDGFLELCKNYMV---ALVFRRYDIDSYKHPLASDLLGRHFTALLLVGVAALIINVLIEWHLLRRL---------WQRVE----RLLDCTYRRELDKLGQ-----LKLVNIQSIFKSCV----DTGEAVRAENLWLAYRRGHYAVRNVNFSVQRGECFGLLGKNGAGKSTIF 1694          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: CG34120 (gene:FBgn0083956 transcript:FBtr0299591)

HSP 1 Score: 122.479 bits (306), Expect = 6.588e-28
Identity = 105/402 (26.12%), Postives = 195/402 (48.51%), Query Frame = 2
Query: 1382 SRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEV---TLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN------ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGE--KGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            + +W N+KGY SM A+ N L++ LLR+ +  S++S    I   N P      ++S   + IL +    ++   +++A   + AS  ++L++ER++G K QQ + G++   YW+   +WD +  ++ +I+ +++ + F    ++  +  +  I L + +  A +P ++      S  S A V +   NL+V  +T     IL ++     +  +    L + FLIFP   LG G ++L  NY     ++V   Y+       L  D+ G    +L  + +   I+ ++IE  ++ R+          +R+E       D    RE     Q     L+++N+  I+   +    + GE  + ++ ++  +    AV N+ F V+ GECFGLLG NGAGK+T F
Sbjct: 1308 ATVWYNNKGYHSMMAWLNDLNSELLRTTMNDSESS----ILTLNEPWKLGFAELS--TSSILRQAGDGSMVFILLIAFGLVVASGSVYLVNERVNGEKLQQRLCGVSAVTYWLVALVWDYLVMVLGLIVCLVVILMFGMPVFVDRQQLVGIIGLSLAFSFACVPSVHVAEKIFSDSSIAIVSIFCANLIVPLVTMGIILILGVVGDGPAW-DDWRHALNQAFLIFPIHALGDGFLELCKNYMV---ALVFRRYDIDSYKHPLASDLLGRHFTALLLVGVAALIINVLIEWHLLRRL---------WQRVE----RLLDCTYRRELDKLGQ-----LKLVNIQSIFKSCV----DTGEAVRAENLWLAYRRGHYAVRNVNFSVQRGECFGLLGKNGAGKSTIF 1677          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0306679)

HSP 1 Score: 113.235 bits (282), Expect = 4.090e-25
Identity = 120/432 (27.78%), Postives = 204/432 (47.22%), Query Frame = 2
Query: 1364 SKTMNFSRI--WINSKGYASMPAYANILSNL----LLRSRIKLSQNSWNYGISVTNYPIA-DSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEY-LKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNAL-------------------QWDIAGEKLFSLFSLSIG--WWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTE---DFDVNLERER---MSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            + T+  S+I  W+N++   + P   N++ N     L  S +K         I VTN P+   + T +SQ +    L   LA  +   + F+S+ +++FLI ER S +K  QFV G+  + +W+S F+ D   YI+  +I++I  + F             + LLL+ +G A++P +Y  S F   P+T F  ++  N+  G    ++ FI+ ++  +  +  K+  DIL  +F IFP F+L   +  ++ N     N+  K    AL                    W+  G    +++    G  +++++I++E  ++N ++  K++   + +     TE   D DV  ERER   MSS++ +   L +  +TK Y  ++                      AVN +   V+E ECFGLLGVNGAGKTTTF
Sbjct: 1020 AATITESKITAWLNNQALHTAPLTVNMVHNAIADKLFGSSVK---------IQVTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCG----MALFIVVVVMSSELFDTKDTADILGWIFRIFPHFSLAMSLNKVYTNT-ATRNACAKA--GALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINELMF-KIRQ-LISKPPPPPTEGQLDDDVANERERILQMSSNELATKNLVLDRVTKYYGQFM----------------------AVNQVSLCVQEVECFGLLGVNGAGKTTTF 1411          

HSP 2 Score: 87.8113 bits (216), Expect = 3.250e-17
Identity = 70/212 (33.02%), Postives = 104/212 (49.06%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNK 637
             DRIAI+  G+L+C G+S FLK+++G GYRLI VK  + +            +++   +  +IP  K E +   + S+ LP  DS S KF  +F  L+E+ D L+   YG+  TS+EEVF++V  +               DN   I    +I N       ED N+    D       F+ N +LL+G  LL  Q   + +K+F Y  RNK
Sbjct:  734 GDRIAIMCDGELKCQGTSFFLKKQYGSGYRLICVKRDDCET-----------NEVTALLNKYIPGLKPECDIGAELSYQLP--DSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAE--------------KDNTGNIKDQHEIMNGGSGFRGEDDNESVQSDGI-----FSENRRLLQGLQLLSNQWKAMLLKKFLYTWRNK 913          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332489)

HSP 1 Score: 113.235 bits (282), Expect = 4.707e-25
Identity = 120/432 (27.78%), Postives = 204/432 (47.22%), Query Frame = 2
Query: 1364 SKTMNFSRI--WINSKGYASMPAYANILSNL----LLRSRIKLSQNSWNYGISVTNYPIA-DSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEY-LKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNAL-------------------QWDIAGEKLFSLFSLSIG--WWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTE---DFDVNLERER---MSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            + T+  S+I  W+N++   + P   N++ N     L  S +K         I VTN P+   + T +SQ +    L   LA  +   + F+S+ +++FLI ER S +K  QFV G+  + +W+S F+ D   YI+  +I++I  + F             + LLL+ +G A++P +Y  S F   P+T F  ++  N+  G    ++ FI+ ++  +  +  K+  DIL  +F IFP F+L   +  ++ N     N+  K    AL                    W+  G    +++    G  +++++I++E  ++N ++  K++   + +     TE   D DV  ERER   MSS++ +   L +  +TK Y  ++                      AVN +   V+E ECFGLLGVNGAGKTTTF
Sbjct:  998 AATITESKITAWLNNQALHTAPLTVNMVHNAIADKLFGSSVK---------IQVTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCG----MALFIVVVVMSSELFDTKDTADILGWIFRIFPHFSLAMSLNKVYTNT-ATRNACAKA--GALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINELMF-KIRQ-LISKPPPPPTEGQLDDDVANERERILQMSSNELATKNLVLDRVTKYYGQFM----------------------AVNQVSLCVQEVECFGLLGVNGAGKTTTF 1389          

HSP 2 Score: 87.8113 bits (216), Expect = 3.294e-17
Identity = 70/212 (33.02%), Postives = 104/212 (49.06%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNK 637
             DRIAI+  G+L+C G+S FLK+++G GYRLI VK  + +            +++   +  +IP  K E +   + S+ LP  DS S KF  +F  L+E+ D L+   YG+  TS+EEVF++V  +               DN   I    +I N       ED N+    D       F+ N +LL+G  LL  Q   + +K+F Y  RNK
Sbjct:  712 GDRIAIMCDGELKCQGTSFFLKKQYGSGYRLICVKRDDCET-----------NEVTALLNKYIPGLKPECDIGAELSYQLP--DSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAE--------------KDNTGNIKDQHEIMNGGSGFRGEDDNESVQSDGI-----FSENRRLLQGLQLLSNQWKAMLLKKFLYTWRNK 891          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 387.111 bits (993), Expect = 7.871e-115
Identity = 293/931 (31.47%), Postives = 479/931 (51.45%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG---DK-------------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQ--EPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCM-NPSIYRSTHYRCFPEYKNNKWSP--IPNGNIPLI----------SPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQR-----LSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDG----IRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIV--NRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 +F  + +N  +  S++G   D+             + + I  H+P A+M  +   + ++VLP   + +  F  LF +LD+ + +L   SYG+SDT+LEE+F++VA+D + ++ E  ++  +P    R   +G       +P    D  D N+     +S     +S +  +    ++G+ L +QQ + L  KR  YA+R++KG FA+++LP + + + +    +V P    P++ ++PW+                E Q  F            +  T +L      D G  G RCM   SI  +    C     + +WS   +P   I ++          SP C+C+  G +     C     G PP   +I + ++ L NLTG NISDYL+K + +     L  KI      +GG+        A+S++++  +   D     +R+     +       RFLK    F N    T N  +IW N+KG+ S+ A+ N+++N +LR+ +   ++   +GI+  N+P+  ++ ++SQ   +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ PY+YW++NFLWD+  Y++P  ++I+IF+ F  ++Y+ + N     LLL+ YG +I P MYP SF    PSTA+VVL + N+L+G   +ISTF++++   N+E +  INDILK V LIFP F LGRG++D+  N    ++++ +   N     L+WD+ G+ LF++    + ++I+ ++I+       + +C KL             ED DV  ER+R+ S     D+L +  LTK+Y                     + ++ AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1100 GDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAED-SGVDTEMLSDGTLPVRRQRRHAFGADHQSCLKPLTEDDSFDCNESEGDPESKETDYLSGSDGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALNPWMY---------------EEQFMF-----FSEDAPYDVSTHKLLRALFDDPG-FGTRCMKGESIPDAP---C--TMGDEEWSTPEVPESIIEILTTRNWTMNDPSPACECSCNGKKKMLPECPAGAGGLPPPQIKI-SETETLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSL-----GARSTQVLPPAEEIDDAISRVREIFQLGKDSGSAADRFLKSLSAFIN-GLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRANLPPGKDPSEFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPYLYWLANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPSTAYVVLTSVNILIGINGSISTFVMELFG-NHE-IGGINDILKNVLLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFEPKSLCPKLSPI--------GEEDEDVARERQRIMSGAGQGDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTF 1965          

HSP 2 Score: 51.9878 bits (123), Expect = 4.298e-6
Identity = 34/122 (27.87%), Postives = 60/122 (49.18%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVA 373
            R+AI+  G+ +C GS   LK +FGDGY +IL             G       +++FI+S +P + ++ +      + LP   S+    + +F  L +  + L    Y +S T+L++VF+  A
Sbjct: 2122 RMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRV----------AGPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLP---SSLTSLAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFA 2230          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 382.874 bits (982), Expect = 2.190e-113
Identity = 293/942 (31.10%), Postives = 479/942 (50.85%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG---DK------------------------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQ--EPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCM-NPSIYRSTHYRCFPEYKNNKWSP--IPNGNIPLI----------SPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQR-----LSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDG----IRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIV--NRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 +F  + +N  +  S++G   D+                        + + I  H+P A+M  +   + ++VLP   + +  F  LF +LD+ + +L   SYG+SDT+LEE+F++VA+D + ++ E  ++  +P    R   +G       +P    D  D N+     +S     +S +  +    ++G+ L +QQ + L  KR  YA+R++KG FA+++LP + + + +    +V P    P++ ++PW+                E Q  F            +  T +L      D G  G RCM   SI  +    C     + +WS   +P   I ++          SP C+C+  G +     C     G PP   +I + ++ L NLTG NISDYL+K + +     L  KI      +GG+        A+S++++  +   D     +R+     +       RFLK    F N    T N  +IW N+KG+ S+ A+ N+++N +LR+ +   ++   +GI+  N+P+  ++ ++SQ   +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ PY+YW++NFLWD+  Y++P  ++I+IF+ F  ++Y+ + N     LLL+ YG +I P MYP SF    PSTA+VVL + N+L+G   +ISTF++++   N+E +  INDILK V LIFP F LGRG++D+  N    ++++ +   N     L+WD+ G+ LF++    + ++I+ ++I+       + +C KL             ED DV  ER+R+ S     D+L +  LTK+Y                     + ++ AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1100 GDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIGTSWPESPVVPVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAED-SGVDTEMLSDGTLPVRRQRRHAFGADHQSCLKPLTEDDSFDCNESEGDPESKETDYLSGSDGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALNPWMY---------------EEQFMF-----FSEDAPYDVSTHKLLRALFDDPG-FGTRCMKGESIPDAP---C--TMGDEEWSTPEVPESIIEILTTRNWTMNDPSPACECSCNGKKKMLPECPAGAGGLPPPQIKI-SETETLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSL-----GARSTQVLPPAEEIDDAISRVREIFQLGKDSGSAADRFLKSLSAFIN-GLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRANLPPGKDPSEFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPYLYWLANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPSTAYVVLTSVNILIGINGSISTFVMELFG-NHE-IGGINDILKNVLLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFEPKSLCPKLSPI--------GEEDEDVARERQRIMSGAGQGDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTF 1976          

HSP 2 Score: 51.6026 bits (122), Expect = 4.562e-6
Identity = 34/122 (27.87%), Postives = 60/122 (49.18%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVA 373
            R+AI+  G+ +C GS   LK +FGDGY +IL             G       +++FI+S +P + ++ +      + LP   S+    + +F  L +  + L    Y +S T+L++VF+  A
Sbjct: 2133 RMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRV----------AGPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLP---SSLTSLAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFA 2241          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1a (ATP-binding cassette, sub-family A (ABC1), member 1A [Source:ZFIN;Acc:ZDB-GENE-031006-12])

HSP 1 Score: 362.073 bits (928), Expect = 2.318e-106
Identity = 284/912 (31.14%), Postives = 466/912 (51.10%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-NFNA--------------QKENFRK-----------GISNSGDK---------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-DLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRL-ESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPL--ISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLP---NDFAQSSKLIAQSPTWDGIRDSVNQ-----SQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK +F+                K + +K           G+ +  +          +   I  H+P A++  +   + ++VLP   +    F  LF  +D+ + +L+  SYG+SDT+LEE+F++VA+D   ++ ET +  L P   NR   +GD ++  +PF + + D N      +S     +     +    ++G+ L +QQ + L  KR  YA+R++KG FA+++LP + + + +    +V P    P++ + P +                E Q  F I+N        N L D L +S   +D    G    + S          PE   +  +   NGN  +   SP C+C+  G +     C     G PP   ++ T  + L NL+G NISDYL+K + ++  K      ++       F+  ++     P  D + D+++      S        RFL     F  +   T N  +IW N+KG+ S+ ++ N+++N +LR+ +    +   +GI+  N+P+  ++ ++S    +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P++YW++NF+WD+  YI+P  ++IIIF+ F  ++Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   ++STF+L++   N   +  INDILK VFLIFP F LGRG++D+  N    ++++ +   N     L WD+ G+ LF++    + ++ + ++I+        C K + S   +++    ED DV  ER+R+       D+L +  LTK+Y                     + ++ AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1101 GDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKDFDLSASSCRTSSSTVSYSKGSLKKDDSVSESSSDAGLGSDHESETTTIDISLISNVIFKHVPTARLVEDLGHEITYVLPYESAKDGAFVELFHEIDDRLTDLSISSYGISDTTLEEIFLKVAED-CGVDAETSDGTL-PARRNRRHAFGDHQSCLKPFTEDDFDFNDSEGDPESRETDWLDGADGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALEPSMY---------------EEQFTF-ISNDAPEDRHTNRLLDALKDSPAYTDQCTDGKNTASRSCPIKDGEWLVPEVTESIEAIFLNGNWSMENPSPLCECSCEGRKKMLPECPPGAGGLPPPQIKV-THDETLQNLSGRNISDYLVKTYAQIIGKSLKNKLWVNEFRYGGFSLGARNTQALPPGDELTDAISHIRSRFSLESGTAADRFLGSLSTFI-RGLDTNNNVKIWFNNKGWHSIGSFLNVMNNAVLRANLPPGLDRSKFGINAFNHPLNLTKEQLSHVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSN--EIGGINDILKNVFLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLAWDMVGKNLFAMAIEGVIFFSITVLIQYR-----FCIKAR-SLSTKLKPIGEEDEDVARERQRILGGGGQTDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTF 1963          

HSP 2 Score: 52.7582 bits (125), Expect = 2.500e-6
Identity = 34/124 (27.42%), Postives = 61/124 (49.19%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G+ +C GS   LK KFGDGY +IL             G     + +++FI+  +P + ++ +      +   Q  S+    + +F  L +  + L+   Y +S T+L++VF+  A D
Sbjct: 2120 RMAIMVNGRFRCLGSVQHLKNKFGDGYTIILRV----------AGADPRLEPVMEFIERELPGSTLKEKHRNMLQY---QLSSSLTSLARIFNILSKNKEQLHIEDYSVSQTTLDQVFVNFAKD 2230          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1a (ATP-binding cassette, sub-family A (ABC1), member 1A [Source:ZFIN;Acc:ZDB-GENE-031006-12])

HSP 1 Score: 362.073 bits (928), Expect = 2.318e-106
Identity = 284/912 (31.14%), Postives = 466/912 (51.10%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-NFNA--------------QKENFRK-----------GISNSGDK---------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-DLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRL-ESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPL--ISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLP---NDFAQSSKLIAQSPTWDGIRDSVNQ-----SQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK +F+                K + +K           G+ +  +          +   I  H+P A++  +   + ++VLP   +    F  LF  +D+ + +L+  SYG+SDT+LEE+F++VA+D   ++ ET +  L P   NR   +GD ++  +PF + + D N      +S     +     +    ++G+ L +QQ + L  KR  YA+R++KG FA+++LP + + + +    +V P    P++ + P +                E Q  F I+N        N L D L +S   +D    G    + S          PE   +  +   NGN  +   SP C+C+  G +     C     G PP   ++ T  + L NL+G NISDYL+K + ++  K      ++       F+  ++     P  D + D+++      S        RFL     F  +   T N  +IW N+KG+ S+ ++ N+++N +LR+ +    +   +GI+  N+P+  ++ ++S    +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P++YW++NF+WD+  YI+P  ++IIIF+ F  ++Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   ++STF+L++   N   +  INDILK VFLIFP F LGRG++D+  N    ++++ +   N     L WD+ G+ LF++    + ++ + ++I+        C K + S   +++    ED DV  ER+R+       D+L +  LTK+Y                     + ++ AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1101 GDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKDFDLSASSCRTSSSTVSYSKGSLKKDDSVSESSSDAGLGSDHESETTTIDISLISNVIFKHVPTARLVEDLGHEITYVLPYESAKDGAFVELFHEIDDRLTDLSISSYGISDTTLEEIFLKVAED-CGVDAETSDGTL-PARRNRRHAFGDHQSCLKPFTEDDFDFNDSEGDPESRETDWLDGADGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALEPSMY---------------EEQFTF-ISNDAPEDRHTNRLLDALKDSPAYTDQCTDGKNTASRSCPIKDGEWLVPEVTESIEAIFLNGNWSMENPSPLCECSCEGRKKMLPECPPGAGGLPPPQIKV-THDETLQNLSGRNISDYLVKTYAQIIGKSLKNKLWVNEFRYGGFSLGARNTQALPPGDELTDAISHIRSRFSLESGTAADRFLGSLSTFI-RGLDTNNNVKIWFNNKGWHSIGSFLNVMNNAVLRANLPPGLDRSKFGINAFNHPLNLTKEQLSHVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSN--EIGGINDILKNVFLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLAWDMVGKNLFAMAIEGVIFFSITVLIQYR-----FCIKAR-SLSTKLKPIGEEDEDVARERQRILGGGGQTDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTF 1963          

HSP 2 Score: 52.7582 bits (125), Expect = 2.500e-6
Identity = 34/124 (27.42%), Postives = 61/124 (49.19%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G+ +C GS   LK KFGDGY +IL             G     + +++FI+  +P + ++ +      +   Q  S+    + +F  L +  + L+   Y +S T+L++VF+  A D
Sbjct: 2120 RMAIMVNGRFRCLGSVQHLKNKFGDGYTIILRV----------AGADPRLEPVMEFIERELPGSTLKEKHRNMLQY---QLSSSLTSLARIFNILSKNKEQLHIEDYSVSQTTLDQVFVNFAKD 2230          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca4b (ATP-binding cassette, sub-family A (ABC1), member 4b [Source:ZFIN;Acc:ZDB-GENE-050517-4])

HSP 1 Score: 362.073 bits (928), Expect = 2.864e-106
Identity = 275/918 (29.96%), Postives = 438/918 (47.71%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQ--KENF--------------------------RKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQA-FVDKSLIS-LNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCF------------PEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIF----------------GGYQFLLPNDFAQSSKLIAQSPTWDGIRDS-VNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFN-YFYNSNSIVKHEY--NALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            SDR+AIIS+GKL C GS +FLK  FG G+ L LV+    Q  KEN                            + +  + + +   I  H+P+AK+      + +++LP        ++ LF  L+E + ++   S+G+SDTSLEE+F++V  D      E  N  + P+      +    +N   F+    L + A  V  SL S  +  R  + ++GF L+ +Q   L +KRFH+A R+ K   A+++LP   + + +    +V P    P + ++PW+  P               Q  F     + N+   +P           D G  G RCM      +  + C             PE  N   SP  +   P  SP C+C+T    T   +C     G PP   R   + D L ++T  NISDYL+K + +L +                   GG   +L  D  +   + +Q      IR    ++S    LE   FL Y +  +N         ++W N+KG+ +M ++ N+ +N +LR+ +    N  +YGI+  N+P+  ++ ++S+   L   ++  +AI VI A+SFI ASFV++LI ER++ +K  QFVSG++P VYW +NF WD++ Y +   +++ IF+ FD + Y    N  A I LL  YG ++ P MYP S+  + PSTA+V L+  NL +G  ++  TFIL++ E N   L   N++LKKV L+FP F LGRG++D+  N    +  +    E+  +  +W+  G+ LF +      ++I  ++I+     +       + Y   + +   ED DV  ERER+      +D+L + +L+K Y                     + +  AV+ +C GV  GECFGLLGVNGAGKTTTF
Sbjct: 1178 SDRVAIISKGKLHCSGSPLFLKNCFGVGFYLTLVRRMKDQRKKENECDCASECSCTCSTCTRYKEESQALQPERVLDGNVESITTLIHHHVPEAKLIEMIGQEMTYLLPNKGFKYRAYASLFRELEETLGDMGLSSFGISDTSLEEIFLKVTAD-----GEAANSSVTPEQW----MLQQRKNGNGFMKDTGLAEDANGVGASLESDSSEGRASRQVKGFSLVLKQFHALLVKRFHHATRSHKDFLAQIVLPASFVLIALVFTMIVPPFGEYPCLTLTPWMYGP---------------QFTF-----ISNEQPSHPKMKHFIQTLLKDPG-MGTRCMANQPLENI-FTCLNSSSDWEVPPVSPEVSNILSSPEWDSRNP--SPSCECSTDLKLTMLPMCPAGAGGLPPRQ-RKEPTGDILLDMTNRNISDYLVKTYTKLIKTSLKSKYWVNEQRYGGISVGGRLPILDVDPEEIQNIFSQLGRMMNIRGGRYSKSAMDELE--TFLHYMESEYN--------VKVWYNNKGWHAMASFLNVANNAILRAYLPPHANPSDYGITAINHPLNLTKEQLSEVTVLTTSVDAVVAICVIFAMSFIPASFVLYLIQERVTKAKHLQFVSGVSPLVYWFANFFWDMLNYSVSTAMVVAIFVGFDKKCYTSPTNLPALIALLCLYGWSVTPMMYPLSYMFNVPSTAYVSLSCINLFIGINSSAITFILELFENNRSLLM-FNEVLKKVLLVFPHFCLGRGLIDMAMNQAVTDVYARFGEEFSMDPFRWNFVGKNLFCMAVEGFVYFIFNLLIQY----KFFLHHWISDY--GMSLGTDEDDDVAQERERIYKGGNKNDILLIRDLSKTY--------------------RRRKRPAVDKICVGVPAGECFGLLGVNGAGKTTTF 2024          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 394.815 bits (1013), Expect = 2.672e-117
Identity = 292/914 (31.95%), Postives = 473/914 (51.75%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFN-----------------AQKENFRKGISNSG--------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-------DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIR--CMNPSIYRSTHY---RCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF-------YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESG--IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK  N                  ++++  +  S++G                +   I  H+P+A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG++DT+LEE+F++VADD   ++ ET +  L P    R A +GD ++   PF + +       D++ ++     L  ++   +++L + + L++QQ   L  KR  YAKR++KG FA+++LP + + + +    +V P    P++E+ PW+   +       TF+  +        +  G +  +  L D+         G S ++  C       ST +        + N  W+      +   SP C+C++   +    IC  P +GG P   R   +SD L NLTG NISDYL+K + ++  K +GG+     N  A         P  + +  S+N  +     PQN    RFL  F  F  K   T +  ++W N+KG+ ++ A+ N+++N +LRS+++  ++  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L  IN+ILK V LIFP F LGRG++D+  N         +  N  V    + + WD+ G  LF++    + ++ + ++I+    I  R +  KL             ED DV  ER+R++   + +D+L +  LTKIY +                     R+ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct: 1097 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTG-VDAETSDGTL-PARRKRYA-FGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQL-KSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQY------TFFSND------APDDQGTQALLKALIDKPGFGTACMEGHSVMKVSCSGEEEEWSTQFVSQSVMDLFLNGNWT------MENPSPSCECSSDKRKKMLPIC-PPGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFSLGASNSPAL--------PPNEEVVASINHIKKRLELPQNGAANRFLDSFGAFM-KGLDTKDNVKVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNN--KLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFV----SPMSWDLVGRNLFAMAVEGVVFFAITLMIQYRFFIKPRPVNAKLPPVV--------DEDEDVARERQRINEGGR-NDILELKGLTKIYRM--------------------KRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1943          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 385.571 bits (989), Expect = 3.387e-114
Identity = 292/928 (31.47%), Postives = 473/928 (50.97%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFN-----------------AQKENFRKGISNSG-----------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-------DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIR--CMNPSIYRSTHY---RCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKI-----------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF-------YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESG--IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK  N                  ++++  +  S++G                   +   I  H+P+A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG++DT+LEE+F++VADD   ++ ET +  L P    R A +GD ++   PF + +       D++ ++     L  ++   +++L + + L++QQ   L  KR  YAKR++KG FA+++LP + + + +    +V P    P++E+ PW+   +       TF+  +        +  G +  +  L D+         G S ++  C       ST +        + N  W+      +   SP C+C++   +    IC  P +GG P   R   +SD L NLTG NISDYL+K + ++  K            +GG+     N  A         P  + +  S+N  +     PQN    RFL  F  F  K   T +  ++W N+KG+ ++ A+ N+++N +LRS+++  ++  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L  IN+ILK V LIFP F LGRG++D+  N         +  N  V    + + WD+ G  LF++    + ++ + ++I+    I  R +  KL             ED DV  ER+R++   + +D+L +  LTKIY +                     R+ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct: 1101 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIGLTDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTG-VDAETSDGTL-PARRKRYA-FGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQL-KSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQY------TFFSND------APDDQGTQALLKALIDKPGFGTACMEGHSVMKVSCSGEEEEWSTQFVSQSVMDLFLNGNWT------MENPSPSCECSSDKRKKMLPIC-PPGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKSLKNKIWVNEFRYGGFSLGASNSPAL--------PPNEEVVASINHIKKRLELPQNGAANRFLDSFGAFM-KGLDTKDNVKVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNN--KLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFV----SPMSWDLVGRNLFAMAVEGVVFFAITLMIQYRFFIKPRPVNAKLPPVV--------DEDEDVARERQRINEGGR-NDILELKGLTKIYRM--------------------KRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1961          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 382.874 bits (982), Expect = 2.916e-113
Identity = 285/907 (31.42%), Postives = 463/907 (51.05%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFN-----------------AQKENFRKGISNSG--------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-------DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHY---RCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF-------YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESG--IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK  N                  ++++  +  S++G                +   I  H+P+A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG++DT+LEE+F++VADD   ++ ET +  L P    R A +GD ++   PF + +       D++ ++     L  ++   +++L + + L++QQ   L  KR  YAKR++KG FA+++LP + + + +    +V P    P++E+ PW+   +       TF+  +        +  G +  +  L D+         G +   C       ST +        + N  W+      +   SP C+C++   +    IC  P +GG P   R   +SD L NLTG NISDYL+K + ++  K +GG+     N  A  S +                         + LK F  F  K   T +  ++W N+KG+ ++ A+ N+++N +LRS+++  ++  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L  IN+ILK V LIFP F LGRG++D+  N         +  N  V    + + WD+ G  LF++    + ++ + ++I+    I  R +  KL             ED DV  ER+R++   + +D+L +  LTKIY +                     R+ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct: 1064 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTG-VDAETSDGTL-PARRKRYA-FGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQL-KSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQY------TFFSNDA------PDDQGTQALLKALIDK------PGFG-TAFSCSGEEEEWSTQFVSQSVMDLFLNGNWT------MENPSPSCECSSDKRKKMLPIC-PPGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFSLGASNSPALPSVVG------------------------KLLKIFGAFM-KGLDTKDNVKVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNN--KLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFV----SPMSWDLVGRNLFAMAVEGVVFFAITLMIQYRFFIKPRPVNAKLPPVV--------DEDEDVARERQRINEGGR-NDILELKGLTKIYRM--------------------KRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1880          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 380.563 bits (976), Expect = 2.105e-112
Identity = 284/916 (31.00%), Postives = 466/916 (50.87%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFN-----------------AQKENFRKGISNSG---------------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-------DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIR--CMNPSIYRSTHY---RCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF-------YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESG--IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK  N                  ++++  +  S++G                       +   I  H+P+A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG++DT+LEE+F++VADD   ++ ET +  L P    R A +GD ++   PF + +       D++ ++     L  ++   +++L + + L++QQ   L  KR  YAKR++KG FA+++LP + + + +    +V P    P++E+ PW+   +       TF+  +        +  G +  +  L D+         G S ++  C       ST +        + N  W+      +   SP C+C++   +    IC  P +GG P   R   +SD L NLTG NISDYL+K + ++  K +GG+     N           SP           + P N E +  + + ++          +S +W N+KG+ ++ A+ N+++N +LRS+++  ++  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L  IN+ILK V LIFP F LGRG++D+  N         +  N  V    + + WD+ G  LF++    + ++ + ++I+    I  R +  KL             ED DV  ER+R++   + +D+L +  LTKIY +                     R+ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct: 1052 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIGKYKSLTDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTG-VDAETSDGTL-PARRKRYA-FGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQL-KSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQY------TFFSND------APDDQGTQALLKALIDKPGFGTACMEGHSVMKVSCSGEEEEWSTQFVSQSVMDLFLNGNWT------MENPSPSCECSSDKRKKMLPIC-PPGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFSLGASN-----------SP-----------ALPPNEEVVASINHIKKRLELPQVEYLYSVVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNN--KLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFV----SPMSWDLVGRNLFAMAVEGVVFFAITLMIQYRFFIKPRPVNAKLPPVV--------DEDEDVARERQRINEGGR-NDILELKGLTKIYRM--------------------KRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1887          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 376.711 bits (966), Expect = 3.651e-111
Identity = 281/912 (30.81%), Postives = 463/912 (50.77%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFN-----------------AQKENFRKGISNSG-----------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-------DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIR--CMNPSIYRSTHY---RCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF-------YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESG--IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK  N                  ++++  +  S++G                   +   I  H+P+A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG++DT+LEE+F++VADD   ++ ET +  L P    R A +GD ++   PF + +       D++ ++     L  ++   +++L + + L++QQ   L  KR  YAKR++KG FA+++LP + + + +    +V P    P++E+ PW+   +       TF+  +        +  G +  +  L D+         G S ++  C       ST +        + N  W+      +   SP C+C++   +    IC  P +GG P   R   +SD L NLTG NISDYL+K + ++  K +GG+     N           SP           + P N E +  + + ++          +S +W N+KG+ ++ A+ N+++N +LRS+++  ++  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  Q +SG+ P +YW++NF+WD+  Y++P  ++IIIFI F   SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++           N+ILK V LIFP F LGRG++D+  N         +  N  V    + + WD+ G  LF++    + ++ + ++I+    I  R +  KL             ED DV  ER+R++   + +D+L +  LTKIY +                     R+ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct: 1067 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIGLTDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTG-VDAETSDGTL-PARRKRYA-FGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQL-KSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQY------TFFSNDA------PDDQGTQALLKALIDKPGFGTACMEGHSVMKVSCSGEEEEWSTQFVSQSVMDLFLNGNWT------MENPSPSCECSSDKRKKMLPIC-PPGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFSLGASN-----------SP-----------ALPPNEEVVASINHIKKRLELPQVEYLYSVVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELF---------TNNILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFV----SPMSWDLVGRNLFAMAVEGVVFFAITLMIQYRFFIKPRPVNAKLPPVV--------DEDEDVARERQRINEGGR-NDILELKGLTKIYRM--------------------KRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1891          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca1 (ATP-binding cassette, sub-family A (ABC1), member 1 [Source:MGI Symbol;Acc:MGI:99607])

HSP 1 Score: 382.874 bits (982), Expect = 2.302e-113
Identity = 295/927 (31.82%), Postives = 472/927 (50.92%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG--------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIP--------NGNIPL--ISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF-----QRLSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF-------YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 +   ++++  +  S++G                +   I+ H+ +A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG+S+T+LEE+F++VA++ + ++ ET +  L P   NR A +GD ++   PF   D  D N      +S    L+S    +    L+G+ L +QQ + L  KR   A+R++KG FA+++LP + + + +    +V P    P++E+ PW+            +  +   ++      +G +  +N LT         D G  G RCM  +    T   C    ++   SP+P        NGN  +   SP C C++   +    +C     G P    R   ++D L NLTG NISDYL+K +     + L  KI      +GG+   + N  A         P    + D++ Q +      ++    RFL     F      T N  ++W N+KG+ ++ ++ N+++N +LR+ ++  +N   YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L +INDILK VFLIFP F LGRG++D+  N         +  N  V    + L WD+ G  LF++    + ++++ ++I+     R    K K   L      N ED DV  ER+R+      +D+L +  LTKIY                     + R+ AV+ +C G+  GECFGLLGVNGAGK+TTF
Sbjct: 1098 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE-SGVDAETSDGTL-PARRNRRA-FGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWM------------YNEQYTFVSNDAPEDMGTQELLNALT--------KDPG-FGTRCMEGNPIPDTP--CLAGEEDWTISPVPQSIVDLFQNGNWTMKNPSPACQCSSDKIKKMLPVCPPGAGGLP-PPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNSQAL--------PPSHEVNDAIKQMKKLLKLTKDSSADRFLSSLGRFM-AGLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQKGENPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNN--KLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFV----SPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVKAKLPPL------NDEDEDVRRERQRILDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTF 1956          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca4 (ATP-binding cassette, sub-family A (ABC1), member 4 [Source:MGI Symbol;Acc:MGI:109424])

HSP 1 Score: 352.058 bits (902), Expect = 7.879e-103
Identity = 272/930 (29.25%), Postives = 446/930 (47.96%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILV---KNFNAQKENFR-------KGISN---------------SGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPA----------KINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIR--------CMNPSIYRS-------THYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSR-----------KIFGGYQF--LLPNDFAQSSKLIAQSPTWDGIRDSVNQS-----QPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFN-YFYNSNSIVKHEYNA--LQWDIAGEKLFSLFSLSIGWWIVLIIIESG-IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIISQG+L C G+ +FLK  FG G+ L LV   KN  +Q+           KG S                 GD  +L+  +  H+P+AK+      +  F+LP  +     ++ LF  L+E + +L   S+G+SDT LEE+F++V +D            +  E+            ++  Y    +      ++    Q   +     + FN   +L+       Q +  L +KRFH+  R++K   A+++LP   + L + L  +V P    PA+ + PW+                 +Q  F   ++  N++ +  L D L +  R   G   ++        C+N + +++       TH      ++  KW+          SP C C+T    T    C +  +GG P   R   S++ L +LT  NISDYL+K +  L R           + +GG      LP        L+       G+   +N S     +  + E L FLK+ +        T +  ++W N+KG+ ++ ++ N+  N +LR+ +   ++   YGI+V + P+  ++ ++S    L   ++  +AI VI A+SF+ ASFV++LI ER++ +K  QF+SG++P  YW++NFLWDIM Y +   +++ IFI F  ++Y    N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TF+L++ E N   L+  N +L+K+ ++FP F LGRG++DL  +    +  +    EY+A   QWD+ G+ L ++    + ++++ ++I+    + R I    +            ED DV  ER+R+ S     D+L++  LTK+Y                    + +   AV+ LC GVR GECFGLLGVNGAGKTTTF
Sbjct: 1127 GDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDPPKGQPSPEPEDPGVPFNTGARLIL------QHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMY---------------GHQYTFFSMDEPNNEH-LEVLADVLLN--RPGFGNRCLKEEWLPEYPCINATSWKTPSVSPNITHL-----FQKQKWTAAHP------SPSCKCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPISGEALVG---FLSGLGQMMNVSGGPVTREASKEMLDFLKHLE--------TTDNIKVWFNNKGWHALVSFLNVAHNAILRASLPRDRDPEEYGITVISQPLNLTKEQLSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFENNRTLLR-FNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAIEGVVYFLLTLLIQHHFFLTRWIAEPAREPVFD-------EDDDVAEERQRVMSGGNKTDILKLNELTKVY--------------------SGSSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTF 1981          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 327.791 bits (839), Expect = 1.265e-94
Identity = 276/925 (29.84%), Postives = 459/925 (49.62%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-------------------------NFNAQKENFRKGISN---------------SGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIY-------RSTH----YRCFPEYKNNKWSPIPNGN-IP-LISPECDCNTTGYQ-ICNDPRSGGPPNSYRIMTSS--DKLNNLTGYNISDYLLKNFQRLSRK-----------IFGGYQFLLPN-DFAQSSKLIAQSPTWDGIRDSVNQSQPQN-LEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL--LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNS--NSIVKHEYNA-LQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DR+A+++ G L CCGS +FL+R  G GY L LVK                         N       F +G S+               S  ++L+ ++ H+P A++  +   +   VLP   +    F+ +F  LD++++ L    YG+SDT+LEE+F++V +D  +   +++ +     +L           +   L+  +L  Q              N   ++G+ L  QQ+  L  KRF  A+R+++G+FA+++LP L + L +    +V P    P +++SP +  P               Q++F   +  G+ N +  L         + LGE+G++   PS+          TH    Y   PE   +  S + +GN  P   SP C C+  G + +  D  +G          +   + + NLTG N+SD+L+K +  L R+            +GG+     + D     +++    T   IR ++   QP N L+  R L    ++        N  +IW N+KG+ +M A+ N  +N LL + +        + I+  N+P+  ++ ++S+   LI   ++V ++I V+ A+SF+ ASF + LI+ERI+ +K  Q VSG+   +YW+ NFLWD+  Y++ + I++ IF+AF  ++Y+  +N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G  ++++TF+L++L  + + L+E++ ILK+VFLIFP F LGRG++D+  N         +   ++ + L+WDI G+ L ++  ++ G   +LI +     NR+    L  S  + +     ED DV  ERER++      DVL + +LTK+Y            +G+        R  AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1002 GDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSSQSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVEDAHREGGDSRPQL----HLRTCTPQPPTGPEASVLENGELAPQGLAP----------NAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQVVLPALFVGLALFFSLIVPPFGQYPPLQLSPAMYGP---------------QVSFFSEDAPGDPNRMKLL--------EALLGEAGLQ--EPSMQDKDARGSECTHSLACYFTVPEVPPDVASILASGNWTPESPSPACQCSQPGARRLLPDCPAGAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGFSLGGRDPDLPTGHEVVR---TLAEIR-ALLSPQPGNALD--RILNNLTQW-ALGLDARNSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHAHSITTLNHPLNLTKEQLSE-ATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELL--SDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDKQFQSPLRWDIIGKNLLAM--MAQGPLFLLITLLLQHRNRL----LPQSKPRLLPPLGEEDEDVAQERERVTKGATQGDVLVLRDLTKVY------------RGQ--------RNPAVDRLCLGIPPGECFGLLGVNGAGKTSTF 1851          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 327.791 bits (839), Expect = 1.265e-94
Identity = 276/925 (29.84%), Postives = 459/925 (49.62%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-------------------------NFNAQKENFRKGISN---------------SGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIY-------RSTH----YRCFPEYKNNKWSPIPNGN-IP-LISPECDCNTTGYQ-ICNDPRSGGPPNSYRIMTSS--DKLNNLTGYNISDYLLKNFQRLSRK-----------IFGGYQFLLPN-DFAQSSKLIAQSPTWDGIRDSVNQSQPQN-LEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL--LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNS--NSIVKHEYNA-LQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DR+A+++ G L CCGS +FL+R  G GY L LVK                         N       F +G S+               S  ++L+ ++ H+P A++  +   +   VLP   +    F+ +F  LD++++ L    YG+SDT+LEE+F++V +D  +   +++ +     +L           +   L+  +L  Q              N   ++G+ L  QQ+  L  KRF  A+R+++G+FA+++LP L + L +    +V P    P +++SP +  P               Q++F   +  G+ N +  L         + LGE+G++   PS+          TH    Y   PE   +  S + +GN  P   SP C C+  G + +  D  +G          +   + + NLTG N+SD+L+K +  L R+            +GG+     + D     +++    T   IR ++   QP N L+  R L    ++        N  +IW N+KG+ +M A+ N  +N LL + +        + I+  N+P+  ++ ++S+   LI   ++V ++I V+ A+SF+ ASF + LI+ERI+ +K  Q VSG+   +YW+ NFLWD+  Y++ + I++ IF+AF  ++Y+  +N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G  ++++TF+L++L  + + L+E++ ILK+VFLIFP F LGRG++D+  N         +   ++ + L+WDI G+ L ++  ++ G   +LI +     NR+    L  S  + +     ED DV  ERER++      DVL + +LTK+Y            +G+        R  AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1002 GDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSSQSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVEDAHREGGDSRPQL----HLRTCTPQPPTGPEASVLENGELAPQGLAP----------NAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQVVLPALFVGLALFFSLIVPPFGQYPPLQLSPAMYGP---------------QVSFFSEDAPGDPNRMKLL--------EALLGEAGLQ--EPSMQDKDARGSECTHSLACYFTVPEVPPDVASILASGNWTPESPSPACQCSQPGARRLLPDCPAGAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGFSLGGRDPDLPTGHEVVR---TLAEIR-ALLSPQPGNALD--RILNNLTQW-ALGLDARNSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHAHSITTLNHPLNLTKEQLSE-ATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELL--SDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDKQFQSPLRWDIIGKNLLAM--MAQGPLFLLITLLLQHRNRL----LPQSKPRLLPPLGEEDEDVAQERERVTKGATQGDVLVLRDLTKVY------------RGQ--------RNPAVDRLCLGIPPGECFGLLGVNGAGKTSTF 1851          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca4 (ATP-binding cassette, sub-family A (ABC1), member 4 [Source:MGI Symbol;Acc:MGI:109424])

HSP 1 Score: 321.627 bits (823), Expect = 1.794e-94
Identity = 242/848 (28.54%), Postives = 409/848 (48.23%), Query Frame = 2
Query:  167 LQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPA----------KINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIR--------CMNPSIYRS-------THYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSR-----------KIFGGYQF--LLPNDFAQSSKLIAQSPTWDGIRDSVNQS-----QPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFN-YFYNSNSIVKHEYNA--LQWDIAGEKLFSLFSLSIGWWIVLIIIESG-IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            +  +  H+P+AK+      +  F+LP  +     ++ LF  L+E + +L   S+G+SDT LEE+F++V +D            +  E+            ++  Y    +      ++    Q   +     + FN   +L+       Q +  L +KRFH+  R++K   A+++LP   + L + L  +V P    PA+ + PW+                 +Q  F   ++  N++ +  L D L +  R   G   ++        C+N + +++       TH      ++  KW+          SP C C+T    T    C +  +GG P   R   S++ L +LT  NISDYL+K +  L R           + +GG      LP        L+       G+   +N S     +  + E L FLK+ +        T +  ++W N+KG+ ++ ++ N+  N +LR+ +   ++   YGI+V + P+  ++ ++S    L   ++  +AI VI A+SF+ ASFV++LI ER++ +K  QF+SG++P  YW++NFLWDIM Y +   +++ IFI F  ++Y    N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TF+L++ E N   L+  N +L+K+ ++FP F LGRG++DL  +    +  +    EY+A   QWD+ G+ L ++    + ++++ ++I+    + R I    +            ED DV  ER+R+ S     D+L++  LTK+Y                    + +   AV+ LC GVR GECFGLLGVNGAGKTTTF
Sbjct:    1 MDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDPPKGQPSPEPEDPGVPFNTGARLIL------QHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMY---------------GHQYTFFSMDEPNNEH-LEVLADVLLN--RPGFGNRCLKEEWLPEYPCINATSWKTPSVSPNITHL-----FQKQKWTAAHP------SPSCKCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPISGEALVG---FLSGLGQMMNVSGGPVTREASKEMLDFLKHLE--------TTDNIKVWFNNKGWHALVSFLNVAHNAILRASLPRDRDPEEYGITVISQPLNLTKEQLSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFENNRTLLR-FNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAIEGVVYFLLTLLIQHHFFLTRWIAEPAREPVFD-------EDDDVAEERQRVMSGGNKTDILKLNELTKVY--------------------SGSSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTF 773          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|P41233|ABCA1_MOUSE (Phospholipid-transporting ATPase ABCA1 OS=Mus musculus OX=10090 GN=Abca1 PE=1 SV=4)

HSP 1 Score: 382.874 bits (982), Expect = 1.610e-112
Identity = 295/927 (31.82%), Postives = 472/927 (50.92%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG--------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIP--------NGNIPL--ISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF-----QRLSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF-------YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 +   ++++  +  S++G                +   I+ H+ +A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG+S+T+LEE+F++VA++ + ++ ET +  L P   NR A +GD ++   PF   D  D N      +S    L+S    +    L+G+ L +QQ + L  KR   A+R++KG FA+++LP + + + +    +V P    P++E+ PW+            +  +   ++      +G +  +N LT         D G  G RCM  +    T   C    ++   SP+P        NGN  +   SP C C++   +    +C     G P    R   ++D L NLTG NISDYL+K +     + L  KI      +GG+   + N  A         P    + D++ Q +      ++    RFL     F      T N  ++W N+KG+ ++ ++ N+++N +LR+ ++  +N   YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L +INDILK VFLIFP F LGRG++D+  N         +  N  V    + L WD+ G  LF++    + ++++ ++I+     R    K K   L      N ED DV  ER+R+      +D+L +  LTKIY                     + R+ AV+ +C G+  GECFGLLGVNGAGK+TTF
Sbjct: 1098 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE-SGVDAETSDGTL-PARRNRRA-FGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWM------------YNEQYTFVSNDAPEDMGTQELLNALT--------KDPG-FGTRCMEGNPIPDTP--CLAGEEDWTISPVPQSIVDLFQNGNWTMKNPSPACQCSSDKIKKMLPVCPPGAGGLP-PPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNSQAL--------PPSHEVNDAIKQMKKLLKLTKDSSADRFLSSLGRFM-AGLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQKGENPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNN--KLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFV----SPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVKAKLPPL------NDEDEDVRRERQRILDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTF 1956          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|O95477|ABCA1_HUMAN (Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3)

HSP 1 Score: 375.17 bits (962), Expect = 6.226e-110
Identity = 292/929 (31.43%), Postives = 472/929 (50.81%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG--------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWS--PIP--------NGNIPL--ISPECDCNTTGYQ----ICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF-----QRLSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF-------YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 ++  ++++  +  S++G                +   I+ H+ +A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG+S+T+LEE+F++VA++ + ++ ET +  L P   NR A +GD ++   PF   D  D N      +S    L+S    +    ++G+ L +QQ + L  KR   A+R++KG FA+++LP + + + +    +V P    P++E+ PW+            +  +   ++       G    +N LT         D G  G RCM  +    T  +   E    +W+  P+P        NGN  +   SP C C++   +    +C     G P    R   ++D L +LTG NISDYL+K +     + L  KI      +GG+   + N  A         P    + D++ Q +      ++    RFL     F      T N  ++W N+KG+ ++ ++ N+++N +LR+ ++  +N  +YGI+  N+P+  ++ ++S+   +   ++V ++I VI A+SF+ ASFV+FLI ER+S +K  QF+SG+ P +YW+SNF+WD+  Y++P  ++IIIFI F  +SY+ S N     LLL+ YG +I P MYP SF    PSTA+VVL + NL +G   +++TF+L++   N   L  INDILK VFLIFP F LGRG++D+  N         +  N  V    + L WD+ G  LF++    + ++++ ++I+     R      K S L      N ED DV  ER+R+      +D+L +  LTKIY                     + R+ AV+ +C G+  GECFGLLGVNGAGK++TF
Sbjct: 1098 GDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE-SGVDAETSDGTL-PARRNRRA-FGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWM------------YNEQYTFVSNDAPEDTGTLELLNALT--------KDPG-FGTRCMEGNPIPDTPCQAGEE----EWTTAPVPQTIMDLFQNGNWTMQNPSPACQCSSDKIKKMLPVCPPGAGGLP-PPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNTQAL--------PPSQEVNDAIKQMKKHLKLAKDSSADRFLNSLGRFMT-GLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTDN--KLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFV----SPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRPRPVNAKLSPL------NDEDEDVRRERQRILDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTF 1956          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|O35600|ABCA4_MOUSE (Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=2 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 5.511e-102
Identity = 272/930 (29.25%), Postives = 446/930 (47.96%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILV---KNFNAQKENFR-------KGISN---------------SGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPA----------KINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIR--------CMNPSIYRS-------THYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSR-----------KIFGGYQF--LLPNDFAQSSKLIAQSPTWDGIRDSVNQS-----QPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFN-YFYNSNSIVKHEYNA--LQWDIAGEKLFSLFSLSIGWWIVLIIIESG-IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIISQG+L C G+ +FLK  FG G+ L LV   KN  +Q+           KG S                 GD  +L+  +  H+P+AK+      +  F+LP  +     ++ LF  L+E + +L   S+G+SDT LEE+F++V +D            +  E+            ++  Y    +      ++    Q   +     + FN   +L+       Q +  L +KRFH+  R++K   A+++LP   + L + L  +V P    PA+ + PW+                 +Q  F   ++  N++ +  L D L +  R   G   ++        C+N + +++       TH      ++  KW+          SP C C+T    T    C +  +GG P   R   S++ L +LT  NISDYL+K +  L R           + +GG      LP        L+       G+   +N S     +  + E L FLK+ +        T +  ++W N+KG+ ++ ++ N+  N +LR+ +   ++   YGI+V + P+  ++ ++S    L   ++  +AI VI A+SF+ ASFV++LI ER++ +K  QF+SG++P  YW++NFLWDIM Y +   +++ IFI F  ++Y    N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TF+L++ E N   L+  N +L+K+ ++FP F LGRG++DL  +    +  +    EY+A   QWD+ G+ L ++    + ++++ ++I+    + R I    +            ED DV  ER+R+ S     D+L++  LTK+Y                    + +   AV+ LC GVR GECFGLLGVNGAGKTTTF
Sbjct: 1127 GDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDPPKGQPSPEPEDPGVPFNTGARLIL------QHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMY---------------GHQYTFFSMDEPNNEH-LEVLADVLLN--RPGFGNRCLKEEWLPEYPCINATSWKTPSVSPNITHL-----FQKQKWTAAHP------SPSCKCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPISGEALVG---FLSGLGQMMNVSGGPVTREASKEMLDFLKHLE--------TTDNIKVWFNNKGWHALVSFLNVAHNAILRASLPRDRDPEEYGITVISQPLNLTKEQLSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFENNRTLLR-FNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAIEGVVYFLLTLLIQHHFFLTRWIAEPAREPVFD-------EDDDVAEERQRVMSGGNKTDILKLNELTKVY--------------------SGSSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTF 1981          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|Q8IZY2|ABCA7_HUMAN (Phospholipid-transporting ATPase ABCA7 OS=Homo sapiens OX=9606 GN=ABCA7 PE=1 SV=3)

HSP 1 Score: 343.969 bits (881), Expect = 3.146e-99
Identity = 274/915 (29.95%), Postives = 453/915 (49.51%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-------------------NFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAK---INEETKNEKL--------IPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGN-IP-LISPECDCNTTGYQ-ICND--PRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRK-----------IFGGYQFLLPNDFAQSSKLIAQS---------PTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNS--NSIVKHEYNA-LQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRN-----TEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DR+A+++ G+L CCGS +FL+R  G GY L LVK                   +   +K+N  +G      +LL  ++  +P A++  E   +   VLP   ++   F+ LF  LD  +  L    YG+SDTSLEE+F++V ++ A    + + +  + L        +   L        +EN EP     + +Q +  D         R    ++G+ L +QQ+  L +KRF  A+R+++G+FA+++LP L + L +    +V P    PA+ +SP             T Y    Q++F   +  G+      L   L+        E+G+    P +  S+H    PE        + +GN  P   SP C C+  G + +  D    +GGPP    +  S + + NLTG N+SD+L+K + RL R+            +GG+     +    S + + +S         P   G  D             R LK    + + S    +  +IW N+KG+ SM A+ N  SN +LR+ +        + I+  N+P+  ++ ++S+   +   ++V ++I V+ A+SF+ ASF + LI+ER++ +K  Q + G++P +YW+ NFLWD+  Y++P  I+++IF+AF  ++Y+   N  A +LLL+ YG +I P MYP SFF S PSTA+VVL   NL +G   +++TF+L++   + + L+E++ ILK+VFLIFP F LGRG++D+  N         +   ++ + L+W++ G+ L +           ++I     +   +  + ++  L +  +R+      ED DV  ERER+       DVL + NLTK+Y            +G+        R  AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1005 GDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGSCGQHLCTGIAGLDVTLRLKMPPQETALENGEPAGSAPETDQGSGPDA------VGR----VQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSP-------------TMYGA--QVSFFSEDAPGDPGRARLLEALLQ--------EAGLE--EPPVQHSSHRFSAPEVPAEVAKVLASGNWTPESPSPACQCSRPGARRLLPDCPAAAGGPPPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELWALLSPLPGGALD-------------RVLKNLTAWAH-SLDAQDSLKIWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHAHSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELF--SDQKLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDRQFQSPLRWEVVGKNLLA-----------MVIQGPLFLLFTLLLQHRSQLLPQPRVRSLPLLGEEDEDVARERERVVQGATQGDVLVLRNLTKVY------------RGQ--------RMPAVDRLCLGIPPGECFGLLGVNGAGKTSTF 1837          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|P78363|ABCA4_HUMAN (Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Homo sapiens OX=9606 GN=ABCA4 PE=1 SV=3)

HSP 1 Score: 333.954 bits (855), Expect = 7.189e-96
Identity = 269/919 (29.27%), Postives = 441/919 (47.99%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILV---KNFNAQKENFR-------KGISNS---------------GD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHK--------------LLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKE-NQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYR--STHYRCFPEYKNNKWSPIPNGNIPLISPECDCNT----TGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSR-----------KIFGGYQF--LLPNDFAQSSKLIAQSPTWDGIRDSVNQ--SQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYN---SNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESG-IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAII+QG+L C G+ +FLK  FG G  L LV   KN  +Q++          KG S +               GD  +L+  +  H+P+AK+      +  F+LP  +     ++ LF  L+E + +L   S+G+SDT LEE+F++V +D           +   +N+N          + P L   +   Q   D ++ S      H               L  G  L+ Q +  L +KRF +  R+ K   A+++LP   + L + L  ++ P    PA+ + PW+   +    +++    ++   L   + N+ G  N    L +    EY          C N + ++  S        ++  KW+ +        SP C C+T    T    C +  +GG P   R   S++ L +LT  NISD+L+K +  L R           + +GG      LP        L+        I +      ++  + E   FLK+ +        T +  ++W N+KG+ ++ ++ N+  N +LR+ +   ++   YGI+V + P+  ++ ++S+   L   ++  +AI VI ++SF+ ASFV++LI ER++ SK  QF+SG++P  YWV+NFLWDIM Y +   +++ IFI F  ++Y   +N  A + LL+ YG A+IP MYP SF    PSTA+V L+  NL +G  ++  TFIL++ E N   L+  N +L+K+ ++FP F LGRG++DL  +       +    +H  N   WD+ G+ LF++    + ++++ ++++    +++ I    K   +        ED DV  ER+R+ +     D+LR+  LTKIY                          AV+ LC GVR GECFGLLGVNGAGKTTTF
Sbjct: 1127 GDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVN---------PRHPCLGPREKAGQTPQDSNVCSPGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWIYGQQYTFFSMDEPGSEQFTVLADVLLNKPGFGNRC--LKEGWLPEYP---------CGNSTPWKTPSVSPNITQLFQKQKWTQVNP------SPSCRCSTREKLTMLPECPE-GAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPVVPITGEALVGFLSDLGRIMNVSGGPITREASKEIPDFLKHLE--------TEDNIKVWFNNKGWHALVSFLNVAHNAILRASLPKDRSPEEYGITVISQPLNLTKEQLSEITVLTTSVDAVVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFENNRTLLR-FNAVLRKLLIVFPHFCLGRGLIDLALSQAVTDVYARFGEEHSANPFHWDLIGKNLFAMVVEGVVYFLLTLLVQRHFFLSQWIAEPTKEPIVD-------EDDDVAEERQRIITGGNKTDILRLHELTKIY--------------------PGTSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTF 1982          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A1S3JVH4 (LOW QUALITY PROTEIN: ATP-binding cassette sub-family A member 1-like OS=Lingula unguis OX=7574 GN=LOC106176500 PE=4 SV=2)

HSP 1 Score: 488.034 bits (1255), Expect = 4.999e-147
Identity = 323/943 (34.25%), Postives = 494/943 (52.39%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-------------------------NFNAQKENFRKGISNSGDK----------------------------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPA--KINEETKNEKL--------IPDNLNRIAVYGD----IENQEPFLDLEDLNQQAFVD----KSLISLNFNR---------NHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMP-KSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIP--NGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQ--SSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFN-NLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF-------YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            DRIAIIS GKL+CCGSS+FLK K+G GY L +VK                          F ++K+     +S++G K                            +  F++  IP AK+  +  T+  F LP+  +++  F  LF  L+  +  L   SYG+SDT+LEEVF++VA++     +NEE     L        I   + R++         +  +P L++ D N+    D     S+ S+  +          +HK+  G    K Q + L +KRFH+ +R+ KG   E++LP + + + +   K++  ++  PA+E+ PW+ +P    + +L  FY               N    + L D LE + RS LG  G RCMN S+Y    Y C P     +W+P P   GN  L SP C C+T GYQ C  P +GGP  S R+M ++D+L N+TG N+SD+L+K  +   ++ +GGY     N   Q  SS+L       D +  +VN  QP  L     +    +   K+    N  ++W N+KG+A+M +Y N ++N++LRS++   ++   YGI+V+N+P+A +  +I +   N   + V +AI VI A+SFI ASFV++LI+ER+S SK  QFVSG+N   YWVS+  WDIM Y + +++ I++F+AF+ +SY+   NA   +LLL  YG A+IP M+PF++    PSTAFV L   N+ +G  +T+ST++L+    + E L +IN +L++VFLI P + LGRG++D+  N         Y + + VK   +  +WD  G  LF+L      W+   ++IE     +  C    +S    ++  + ED DV  ER R  S +   D+LRV NLTK++                 + + K + VAV+ LCF V +GECFGLLGVNGAGKTTTF
Sbjct:  797 DRIAIISLGKLRCCGSSLFLKNKYGSGYYLTMVKANSDEKPADRPVTALSNRTVSDIKAQFVSEKDEGVADMSDTGSKSEHSDSDQSATPPPEYEDPVPCVKDSSDVAVFVQKFIPSAKLVEDMGTELCFQLPEEGTHTGAFEALFRALESNLTKLGITSYGISDTTLEEVFLKVAEESGVDDVNEEQTRNALERYTEGGKIARPVTRLSFRKKKLDFFKKSKPVLNISDTNELVDSDFEDADSVASMPVSEVSTAQGGAGSHKV-TGLAHTKDQFLALFVKRFHHVRRSYKGFVCEILLPAIFVCIAMIFTKIIPVIKENPALELQPWMYVPITGTNPHLTVFYT--------------NDAPGSMLADSLERQIRSPLG-IGTRCMNSSVYSIRGYPCTPASSAERWTPSPAVTGNTSLDSPSCSCDT-GYQTC-PPGAGGPLGSSRVMDNTDRLVNMTGRNVSDWLVKTMEDYKKRRYGGYSLGERNQLVQLNSSQLYQ---VVDRLSRAVNNGQPV-LNGNESIWSDIDALIKNVAVQNNVKVWFNNKGWAAMASYMNAMNNVILRSKLPPGKDPAQYGITVSNHPMAPTNKQIERDTLNSAWISVLVAIGVIFAMSFIPASFVLYLIEERVSNSKHLQFVSGVNRVTYWVSHLAWDIMNYSVSMVLCILLFLAFNERSYVSPTNAPCLVLLLFLYGWAMIPMMFPFNYLFKVPSTAFVALACVNVFLGVTSTLSTYVLEFFSDDQE-LVQINTVLRQVFLILPHYCLGRGLIDMAANQLIADVAGIYVAGTAVK---DPFEWDQVGRNLFALAVSGAAWFGFTLLIEY----KFFCTSRLSSNENAVD--DNEDIDVARERRRAMSAEARSDILRVENLTKVF-----------------HKRRKGKFVAVDRLCFSVPKGECFGLLGVNGAGKTTTF 1690          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: V4ABB8 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_212836 PE=4 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 2.403e-134
Identity = 323/920 (35.11%), Postives = 488/920 (53.04%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN-----FNAQKENFRKGI--------------------------SNSGD----KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNF-------NRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNN----KWSPIP--NGNIPLISPECDCNTTGYQICNDPR-SGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLS--------RKIFGGYQFLLPNDFAQ--SSKLI----AQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLI-LLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEY------NALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            DRIAIIS GKL CCGSS+FLK KFG GY L LVK       N   ++   G+                          S +G     ++  F++ ++ +A++  +  T+  + LP    +S  F  LF  L+     L   S+GLSDTSLEEVF+ VAD+    N +   ++   +N  +   +  + N+   ++  +L +    + S+ S          N   + L G+ L+  Q + L IKRFH+ +R+KKG   E+ILP   + L IA   ++ PL + P +E+ PWL +PK    NL  FY               N N  + L + LE    S     G RCMNP +Y    Y C  E  +N    KW+  P   GN+ + SP CDC + G+  C  P+ +GGP  S   + ++D L N+T  NISD+LL +    S           + G  F   N  A   SS+++      S   +G +  VN S   +++ L           +   T N +++W N+KG+AS  +Y N+L+N++LRS++  +++  +YGI+  N+P+A ++ + S    L  ++++ +AI VI A+SFI ASF+IFLI+ER+S SK  QFVSGINP +YW+S F WD++ Y++P  + ++IF+AFD +SY+ + N    + LL  YG AIIP MYPFS   S  S+AFV ++  N+ +G ++T+STFI+++LE + + L +IN ILK VFL+ P + LGRG++D+  N       + K  +      N L WD+ G  LFSL  L I ++I+  +IE           +K  Y+K  E  N ED DV+ E++R+ S +  +DVL + NL+K++                 Y   + +  AV+NLC GV  G+CFGLLGVNGAGKTTTF
Sbjct: 1089 DRIAIISHGKLCCCGSSLFLKSKFGSGYYLTLVKQDGNGAVNVDDDDDEDGLKKALNDDDGLRPSTADVDEGFGESNGSTTGSLSVGRITGFVQKYVKNAQLVEDNSTELCYQLPTEAMSSGDFEALFTQLERSHHELGIDSFGLSDTSLEEVFLAVADE---TNVDDLTDEATRNNFRKKKKFNFLRNRRSRIEHTELVEDTDDNVSIASSTLENRVGFANSGVQKLHGWSLIFNQFLALFIKRFHHVRRSKKGFVCEIILPAGFVALAIAFSLILPPLVTEPPLELHPWLYVPKKSEPNLYMFY--------------SNDNPRSTLANSLEQALLSK-PWVGTRCMNPDVYSIDGYPC--EGSSNSQYLKWTERPKMTGNLTIDSPSCDC-SRGFPDC--PKGAGGPTPSMSYLPTTDYLYNMTARNISDWLLAHIPSFSICFDMFIFHYRYAGISFGDINPLADVNSSQIVDIINRLSEAANGGQPIVNNSFLTDIDTLA----------RGFLTRNVAKVWYNNKGWASSVSYMNVLNNMILRSKLPANKDPADYGITTINHPMAYNQKQFSAEAILTSVIDLIVAICVIFAMSFIPASFLIFLIEERVSDSKHMQFVSGINPTIYWISTFAWDMVNYLVPATLCVLIFLAFDQESYVSASNFPCLLALLFLYGWAIIPLMYPFSRLFSVSSSAFVTISCANVFLGVVSTLSTFIVELLEQSDKELADINTILKSVFLVLPHYCLGRGLIDMTRNQL--QYDLTKQFFPDAKPSNILAWDLVGRNLFSLAMLGIFFFILNWLIEYRFF-------IKPRYVKESEDTN-EDIDVSREKQRVLSGEADNDVLVLKNLSKVF-----------------YGARRKKLKAVDNLCVGVPRGQCFGLLGVNGAGKTTTF 1948          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: N1PB02 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226736 PE=4 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 4.893e-131
Identity = 310/898 (34.52%), Postives = 472/898 (52.56%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN---------FNAQKENFRKGISNSGD-KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNE-KLIPDNLNRIAVYG-----------------DIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMP-KSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNG-NIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSS-----KLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFN-NLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNAL---------QWDIAGEKLFSLFSLSIGWWIVLIIIESG--IVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAII+QGKL C GSS+FLK  FG GY L LVK+          + + EN  +   N+G+     FI   +P+A +      + ++ LP + S++  F  LF +LD  + +L  LSYG+SDT+LEEVF++VA++  + N  ++ + +   + L    +Y                  D E+ E  LD  D N  + V  + IS N   ++K+  G  L+ +Q + + IKRF+Y +R+KK   ++                        PAMEI PWLM P K +  +L TF+          +N L ++     + D L  +        G+RCM+P +Y    +RC  + ++++WS +    + P    EC C + GYQ C    +G   + Y ++ ++D++ N+TG NISD++LK  Q   ++ +GG  F   ND  +++      + AQ  T     D+ N + P  +  L       E   K+  T   ++IW N+KGY SM AY NI++NL+LR+ +    +   YGIS+ N+P+  + +++  +     +++V +++ VI A+  I ASFV+FLI+ER+SGSK  QFVSG+NP VYWV+NF WD++ Y++  I+ I+IF+AF   +Y+   NA   + LL+ YG A  P MYP S F + PS+AFV+L   N+ +G I+T+STFIL+      + L EIN I+ KVFL+ P + LGRG++D+        N +V   +  L          WDI G  L SL  L + ++ + I IE    I +       K      +E  + ED DV  ERER++    S D+L +  LTK+Y                + +KNK    AV+ L  GV  GECFGLLGVNGAGKTTTF
Sbjct: 1093 GDRIAIINQGKLCCVGSSLFLKSNFGGGYYLTLVKDERKGDSASTSDVKVENATED-GNAGEISTTAFIMERVPEAVLVESIGIEMTYQLPNDKSHTASFEKLFRDLDAHLSSLGLLSYGVSDTTLEEVFLKVANESEEANHLSEEDVRQGTERLTDGGMYARPVTRLSFRKRNFFASKDRESNE-LLD-ADGNPDSAVSTASISCNGTGSYKV-TGLSLIPRQFLAIFIKRFNYLRRSKKAFISQE-----------------------PAMEIHPWLMSPSKLQDSHLFTFF----------SNDLPSEAWTQAIEDLLTQK-----PGLGVRCMDPDVYSLKGFRCV-DAEDSQWSNVEEDFDEP---EECSCES-GYQRCPKGAAGAEASKY-LLPTTDEMYNMTGRNISDWILKTSQEYIKRRYGGLTFGERNDLLRANDTEVDSIFAQLATAAAGDDTNNVTLPGLILDL-------ENLIKNIATKRNAKIWFNNKGYVSMVAYMNIMNNLVLRAHLPPDTDPSRYGISLINHPMNRTSSQLYAYTLKASIVDVMISVSVIFAMCLIPASFVLFLIEERVSGSKHLQFVSGVNPVVYWVANFTWDMLNYLVSGILCILIFVAFQQNAYVSQTNAPCLVSLLLLYGWAATPMMYPASHFFNVPSSAFVILGCMNIFLGIISTLSTFILEAF--MEQELDEINAIIMKVFLVLPHYCLGRGLIDM------TRNQLVADIFENLGETFFQSPFTWDIVGRNLLSLSILGVFFFFLNICIEYKFWIYSMKCISPCKEQIPVNVEETDEEDIDVVRERERVTLGAASGDILTLEGLTKVYK---------------SPLKNKGHR-AVDRLSVGVHSGECFGLLGVNGAGKTTTF 1911          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A2T7NPT0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_16419 PE=4 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 1.319e-120
Identity = 287/826 (34.75%), Postives = 446/826 (54.00%), Query Frame = 2
Query:  161 KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINE---ETKNEKL--------IPDNLNRIAVYGDIEN---------QEPFLDLEDLNQQAFVDKSLISLNFNRNHKL-LRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNN-KWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSV-NQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSW-NYGISVTNYPIADSETKISQFNNL-ILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYF---YNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            +L  FI+ ++PDAK+  +   +  F +P + + S   + LF  L++   +L   SYG+SDTSLEEVF++V ++ +   E   E    KL         P  ++R++    I N         +E   D +D + +     +     F+   K+ + G  L   QII L IKRFH+ +R+KKG   E +LP   + L +    +  P+E +P +E+ PW   P     +L  F+  +N          G+   +      L S +       G RCMNP +Y  + Y C      +   SP   G+     P C C++ G+Q C D  +GGP  + R +  +D L N+TG +I D+LLK  ++   + FGG+ F    D    S+L A   T   I D V   +      P   ++  +EFFN +    N +++W N+K +AS  AY + L+N++LRS +  S+  W +YGI   N+P+  ++ ++ + + +   + V +AI VI A+SF+ ASFV+FLI+ER+S SK  QFVSGINP +YWV+NF+WD+M Y+IP ++ I IF+AF  ++Y+ ++NA   + LL  YG AI P MYPFS   S PS+AFV L+  N+ +GT++T++TFIL++L      L+EIN ILK+VFL+ P + LGRG++D+  N       +   V   Y   QW+  G  LF+LF L I ++I+  +IE      I   K ++      + +  ED DV  ER+R+ S     DV+++ NLTK+  +        G        + + ++ AV++LC G+ +G+CFGLLGVNGAGKTTTF
Sbjct: 1189 RLRAFIEKYVPDAKLVEDNSMEVCFQIPDSSAKSGCLTTLFAELEKFCHHLGVSSYGISDTSLEEVFLKVTEENSNAEEDKDENTRRKLDVITDHGRYPRPVSRLSFRSKIRNTFFSNHVDAKELLDDTDDTSSEGSSASAEEGNTFSGAGKIQVTGRQLTLSQIIALLIKRFHHVRRSKKGFICEFVLPAAFVCLAMVFSLIQPPVEDMPPLELHPWHYQPTKGDSSLYIFFSNDNP-------SQGHARKLEETL--LNSPFH------GARCMNPDVYTISGYSCLSSDTGSFSASPKLTGDPSKDFPACSCDS-GFQRCPD-GAGGPEPARRFLPVNDNLYNMTGRDIPDWLLKTMEQYMIRRFGGFSF---GDENPLSRLNASQMT-AAISDIVLAVTNGTTTLPDSVVRDAEEFFNNAVVQDN-AKVWFNNKAWASSVAYMSSLNNIILRSYLPPSK--WQDYGIVTVNHPMNFTKGQLDRESIMNSAVNVVVAICVIFAMSFVPASFVLFLIEERVSSSKHLQFVSGINPTIYWVTNFMWDMMNYLIPAVLCIFIFLAFGKEAYVSAQNAPCLVALLFLYGWAITPMMYPFSRLFSVPSSAFVALSCVNVFLGTVSTLATFILELLGREDPDLEEINTILKQVFLLLPHYCLGRGLIDMATNQLIVDLAARYGVTCTYKMFQWNYVGRNLFALFMLGILFFIINWLIEYKFF--ITWSKTEH------KSQEVEDVDVAKERQRVLSGGADGDVMKLENLTKVCLL--------GS-------RQERQDEAVDHLCVGIPQGQCFGLLGVNGAGKTTTF 1967          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A1D1VFB8 (Uncharacterized protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_09881 PE=4 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 8.082e-119
Identity = 315/887 (35.51%), Postives = 463/887 (52.20%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFL---------DLEDLNQQAFVDKSLISL-----------NFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVN-PLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPL-ISPECDCNTTGYQICNDPR-SGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSK------TMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLE----VTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFF-NYFYNSNSIVKHEYN--ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            SDRIA+I+ G+L C GS VFLK +FG GY L +VK+ +   E          ++L +FI++ +P+A +     ++ SF+LP +     +F  LF  LD  +  LN  SYG+ DTSLEEVF+RV D  +  N + K+E L     N +A  G +                 LED    A    S +S            + N   K + G  L  QQ+  + IKRFH  +R+KK  F E++LP L + L + +  L   PLE  PA+E++PWL  P +       F+  E         Q G+ N+   L +  E          G RCM  S        C P  KN+     P   +    +P C C+  G QIC  PR +GGP     ++ ++D L N+TG N+SD+L K  +      +GGY F   + FAQ +  + +    DG+R  V Q+Q QN EP+      Q  +   +K      T +  ++W N++G+AS  +Y N ++N++LRSR+K   + + YGI   N+P+  +E    Q  + I+ E    +  A+ +I A+SF+ ASFV+FLIDER+SG+K  QF + + P++YWVS ++WDI+ Y +   I I+IF+AF+ Q+Y+ S NA A I LL  YG A IP MY  S+    PS+AFV L   NL +G ++TI+ FIL++L+ + E L+E+  IL+KVFL+ P + LGRG+MDL   N   N  S    E +    +W   G  +F +    I ++++ I+IE     R    K K   +    +RN ED DV  ER R+++    + VL   NL+K +                   K K   +AV+N+ F V +GECFGLLGVNGAGKTTTF
Sbjct: 1119 SDRIAVIADGRLVCSGSPVFLKSRFGCGYYLTVVKSSSDTNE----------EELGRFIRAFVPEAVLIENVGSEMSFILPTDVKKEGRFEALFEALDTMLARLNISSYGIRDTSLEEVFLRVMD--SHNNHKEKDEDLA----NGVASEGFLAKMRRRYRGGGNPVDGALEDPAALATSGGSTLSSQSQSVALDDWDHINVAIKRVYGPRLALQQMKAMHIKRFHNLRRSKKSFFCEILLPALFVCLAMVVTLLTPVPLEQ-PALELTPWLYGPPNY-----MFFADE---------QPGSPNTSVLLRNMYEGP------GIGTRCMKGSPVSGKS--CIPTIKNDISQLTPEFPVSRNATPSCSCDVGG-QIC--PRNAGGPMPPCMLLNTTDWLCNMTGRNVSDWLTKTAKNYDSTRYGGYSFGEVDTFAQFNFTVWK----DGLRAMVEQAQ-QNEEPVPHENGLQGRWRNFAKLLSGMFTKDNIKVWFNNRGWASSVSYTNAINNVILRSRLKAGADPYQYGIMAVNHPLNRTE---EQMEDQIIKESAKSLLHAVCIIFAMSFVPASFVMFLIDERVSGAKNLQFTAKVKPWLYWVSTYIWDIVNYSLTACICIMIFLAFNEQAYVSSTNAPALICLLFLYGFAAIPMMYIPSYLFKVPSSAFVALACANLFLGLVSTITVFILELLD-DVE-LQEVAAILRKVFLVLPHYCLGRGLMDLAITNVKANVFSRFGQEVDDHPFEWTFMGRNVFCMMVQGIVFFLLTILIEY----RFFV-KPKRVTVASEVLRN-EDRDVAAERARVAAGHADNSVLTCRNLSKAFK------------------KRKQTYLAVDNISFAVEKGECFGLLGVNGAGKTTTF 1929          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: ENSAMXT00000016919.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:9912642:9956080:1 gene:ENSAMXG00000016432.2 transcript:ENSAMXT00000016919.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 385.185 bits (988), Expect = 3.109e-114
Identity = 289/927 (31.18%), Postives = 477/927 (51.46%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQKENFRKGISNSG---------------DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQ--EPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWS--PIPNGNIPLI----------SPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKI-----------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQ-NLEPL---RFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK   G GY L LVK                 ++  + +   +  S++G                 +   I  H+P+A+M  +   + +++LP   +    F  LF ++D+ + +L   SYG+SDT+LEE+F++VA+D + ++ E  ++   P    R   +G       +P    D  D N+     +S     +S +  +    ++G+ L +QQ + L  KRF YA+R++KG FA+++LP + + + +    +V P    P++ + PW+                E+Q+ F I++      S    T RL +      G  G RCM           C     ++ WS   +P   + ++          SP C+C++ G +     C     G PP   +I +  D L NLTG NISDYL+K + ++  K            +GG+        A+S++++   P  + I D++ + +   NLE +   RFLK    F N    T N  +IW N+KG+ S+ A+ N+++N +LR+ +   ++   YGI+  N+P+  ++ ++SQ   +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P++YW++NF+WD+  Y++P  ++I+IF+ F  ++Y+ + N     LLL+ YG +I P MYP SF    PSTA+VVL + N+L+G   ++STF+L++   N   +  INDILK V LIFP F LGRG++D+  N    ++++ +   N      +WD+ G+ LF++    + ++I+ ++I+     +       N+ L  I     ED DV  ER+R+ S     D+L +  LTK+Y                     + ++ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct:  993 GDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTLVKKEPEASLSSCRNSSSTVSYVKKDDEASESSSDAGLGSDHESDAATAIDISLISGLIIKHVPNARMVEDLGHEITYILPYESAKDGAFVELFHDMDDHLADLGISSYGVSDTTLEEIFLKVAED-SGVDTEILSDGTFPIRRRRRHAFGADHQSCLKPLTEDDRYDGNESEVDPESRETDYLSGSDGKGSYQIQGWSLKRQQFLALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALQPWMY---------------EDQVTF-ISDDAPEDAS----TQRLLAALMEGPG-FGTRCMEGEPIPDAP--C--TIGDDDWSIPEVPESVLEVLMSQNWTMDNPSPACECSSDGKKKMLPECPASAGGLPPPQIKI-SERDTLQNLTGRNISDYLVKTYAQIIGKSLKNKVWVNEFRYGGFSL-----GARSTQVL---PPAEEIDDAIARVRVIFNLEKVTADRFLKSLSAFIN-GLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRANLPPEKDPSKYGITAFNHPLNLTKEQLSQVALVTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFIWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFEIPSTAYVVLTSVNILIGINGSVSTFVLELFGNN--EIGGINDILKNVLLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPFEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFK------PNAKLSPI---GEEDEDVARERQRIVSGAGQGDILELRELTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1851          

HSP 2 Score: 56.6102 bits (135), Expect = 1.357e-7
Identity = 36/124 (29.03%), Postives = 62/124 (50.00%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G+ +C GS   LK +FGDGY +IL             G       +++FI+S +P + ++ +      + LP + S+    + +F  L +  D L    Y +S T+L++VF+  A D
Sbjct: 2008 RMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRV----------AGPDPDLQPVMKFIESELPGSTLKEKHRNMLQYQLPSSVSS---LAHIFSILAKHKDFLRIEDYSVSQTTLDQVFVNFAKD 2118          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: zgc:172302 (zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5])

HSP 1 Score: 381.719 bits (979), Expect = 4.579e-113
Identity = 290/888 (32.66%), Postives = 451/888 (50.79%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDL--NQQAFVDKSLISLNFNRNHKL---------LRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCM--NPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDF--------AQSSKLIAQSPTWD----GIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILL----EVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVK----HEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIISQGKL CCGSS+FLK   G GY L  VK    ++   R   S SG+ L+   + ++  A++  +   +    LP   S     +     LD+       +SYGLSDT+LEE+F++VA++     E        PD           +  EP  D + +  NQQ     SL+         L         L G+ L  QQ+  L  KR  YA R++KG  A+++LP L I + +    +V P+   PA+E+ PW+                  Q  F       N    +P    L S      G  G +C+  +P I  ST ++ F           PN  +   SP+C C+T   +     C +   G PP   + +T  D L NLTG NISDYL+K + ++ +K     +++  N+F        A+ S+ +  S   +     IR     ++  +L+ L  L    + F   +   N  ++W N+KG+ +M ++ NI++N LLR+ +        +GI+  N+P+  ++    Q ++++L+    +V L+I VI A+S + ASFV+FLI+ER+S +K  QFVSG+ P +YW +NF+WD++ Y +P  ++++IFI F  Q+Y+  KN  A +LLL+ YG AI P MYP SF  S PSTA+V L + NL +G   +I+TF+L++     E+L+E+N ILKKVFLIFP F LGRG++D+  N    ++++ +    H  + + WD  G+ LF++    + ++I  I+++     R      +      +     ED DV  ER+R+ + +  DD+L +I+L+K+Y                       ++ AVN LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1003 GDRIAIISQGKLCCCGSSLFLKSHLGTGYYLTAVK----KELQSRTPTSASGNGLVALAQHYVSGARLVEDVGREVVINLPHAASEDGTLALFLAELDKRQAEFGIISYGLSDTTLEEIFLKVAEETGVDAE--------PDEAATPPAVSPSQQGEPPEDRDAVLFNQQV----SLLYTEAQETDPLSGDGRGSVSLTGWGLTWQQLRALFTKRLLYATRSRKGFIAQIVLPALFILIDLLFSLIVPPMGKYPALELQPWMY---------------GEQFTF-----FSNDAPQDPAMQNLLSALLDPPG-FGTKCLFNSPQIPFST-WKLFNS---------PNWTMEHPSPDCMCSTEEVRRMLPDCPEGAGGLPPPQIKRLTG-DILQNLTGRNISDYLMKTYPQILKKSMKTKKWV--NEFRYGGFSLGAKGSQTLIGSLQLEESVMAIRKQYKIAENSSLDQL--LDRLPDLFTDLNSQNNV-KVWYNNKGWHAMVSFVNIMNNGLLRASLPPGPERQKHGITAYNHPLNLTK---EQLSDMVLMTTSVDVLLSISVIFAMSLVPASFVLFLIEERVSKAKHLQFVSGVKPILYWTANFVWDMLNYTVPATLVVLIFIGFQQQAYVSEKNLPALVLLLLLYGWAITPLMYPASFVFSVPSTAYVTLTSINLFIGINGSIATFVLELF--TNEHLREVNRILKKVFLIFPHFCLGRGLIDMAKNQAM-ADALQRLGKCHMPSPIVWDFVGKNLFAMAVEGVVFFIFTILLQYKFFIRCRLPWFE----PVLPPLCAEDEDVGRERDRVKNGRTQDDILTLIDLSKVY--------------------KSGKKPAVNRLCLGIPRGECFGLLGVNGAGKTSTF 1807          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: zgc:172302 (zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5])

HSP 1 Score: 375.17 bits (962), Expect = 7.591e-111
Identity = 283/898 (31.51%), Postives = 446/898 (49.67%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN--------------FNAQKENFRKGISNSGDK--------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPI--PNGNIPLISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDF--------AQSSKLIAQSPTWD----GIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILL----EVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSI----VKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            DRIAIISQGKL CCGSS+FLK   G GY L  VK                 A  ++ R   +  G +        L+   + ++  A++  +   +    LP   S     +     LD+       +SYGLSDT+LEE+F++VA++     E        PD           +  EP  D ++ +  +   +  +SL          G+ L  QQ+  L  KR  YA R++KG  A+++LP L I + +    +V P+   PA+E+ PW+                  Q  F       N    +P    L S      G  G +C+       T +   P+   + W     PN  +   SP+C C+T   +     C +   G PP   + +T  D L NLTG NISDYL+K + ++ +K     +++  N+F        A+ S+ +  S   +     IR     ++  +L+ L  L    + F   +   N  ++W N+KG+ +M ++ NI++N LLR+ +        +GI+  N+P+  ++    Q ++++L+    +V L+I VI A+S + ASFV+FLI+ER+S +K  QFVSG+ P +YW +NF+WD++ Y +P  ++++IFI F  Q+Y+  KN  A +LLL+ YG AI P MYP SF  S PSTA+V L + NL +G   +I+TF+L++     E+L+E+N ILKKVFLIFP F LGRG++D+  N    ++++     K     L+WD  G+ LF++    + ++I  I+++     R      +      +     ED DV  ER+R+ + +  DD+L +I+L+K+Y                       ++ AVN LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1056 DRIAIISQGKLCCCGSSLFLKSHLGTGYYLTAVKKELQSRTPTSASGKLLAADTDSTRSDDTGLGSEVNSSVISGLVALAQHYVSGARLVEDVGREVVINLPHAASEDGTLALFLAELDKRQAEFGIISYGLSDTTLEEIFLKVAEETGVDAE--------PDEAATPPAVSPSQQGEPPEDRDETDPLSGDGRGSVSLT---------GWGLTWQQLRALFTKRLLYATRSRKGFIAQIVLPALFILIDLLFSLIVPPMGKYPALELQPWMY---------------GEQFTF-----FSNDAPQDPAMQNLLSALLDPPG-FGTKCLCTGENVGTKFNS-PQIPFSTWKLFNSPNWTMEHPSPDCMCSTEEVRRMLPDCPEGAGGLPPPQIKRLTG-DILQNLTGRNISDYLMKTYPQILKKSMKTKKWV--NEFRYGGFSLGAKGSQTLIGSLQLEESVMAIRKQYKIAENSSLDQL--LDRLPDLFTDLNSQNNV-KVWYNNKGWHAMVSFVNIMNNGLLRASLPPGPERQKHGITAYNHPLNLTK---EQLSDMVLMTTSVDVLLSISVIFAMSLVPASFVLFLIEERVSKAKHLQFVSGVKPILYWTANFVWDMLNYTVPATLVVLIFIGFQQQAYVSEKNLPALVLLLLLYGWAITPLMYPASFVFSVPSTAYVTLTSINLFIGINGSIATFVLELF--TNEHLREVNRILKKVFLIFPHFCLGRGLIDMAKNQAM-ADALQRLGTKQTLEPLEWDFVGKNLFAMAVEGVVFFIFTILLQYKFFIRCRLPWFE----PVLPPLCAEDEDVGRERDRVKNGRTQDDILTLIDLSKVY--------------------KSGKKPAVNRLCLGIPRGECFGLLGVNGAGKTSTF 1878          

HSP 2 Score: 55.0694 bits (131), Expect = 4.210e-7
Identity = 42/148 (28.38%), Postives = 69/148 (46.62%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVA----DDPAKINEETKNEKLIPDNLNR 439
            R+AI+  G+ QC GS   LK +FGDGY +IL    +A  ++           +  +IK+      ++        + LP   SNSC  + +F  L    + L    Y +S T+L++VF+  A    DD  +++  T N  L+    +R
Sbjct: 2035 RMAIMVNGRFQCLGSVQHLKNRFGDGYTIIL--RLSAPPKD--------PCPVDAYIKNSFTGIVLKERHHNVLQYQLP---SNSCSLARVFDVLSNNYEELGVTDYSISQTTLDQVFVNFAKEQTDDDDQLSGVTVNGGLVAAQTSR 2169          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca1a (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:103028164])

HSP 1 Score: 369.777 bits (948), Expect = 5.662e-109
Identity = 290/920 (31.52%), Postives = 465/920 (50.54%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK---------------NFNAQKENFRK-----------GISNSGDK---------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMN---PSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTS-SDKLNNLTGYNISDYLLKNFQR-----LSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQ-----SQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLK--NSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 +  K + +K           G+ +  +          +   I  H+P A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG++DT+LEE+F++VA+D   ++ ET +  ++     R A  GD ++   PF   D  D N      +S     +  +  +    ++G+ L +QQ + L  KRF YA+R++KG FA+++LP + + + +    +V P    P++E+ P +   +       TF   +   +      LG        + R   E +S  G   IR      P I  +        +    WS     + P  S EC C  +   +   P   G     +I  S +D L NLTG NISDYL+K + +     L  KI      +GG+        A+SS+ +   P  D + D+++      S  +     RFLK    F  +   T N  +IW N+KG+ S+ A+ N+++N +LR+ +    +   + I   N+P+  ++ ++SQ   +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P++YW++NF+WD+  YI+P  ++IIIF+ F  ++Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   ++STF+L++   N   +  INDILK VFLIFP F LGRG++D+  N    ++++ +   N     L WD+ G+ LF++    + ++ + ++I+        C K +  ++ LK I     ED DV  ER+R+       D+L +  LTK+Y                     + ++ AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1101 GDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKRDFDLSLSSCHNSSSTVSYSKNSLKKEDSVSESSSDAGLGSDHESETTTIDVSLISNVIFKHVPSARLAEDLGHELTYVLPYEAAKDGAFVELFHEIDDRLIDLGISSYGIADTTLEEIFLKVAEDNG-VDAETSDGTILSRRNRRHAFGGDHQSCLRPFTEDDSFDFNDSEGDPESRETDWLGGSDGKGSYQVKGWSLKRQQFVALLWKRFLYARRSRKGFFAQIVLPAVFVCIALIFSLIVPPFGKYPSLELEPSMYEEQF------TFVSNDAPEDLQTNKLLGALTERPAYSKRCAEEAKSVDGSCPIRAEEWEMPEIAETVR----DMFVTGNWSM----DHPSPSCECSCEHSKKMLPECPPGAGGLPPPQIKVSQTDTLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSL-----GARSSQPM---PPADEVHDAISHLRRRFSLERGTSADRFLKSLSGFI-QGLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRTSLPAGLDPAKFAIKAFNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHLQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSN--EIGGINDILKNVFLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFFITVLIQYR-----FCIKARGFSANLKPI---GEEDEDVARERQRILGGGGHSDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTF 1965          

HSP 2 Score: 56.6102 bits (135), Expect = 1.330e-7
Identity = 36/125 (28.80%), Postives = 64/125 (51.20%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLIL-VKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G  +C GS   LK +FGDGY ++L V   + Q E            +++FI+  +P + ++ +      + LP + S+  +   +F  L +  D L+   Y +S T+L++VF+  A D
Sbjct: 2122 RMAIMVNGTFRCMGSVQHLKNRFGDGYTIVLRVAGADPQLE-----------PVMKFIEHELPGSTLKEKHRNMLQYQLPSSLSSLAR---IFSILAKNKDELHIEDYSVSQTTLDQVFVNFAKD 2232          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca1a (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:103028164])

HSP 1 Score: 369.777 bits (948), Expect = 5.662e-109
Identity = 290/920 (31.52%), Postives = 465/920 (50.54%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK---------------NFNAQKENFRK-----------GISNSGDK---------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFL--DLEDLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMN---PSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTS-SDKLNNLTGYNISDYLLKNFQR-----LSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQ-----SQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLK--NSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK + G GY L LVK                 +  K + +K           G+ +  +          +   I  H+P A++  +   + ++VLP   +    F  LF  +D+ + +L   SYG++DT+LEE+F++VA+D   ++ ET +  ++     R A  GD ++   PF   D  D N      +S     +  +  +    ++G+ L +QQ + L  KRF YA+R++KG FA+++LP + + + +    +V P    P++E+ P +   +       TF   +   +      LG        + R   E +S  G   IR      P I  +        +    WS     + P  S EC C  +   +   P   G     +I  S +D L NLTG NISDYL+K + +     L  KI      +GG+        A+SS+ +   P  D + D+++      S  +     RFLK    F  +   T N  +IW N+KG+ S+ A+ N+++N +LR+ +    +   + I   N+P+  ++ ++SQ   +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P++YW++NF+WD+  YI+P  ++IIIF+ F  ++Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   ++STF+L++   N   +  INDILK VFLIFP F LGRG++D+  N    ++++ +   N     L WD+ G+ LF++    + ++ + ++I+        C K +  ++ LK I     ED DV  ER+R+       D+L +  LTK+Y                     + ++ AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1101 GDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKRDFDLSLSSCHNSSSTVSYSKNSLKKEDSVSESSSDAGLGSDHESETTTIDVSLISNVIFKHVPSARLAEDLGHELTYVLPYEAAKDGAFVELFHEIDDRLIDLGISSYGIADTTLEEIFLKVAEDNG-VDAETSDGTILSRRNRRHAFGGDHQSCLRPFTEDDSFDFNDSEGDPESRETDWLGGSDGKGSYQVKGWSLKRQQFVALLWKRFLYARRSRKGFFAQIVLPAVFVCIALIFSLIVPPFGKYPSLELEPSMYEEQF------TFVSNDAPEDLQTNKLLGALTERPAYSKRCAEEAKSVDGSCPIRAEEWEMPEIAETVR----DMFVTGNWSM----DHPSPSCECSCEHSKKMLPECPPGAGGLPPPQIKVSQTDTLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSL-----GARSSQPM---PPADEVHDAISHLRRRFSLERGTSADRFLKSLSGFI-QGLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRTSLPAGLDPAKFAIKAFNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHLQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSN--EIGGINDILKNVFLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFFITVLIQYR-----FCIKARGFSANLKPI---GEEDEDVARERQRILGGGGHSDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTF 1965          

HSP 2 Score: 56.6102 bits (135), Expect = 1.330e-7
Identity = 36/125 (28.80%), Postives = 64/125 (51.20%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLIL-VKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G  +C GS   LK +FGDGY ++L V   + Q E            +++FI+  +P + ++ +      + LP + S+  +   +F  L +  D L+   Y +S T+L++VF+  A D
Sbjct: 2122 RMAIMVNGTFRCMGSVQHLKNRFGDGYTIVLRVAGADPQLE-----------PVMKFIEHELPGSTLKEKHRNMLQYQLPSSLSSLAR---IFSILAKNKDELHIEDYSVSQTTLDQVFVNFAKD 2232          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:ZFIN;Acc:ZDB-GENE-030131-9790])

HSP 1 Score: 186.808 bits (473), Expect = 9.145e-49
Identity = 148/493 (30.02%), Postives = 241/493 (48.88%), Query Frame = 2
Query: 1130 NLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNY-GISVTNYPIADSETKISQFNNLILL---EVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEV--NYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYL-----KRIEIRNTE-DFDVNLERERMSSDQK------SDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            NL+G ++ +YL+    +   K +GG+ F LP+      +++                 P N    +  +             N  ++W N +GY ++PAY N  +NLLL   +   ++  +Y GISV + P A  +  +SQ  ++IL    +  +AI ++L  S ++ SF   ++ ERI+GSKR Q +SG++P  YW  NF +D++ Y +   + I +  AF   +Y  + N  A  LLLI +G A +P MY  S   S    AFV   + N+++G  T ISTF+++ L +  + + L    +I++ +FL+FPQF LG G++ L      +   +++     L  D    +  S F++ I  W  + +  +GIV   +   L +S++     K +E    E D DV  ER R+    +       DD L+++ L K Y +                  N++   AV+ L  GV   +CFGLLGVNGAGKTTTF
Sbjct: 1059 NLSGEDVEEYLMGTTCQYLLKRYGGWSFGLPHSTTSDLEVV-----------------PDNRTLTKVWR-------------NHMKVWYNPEGYHALPAYVNSFNNLLLWDNLPDGEHPGDYKGISVNSKPYAGQQ--LSQ--DMILQNLGDTGVAICILLGFSILTGSFATAVVRERITGSKRLQQISGVSPTFYWAVNFTYDMVSYTVTTGLCIAVIAAFHLPAYTDNSNLGAVSLLLILFGFASLPWMYLISGVFSEEEMAFVTYISINIILGVSTIISTFLVNFLYLSSDSQSLYNAYNIMRWLFLVFPQFCLGWGLVSL------SKQRLMEDIMKLLGSD---PQESSSFAMDITGWPFVALAVNGIVCFTLRLVLTDSFIRWWRRKAVEPGQPELDTDVQAERSRVEEQSRVVDAATPDDTLQLVGLRKRYRLL-----------------NRSF-TAVDGLHLGVSPNQCFGLLGVNGAGKTTTF 1490          

HSP 2 Score: 72.0182 bits (175), Expect = 4.477e-13
Identity = 44/141 (31.21%), Postives = 77/141 (54.61%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSG-DKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIP 424
            D++AI+  G+ +C G+   LK +FG+G+ + L           R    NS   ++ +FI SH P A ++ + ++Q  F +P   SN+ K S +F+ L++E ++L+   Y +S T+L++VFI  A     + EE+ N    P
Sbjct: 1652 DKLAIMVNGQFKCLGTLQHLKNRFGNGHMIKL-----------RLSSGNSKVTEVTEFITSHFPGAYLKEQHISQLEFQVP---SNAGKLSEIFIALEKEKESLSIQHYSISQTTLDQVFINFARQQIDMEEESSNADARP 1778          

HSP 3 Score: 70.0922 bits (170), Expect = 2.064e-12
Identity = 67/269 (24.91%), Postives = 109/269 (40.52%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFN----AQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWS------FVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFI---RVADDPAKINEETKNEKLIPDN----LNRIAVYG-------------------DIENQEPFLDLEDLNQQAFVDK-----------SLISLNFNRNH----KLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAE 655
            SDRIA++  GKL+CCGS  +LK  +G G  L L K       +Q            ++++  ++S +  A +++   +  +      F+LP +  N    S   V L+E ++ L    Y +SDT+LEEV +   RV  +PA +          P +    L +    G                   DI N+ P  +   +N +                 L SL     H    + + G  LL ++   L  KRFH+ +R+ KG  A+
Sbjct:  581 SDRIAVLEHGKLRCCGSPQYLKEIYGQGLTLTLTKKVRVLCLSQSVTLGSRPPFDPERVVSLVRSGVAGAALKSGEDSSGNRNADMVFLLPAHSQNVLGQS-FLVTLEENMEELGLSGYAISDTTLEEVCLRQQRVMSEPA-LGCSASARYFTPTSAASLLTKATQCGPGLYSCSQLVQEAEDQRLKDITNKSPEAESGSINSETAAPPDHTSPAASSILCLSSLWRTEKHLVKKERVTGIHLLVRKTQALIYKRFHHWRRDVKGAAAQ 847          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002495.1 (pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene:ENSPMAG00000002218.1 transcript:ENSPMAT00000002495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.407 bits (446), Expect = 1.199e-45
Identity = 150/578 (25.95%), Postives = 265/578 (45.85%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK---------------------NFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAV-----------YGDIENQEPFL-DLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMN-PSIYRSTHYRCFPEYKNNKWSPI-------PNGNIPLISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNF-----------------SRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQ 1549
             DRIAIIS G+L+CCGSS+FLK  FG GY L +VK                      F + + N     +N    + + ++ H+PDA++      + +++LP + +    F+ LF  LDE++  L   SYG+SDT+LEE+F++VA++PA  +  T   KL   N     +           Y   +     L +LE LN+   +D         +  + + G  L+  Q   L IKRFH+A+R++KG  A++ILP + + L +    ++ P    P +++ PW+   +   ++ +     EN    S+ + L NK                     G RCMN  SI  +       E+     SP         N ++   SPEC C+  G ++    C +  +GGPP   R+  ++D L +L+G NISDYL+K + +  RK      ++    +   S          G +   + + P++++ +      +  F+  +K ++                   ++W N+KG+ ++ A+ N+ +N +LRS +    +  +YGI+  N+P+  ++ ++S+
Sbjct:  561 GDRIAIISHGRLRCCGSSLFLKNAFGAGYYLTMVKRSGSGGSNSSCLAGLASSSDEGFGSDESNPDSIAANHVSSVTRLLQQHVPDARLIENFGQELTYLLPSHGAKDGTFALLFKELDEKLAELGVSSYGVSDTTLEEIFLKVAEEPAANSHFTNGVKLSARNSKYTYLQPVHAGCICKNYSTCKKAPAELGELEKLNE---LD--------GKGTQQISGVQLILLQFKALFIKRFHHARRSRKGFVAQIILPAVFVCLALVFSLIIPPFGKYPMLQLQPWMYGEQYTFLSNDA---PENVKTNSLYDALLNKPGF------------------GTRCMNGESIPDAACVETKSEWVQPPMSPAMARTMQSRNWSMEDPSPECRCSGEGRRVILPDCPE-GAGGPPPMQRVQNTTDTLEDLSGRNISDYLVKTYPQAIRKSLKHKYWVNEIRYGGLSV---------GKKKLSHSASPKDMDIV--FTNVKRVFHIENKAVDVLYSGVKDMVSFLGPKETIKVWFNNKGWHAIVAFMNMANNAVLRSSLPAGTDPSDYGITAYNHPLNLTKEQLSE 1094          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006855.1 (pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene:ENSPMAG00000006189.1 transcript:ENSPMAT00000006855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 1.873e-9
Identity = 26/32 (81.25%), Postives = 28/32 (87.50%), Query Frame = 2
Query: 2459 REVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            R +AV+ LC GVR GECFGLLGVNGAGKTTTF
Sbjct:    1 RILAVDRLCVGVRPGECFGLLGVNGAGKTTTF 32          

HSP 2 Score: 48.9062 bits (115), Expect = 2.412e-6
Identity = 33/125 (26.40%), Postives = 59/125 (47.20%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLE---EVFIRVA 373
            R+AI+  G  +C GS   LK +FGDGY + +           R   +    ++L+F     PDA ++    T+  +   Q  S +   + +F  +++ +D L    Y +S T+L+   +VF+  A
Sbjct:  192 RLAIMVNGHFKCLGSIQHLKNRFGDGYMITI-----------RTRSTLHVKEVLRFFSRSFPDAVLKERHHTKVQY---QLKSETLSLAAVFTKMEQVLDVLGVEDYSVSQTTLDNDPQVFVNFA 302          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006988.1 (pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-1 gene:ENSPMAG00000006318.1 transcript:ENSPMAT00000006988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 1.178e-6
Identity = 21/36 (58.33%), Postives = 29/36 (80.56%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN 109
            +D  A++SQG+L+C GSS+FLK KFG GYRL L+ +
Sbjct:  649 ADWKAVLSQGRLKCAGSSLFLKTKFGVGYRLTLITD 684          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010397.1 (pep scaffold:Pmarinus_7.0:GL480213:155963:163950:1 gene:ENSPMAG00000009413.1 transcript:ENSPMAT00000010397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 3.255e-6
Identity = 21/30 (70.00%), Postives = 24/30 (80.00%), Query Frame = 2
Query: 2465 VAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            VAV+ +  G+  GECFGLLG NGAGKTTTF
Sbjct:    4 VAVDGISVGIPAGECFGLLGFNGAGKTTTF 33          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO46878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNL9])

HSP 1 Score: 385.185 bits (988), Expect = 1.831e-115
Identity = 295/891 (33.11%), Postives = 453/891 (50.84%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----NFNAQKENFRKGISNS------------GD---------KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLI-SLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDK--LNNLTGYNISDYLLKNFQRLSRKIF-GGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKL-SQNSWNYGISVTNYPI------ADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYN--SNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSD-QKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIISQGKLQCCG+S+FLK  +G+GY L L K       ++   + R  + +             GD          +  FIKSHIP A +     T+ ++VLP + +   KF  +F  LD  +  L+  SYG+SDT+LEEVF++VA++    +EE      +P   +         +  P   L+   Q    + S+  SL F+       G  LL +Q   L +KRFH+ +RN+K   A++ILP + + L + + + + P    PA+E++P            + F ++E   N+ +     N +   PL   L   +    G  G  CM+ +  R       P       SP+P       SP+CDC +    +C     G PP ++   TS D   +  ++G NISDYLLK + +  +K +    + ++  ++   S     +     +R+S + +  + + P                     +IW N+KGY ++PA+ N LSN +LR++ K    +   YGI+  N+P+       D ET + +      ++V +AI V+ ALSF+ ASFV+FL+ ER+S +K    VSG+ PY+YW++N++WD+  Y IP ++ + IF+AF  +SY  + N      LL+ YG +I P MYP S F S  STA++VL + NL VG   T++TFIL++ E + E L +IN +LK VFL+FP + LGRG++DL  N F    S   V    +   WDI G  +F++      ++ + ++IE     ++   K+    LK +E    ED DV  ER+R++S    + D LR++NLTK+Y                     + R VAV+ LC GV +GECFGLLGVNGAGKTTTF
Sbjct:  569 GDRIAIISQGKLQCCGTSLFLKSHYGNGYYLTLTKKTPGLGLDSVDASERDSLGSRSSDSDPISDSVLGDYSDVYCNEKSVTSFIKSHIPSASLVEHVGTELTYVLPSHAAKEGKFQDMFEELDRNLHKLHVGSYGVSDTTLEEVFLKVAEEAQ--SEEAGTSAEVPVRRSTFTF-----SSHPVKCLQPPAQGDSKNDSVDGSLEFDDRES---GLALLLRQFFALLVKRFHHCRRNRKAFIAQIILPAVFVCLAMIVAQ-IRPFYEKPALELTP------------HMFVKEEPYENYVL---YANDDPGEPLARNLSDAFLQYPG-LGTWCMSNNCSRK------PIAFQPSLSPVPTP-----SPDCDC-SEAMNVCPAGAGGPPPPTW---TSYDGNIIQKMSGRNISDYLLKTYMKFVKKRYINKIEIMIVREYGGLSFGDNYNNLPANVRNSSDPAIRRLISPRNV------------------KIWYNNKGYHALPAFLNTLSNTVLRAKAKARGLDPSQYGITAYNHPMNYTKEQLDDETFVKR-----AVDVLVAICVVFALSFVPASFVVFLVSERVSKAKHLHLVSGVKPYIYWLANYVWDMCNYFIPAMLCVFIFLAFGDESYTTAMNFPPTFCLLLLYGWSITPLMYPASHFFSVSSTAYIVLISINLFVGINCTLATFILELFEDDKE-LTDINTVLKSVFLVFPNYCLGRGLIDLAKNQFLGIFSRFGVNLTRDPFSWDITGRNIFAMIIEGFVFFTLTVLIEYRFFIKLRPVKV---VLKPVE---EEDDDVQRERQRVNSGLGHATDALRLMNLTKVYR------------------SRRKRIVAVDRLCVGVPKGECFGLLGVNGAGKTTTF 1369          

HSP 2 Score: 55.8398 bits (133), Expect = 7.676e-8
Identity = 38/126 (30.16%), Postives = 61/126 (48.41%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLIL-VKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            +R+AI+  G+++C GS   LK KFGDGY +IL V   N   E           ++ QFI    P+A ++ +      + +P         S LF +L+      +   Y ++ T+L++VFI  A D
Sbjct: 1525 NRVAIMVNGQMKCLGSPQHLKNKFGDGYTVILRVAGSNPDTE-----------QVCQFIIQCFPNAVLKDKHHNMVEYQIP---CQGLSVSRLFGHLEANRKMFDIEDYSVTQTTLDQVFINFAKD 1636          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO38879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBQ0])

HSP 1 Score: 362.459 bits (929), Expect = 3.650e-107
Identity = 288/940 (30.64%), Postives = 448/940 (47.66%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKE----NFRKGISN-------SGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINE-----ETKNEKLI----------PDNLNRI-------------------AVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRN---------HKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESL------PAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSIN-PLTDRLESEYRSDLGESGIRCMNPSIYRST-------------HYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTG-YQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQ-NSWNYGISVTNYPIADSETKISQFNNLILLEVT---LAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNAL----QWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIR------NTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL+C GS ++LKR+FG+GY L LVK   +       +FR+  S+       S +KL  FI SHI  A+++ +T  +++F+LP N      F  LF +L++ ID L   SYG++ T LEEVF++V D    +NE       + +KL           P +L  +                    V    E+ E  L  + L+       +L +   N +            L G  L  QQ   L +KRFHYA+RN KG+ ++++LP L I + + +   + P   L      P+M   P  +   + +  +N   ++  Q   ++++ +G    +  P  D L S  +  L +S +  M     R               H   +  Y N+  +   +       P C C+  G + +C+   +G  P     +T  D L N+TG N+S+YLL   Q      +G   F                        +V Q  P  L+ +      +    ++SK+      W N+KGY ++P Y N+++N +LR+ I  S+ N   YGI+  N+P   + T     +   L + T   +AI+VI+A+SF+ ASFV+FL+ ER + +K  QFVSG++P VYW+SN+LWD+  Y+IP +  I +   F   +Y    N  A + L + YG +I P MYP +F  S  S+A+V +   NL VG   T++TFIL +   + E L ++ND++K + L FP + LGRG+MDL +N + +       E +++    +W I    L  +      ++I+ I+IE               +LKR  I        TED DV  ER+R+      DD++++ NLTKIY                 Y + + + +AV+ LC GV +GECFGLLGVNGAGKT+TF
Sbjct:  801 GDRIAIISSGKLRCVGSPLYLKRRFGEGYNLTLVKKSISSPHGSIGSFRRSTSSNLEASRRSEEKLTSFITSHISSAQLKHKTNQEFTFILPDNSIKRGAFKKLFADLEQNIDVLGIDSYGITHTLLEEVFLKVTD--VSLNETGNMPHHRQDKLPTQLLQFPADKPGHLGHVLLSPPLPTLPTNEGLEMSDVVRNRGEDTERLLGYQPLSDSGTHQGNLYNEASNGHAAGLFEGVGSHTLTGSALQWQQFYALMLKRFHYARRNFKGVISQILLPALFICIAMTMALSLPPKPDLPPLELSPSMFYQPNYIPFGNEAKGMNILAKRLEQ-TLTLSSGIGATCCLRYPQYDLLNSTVK--LTKSQVALMFDKSCRKAIDEVSGVYLKPNKHRFSYIYYTNSSMNVSESVTHQKAGPGCRCSANGTWYLCDQGAAGKQPKELVTITR-DTLQNVTGRNMSEYLLYTTQTFRMHRYGALSF-----------------------GNVVQFVPSRLDSVHIDAVRRLAIREASKS------WYNNKGYHALPTYLNVMNNAILRASIPKSKGNPAAYGITAYNHPFPFNSTSAVHLSADYLRQGTDLVIAIFVIIAMSFVPASFVVFLVTERSTKAKHLQFVSGVDPVVYWLSNYLWDMCNYLIPALACITLLYLFGVPAYASETNFPAVVGLFMLYGWSITPMMYPSAFCFSEASSAYVAMIVLNLFVGVTATVTTFILQLFPDD-EVLTDVNDVIKLISLGFPNYCLGRGLMDLAYNQYLSEYYRQIGEEDSIKSPFEWMIVSRNLVCMLMEGFAFFILTILIEFKF------------FLKRRRIPVSQLPIETEDEDVAAERDRVLRGDADDDLVKIENLTKIY-----------------YSRKRGKHLAVDRLCVGVPQGECFGLLGVNGAGKTSTF 1675          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO48951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI12])

HSP 1 Score: 150.599 bits (379), Expect = 4.014e-37
Identity = 123/410 (30.00%), Postives = 215/410 (52.44%), Query Frame = 2
Query: 1397 NSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIAD-SETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSF-----FISTPSTAFVV-LNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNS------------NSIVKHEYNALQWDIAGEKLFSLFSL--SIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSS---DQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            N+ GY  + +  N LSN+LL    +LS +S   GI  TN+P+ + ++ K     + I + + LAI++ + ++F++ASF+ FL+ ER S +K  QFVSG++ + YW + + WD + Y++P ++I+I+F AF  + +    +  +  LLLI +GL ++P +Y  SF      I+   T FV+ + ++ +L      ++ F+  I  +N   L +  +I+  VF++ P + +   ++D+  NY Y              ++ ++   ++L WD  G    +L+    ++  +I+ ++I+     R+I           I    ++D DV  ER R+ S   +Q   + + V +LTK+Y+            G D          AV++LC G+  GECFGLLGVNGAGKTTTF
Sbjct: 1092 NASGYHIIASSINALSNILLA---ELSGDS-EQGIETTNHPLPNNAQNKADNVTSTISV-LFLAIFMSMGMAFMAASFITFLVQERTSKAKHLQFVSGVDAFSYWSATYTWDFLNYLVPCLLILILFAAFQIEEF--ENDMGSVFLLLILFGLVVLPFIYVMSFAFKSQLIAYAMTVFVLSIMSFGML------LAVFLCRIPSLN---LLDEAEIMHYVFMLLPTYTVSYALIDMSTNYGYRKICSTLQTVESCRDNGIQFTDSSLNWDRPGVGQHALYMAVEAVVLFILTLLIQVRRPYRLI----------PICPWTSQDCDVAGERARVHSLNPEQIKKESVIVKDLTKVYH------------GSD--------RTAVDHLCIGIPRGECFGLLGVNGAGKTTTF 1455          

HSP 2 Score: 95.1301 bits (235), Expect = 7.437e-20
Identity = 68/221 (30.77%), Postives = 108/221 (48.87%), Query Frame = 2
Query:    5 DRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNR----NHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAE 655
            DRIAI++ G+L+CCGSS+FLK ++G GY L LVK  +              + ++  ++  +P A++ +    +  FVL  N   S  F  LFV L+   ++    SYG+S T++EEVF++V +          +EK + D LN              L L  L+ Q+ +    I +   R    N+ L  GF L  Q    + +KRF  +KR+KK +  +
Sbjct:  700 DRIAIMADGQLRCCGSSLFLKSRYGVGYHLTLVKKEDCDD-----------NAIINAVRETVPSAQVLSNVGAEIEFVL--NGEASKDFESLFVKLENNKEDYGIASYGVSCTTMEEVFMKVGEG---------SEKTVEDILN--------------LLLRILSSQSLLRYQNIKIKILRLLKSNYPLQTGFALQWQHYKAMLVKRFINSKRDKKSVVTQ 884          

HSP 3 Score: 56.9954 bits (136), Expect = 3.800e-8
Identity = 39/124 (31.45%), Postives = 65/124 (52.42%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G+ +C GS+  LK +FG GY L+L      + E     +SN+     QF+ S  P A++        ++   Q +S    +S +F  L+    +LN + Y +S TSLE+VF+ +A +
Sbjct: 1612 RLAIMVNGQFKCVGSAQHLKSRFGMGYTLML------KVEARLVPVSNTE----QFVSSTFPGAQLLESHNGMLTY---QINSTELSWSRIFGELERNRASLNIVDYSVSQTSLEQVFLNLAKE 1722          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO32071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW57])

HSP 1 Score: 55.8398 bits (133), Expect = 2.842e-8
Identity = 37/124 (29.84%), Postives = 63/124 (50.81%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRL--ILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVA 373
            R+ I+ +G+L+C GS+  LK KFG GY L   L  +F +   +      +   +L+ F++   P+AK       +  + +P+  SN  K S  F  L+E   ++    Y  S ++LE+VF+  A
Sbjct:  184 RVGIMVKGQLKCLGSTQHLKSKFGSGYTLEIKLSPSFQSSDPDV-----DMQTQLVAFVEGLFPNAKRTESFGDRVIYKVPK--SNVSKLSSTFATLEEGKRSIGIEEYSFSQSTLEQVFLEFA 300          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO28092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7F9])

HSP 1 Score: 53.5286 bits (127), Expect = 4.649e-8
Identity = 37/117 (31.62%), Postives = 62/117 (52.99%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEV 358
            R+AI+  G+ +C GS+  LK +FG GY L+L      + E     +SN+ ++  QF+ S  P A++        ++   Q +S    +S +F  L+    +LN + Y +S TSLE+V
Sbjct:   76 RLAIMVNGQFKCVGSAQHLKSRFGMGYTLML------KVEARLVPVSNT-EQAQQFVSSTFPGAQLLESHNGMLTY---QINSTELSWSRIFGELERNRASLNIVDYSVSQTSLEQV 182          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: ENSORLT00000046301.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 399.438 bits (1025), Expect = 1.873e-119
Identity = 297/920 (32.28%), Postives = 462/920 (50.22%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN----FNAQKENFRKGI---------------------------SNSGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINE-ETKNEKLIPD-----------NLNRIAVYGDIENQEPFLD------LEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMN----PSIYRSTHYRCF--PEYKNNKWSPIPNGNIPL--ISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQ--EFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKIS-QFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYN---SNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GK++CCGSS+FLK+ FG GY L LV++      AQ+     GI                           SN  D   + QF++ H+P+A        + +F+LP   +    F+ LF  LD+ +D L   SYG+SDT+LEE+F++VA+D     E     E ++ D           +++R        N +  L       +ED  + A V+         R   ++ G+ L++QQ + L IKRFH+A+R++KG+ A+++LP + + L +    +V      P++E+ PW+   ++      TFY          +N +    +++ + + L      D    G RCM     P +  S+    +  P    +      NGN  +   SP C C+T G  I    C     G P    R+  ++D L NLT  N++D+LLK ++   +K +GG      N    S  L+ +    +            NLEP  +    Q  E   K   T N  ++W  +KG+ SM ++ ++++N +LR  +   QN   YG+SV+N+P+  S+ ++S         +V ++I VI A+SFI ASFV+FLI ER+S +K  QFVSG+NP VYWV++F+WDI  Y+IP  +++ IFI F  ++Y+  +N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF++++ E   E + +IN+I+K+V LIFP F LGRG+MD+  N       SN       + L W++ G+ L ++       +   ++I+     +          L +++    ED DV  ER+R+   + ++DVLR+ +LTK+Y                     +    AV  LC GV   ECFGLLG+NGAGKTTTF
Sbjct:  753 GDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNTKDELKKKLSNKVEDFKKSASVN--------GRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQT------TFY----------SNDMPEDANVSRVVETL-----VDNPGFGTRCMEGNPIPRLPCSSGASDWFSPSVDQSVADIFLNGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGLP-PPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGISVGGIN----SQVLLTEVEIEEAF---------ANLEPPGYGDTIQKAEMVLKKLGTRNNVKVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQNLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLIQYKFFYK------PRLSLPKVQSEEKEDVDVARERQRVHEGRANNDVLRICDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTF 1601          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: ENSORLT00000045391.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 399.438 bits (1025), Expect = 2.004e-119
Identity = 297/920 (32.28%), Postives = 462/920 (50.22%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKN----FNAQKENFRKGI---------------------------SNSGD--KLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINE-ETKNEKLIPD-----------NLNRIAVYGDIENQEPFLD------LEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMN----PSIYRSTHYRCF--PEYKNNKWSPIPNGNIPL--ISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQ--EFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKIS-QFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYN---SNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GK++CCGSS+FLK+ FG GY L LV++      AQ+     GI                           SN  D   + QF++ H+P+A        + +F+LP   +    F+ LF  LD+ +D L   SYG+SDT+LEE+F++VA+D     E     E ++ D           +++R        N +  L       +ED  + A V+         R   ++ G+ L++QQ + L IKRFH+A+R++KG+ A+++LP + + L +    +V      P++E+ PW+   ++      TFY          +N +    +++ + + L      D    G RCM     P +  S+    +  P    +      NGN  +   SP C C+T G  I    C     G P    R+  ++D L NLT  N++D+LLK ++   +K +GG      N    S  L+ +    +            NLEP  +    Q  E   K   T N  ++W  +KG+ SM ++ ++++N +LR  +   QN   YG+SV+N+P+  S+ ++S         +V ++I VI A+SFI ASFV+FLI ER+S +K  QFVSG+NP VYWV++F+WDI  Y+IP  +++ IFI F  ++Y+  +N  A ILLL+ YG AI P MYP SF  + PSTA+VVL   NL +G   +++TF++++ E   E + +IN+I+K+V LIFP F LGRG+MD+  N       SN       + L W++ G+ L ++       +   ++I+     +          L +++    ED DV  ER+R+   + ++DVLR+ +LTK+Y                     +    AV  LC GV   ECFGLLG+NGAGKTTTF
Sbjct:  753 GDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNTKDELKKKLSNKVEDFKKSASVN--------GRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQT------TFY----------SNDMPEDANVSRVVETL-----VDNPGFGTRCMEGNPIPRLPCSSGASDWFSPSVDQSVADIFLNGNWSMSNPSPSCQCSTPGRTIIMPDCPPGAGGLP-PPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGISVGGIN----SQVLLTEVEIEEAF---------ANLEPPGYGDTIQKAEMVLKKLGTRNNVKVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQNLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLIQYKFFYK------PRLSLPKVQSEEKEDVDVARERQRVHEGRANNDVLRICDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTF 1601          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: ENSORLT00000025407.2 (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163308])

HSP 1 Score: 385.571 bits (989), Expect = 2.184e-114
Identity = 298/945 (31.53%), Postives = 477/945 (50.48%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-----------------NFNAQ-KENFRKGISNSG----------------------------DKLL--QFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFL-----DLEDLNQQA----FVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNP-SIYRST--------HYRCFPEYKNNKWSPIPNGNIPL--ISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQR-----LSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKN-SYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS++LK + G GY L LVK                 +FN + +EN     S++G                            D  L    I  H+P A++  +   + +++LP + + +  F  LF +LD ++  L   SYG+SDT+LEE+F++VA+D     E   +  L      R   +G  E+Q         D  D N         +   +S    +    + G+ L +QQ + L  KRF YA+R++KG FA+++LP + + + +    +V P    P++E+ PW+                E+Q+ F   +  G+ N    L   +E          G RCM+  SI  S         H    PE     +S   +GN  +   SP C C + G +     C     G PP   + ++++D L NLTG NISDYL+K + +     L+ K+      +GG+        A+S++++   P  + I D++ + +      +     RFL     F N    T N  ++W N+KG+ S+PA+ N+++N +LR+ +    +  NYGI   N+P+  ++ ++SQ   +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P +YW +NFLWD+  Y +P  ++I+IF+ F  ++Y+ S N     LLL+ YG +I P MYP SFF + PSTA+VVL + N+L+G   +ISTF++++   ++E +  INDILK V LIFP F LGRG++D+  N    ++++ +   N     L+WD+ G+ LF++    + ++I+ ++I+        C K +  S L ++     ED DV  ER+R+       D+L +  LTK++                     + ++ AV+ LC G+  GECFGLLGVNGAGKTTTF
Sbjct: 1104 GDRIAIISHGKLCCVGSSLYLKNQLGSGYYLTLVKKDPETSLSSCRNSSSTISFNKKDEENTSVSSSDAGLGSEHESEAATIENGPAASICTVPFVPTDTSLVSALILRHVPTARLVEDLGHELTYILPYSAAKNGAFVELFKDLDLKLHELGISSYGVSDTTLEEIFLKVAEDNGVDTEVLSDGTLPVRARRRTHAFGGGEHQSCLKPISEDDTYDCNDSEGDPDCRETDWLSCTEGKGSYQVNGWSLRRQQFVALMWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMY---------------EDQVTFISDDAPGDANMQKLLKSLMEPP------GFGTRCMDGYSIPESPCTMGDEDWHNPDVPESLQQLFS---SGNWTMENPSPSCFCASDGKKRMLPDCPVGAGGLPPPEMK-LSATDTLQNLTGRNISDYLVKTYAQIIGKSLNNKVWVNEFRYGGFSL-----GARSTQVL---PPANEIDDAIERVRNIFELQKGAAADRFLDSLSNFIN-GLDTKNNVKVWFNNKGWHSVPAFMNVMNNAILRANLPPGADPSNYGIMSFNHPLNLTKEQLSQVALVTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPLLYWTANFLWDMCNYFVPAALVILIFVCFQQKAYVSSANLPVLALLLLLYGWSITPLMYPASFFFTIPSTAYVVLTSVNILIGINGSISTFVMELFG-DHE-IGGINDILKNVLLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITLLIQYK-----FCIKPRPISKLTKMGSLGEEDEDVARERQRIVQGLGQGDILELRQLTKVF--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTF 1986          

HSP 2 Score: 51.2174 bits (121), Expect = 5.126e-6
Identity = 34/124 (27.42%), Postives = 60/124 (48.39%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G+ +C GS   LK +FGDGY +IL             G       +++FI+S +  + ++ +      + LP   S+    + +F  L +  D L    Y ++ T+L++VF+  A D
Sbjct: 2143 RMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRV----------AGPDPDLLPVMKFIESELSGSTLKEKHRNMLQYQLP---SSLTSLAHIFSILAKNKDTLRIEDYSVTQTTLDQVFVNFAKD 2253          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: abca1a (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163147])

HSP 1 Score: 379.407 bits (973), Expect = 2.521e-112
Identity = 290/921 (31.49%), Postives = 472/921 (51.25%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-NFNAQKENFR------------------------KGISNSGDK---------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-DLN-QQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCM------NPSIYRSTHYRCFPEYKNNKWSPIPNGNIPL--ISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQR-----LSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK   G GY L +VK +++   ++ R                         G+ +  D          +   I  H+ +A++  +   + ++VLP   +    F  LF  LD+ + +L   SYG+SDT+LEE+F++VA+D + ++    ++ ++P    R   +GD ++  +PF + E D N  +   +   +     +    ++G+ L +QQ + L  KRF YA+R++KG FA+++LP + + + +    +V P    P++ + P             + Y +  Q +F I+N + +    +P T++L        G  G RCM      N            PE   +       GN      SP C C+  G +     C D   G PP   RI +  D L NLTG N+SDYL+K + +     L  KI      +GG+        A+SS+ ++     D I  ++ Q +      +     RF      F  +   + N  +IW N+KG+ S+ ++ N+++N +LR+ +   ++   +GI+  N+P+  ++ ++SQ   +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P++YW++NF+WD+  YI+P  ++IIIF+ F   +Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   ++STF+L++   N   +  INDILK VFLIFP F LGRG++D+  N    ++++ +   N     L WD+ G+ LF++    + ++ + ++I+       I  +   S+LK I     ED DV  ER+R+ S     D+L +  LTKIY                     + ++ AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1102 GDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTMVKRDYDLALQSCRNSASTVSYSKKTEKEDSISESSSDAGLGSEPDSETTTIDVSLISNVIFKHVREARLVEDLGHELTYVLPYQSAKDGAFVELFHELDDRLTDLGISSYGISDTTLEEIFLKVAED-SGVDAVELSDGVVPTRTRRRHAFGDHQSCLKPFTEDEFDFNDSEESRETDWLGGADGKGSFQVKGWSLKRQQFVALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALHP-------------SMYGE--QFSF-ISNDMPD----DPHTNKLLGALMEKPG-FGSRCMKGEPIPNTPCTAVEDEWAVPEVSESLRDIFAKGNWTRENPSPLCQCSCEGRKRMLPECPDGAGGLPPPQMRI-SDKDTLQNLTGRNVSDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSL-----GARSSQFLSHK---DDIDVAIAQLRRRFHLERGTAADRFFHSLSSFI-QGLDSKNNVKIWFNNKGWHSISSFLNVMNNGILRASLPAGKDPTKFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSN--EIGGINDILKNVFLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFCITVLIQYRFC---ITTRSSISHLKPI---GEEDEDVARERQRVLSGSGQSDILELRELTKIY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTF 1961          

HSP 2 Score: 51.9878 bits (123), Expect = 3.161e-6
Identity = 34/124 (27.42%), Postives = 60/124 (48.39%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G+ +C GS   LK +FGDGY +IL         + R         ++ FI+  +P + ++ +      + LP   S+    + +F  L +  + L    Y +S T+L++VF+  A D
Sbjct: 2118 RMAIMVNGRFRCLGSVQHLKNRFGDGYTIIL--RVAGPDPDLR--------PVMGFIERELPGSTLKEKHRNMLQYQLP---SSLTSLARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKD 2228          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: abca1a (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163147])

HSP 1 Score: 378.252 bits (970), Expect = 7.277e-112
Identity = 291/924 (31.49%), Postives = 472/924 (51.08%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVK-NFNAQKENFR------------------------KGISNSGDK---------LLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIEN-QEPFLDLE-DLNQQAFVDKS----LISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCM------NPSIYRSTHYRCFPEYKNNKWSPIPNGNIPL--ISPECDCNTTGYQI----CNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQR-----LSRKI------FGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQ-----PQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLIL-LEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYN----ALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
             DRIAIIS GKL C GSS+FLK   G GY L +VK +++   ++ R                         G+ +  D          +   I  H+ +A++  +   + ++VLP   +    F  LF  LD+ + +L   SYG+SDT+LEE+F++VA+D + ++    ++ ++P    R   +GD ++  +PF + E D N      +S     +     +    ++G+ L +QQ + L  KRF YA+R++KG FA+++LP + + + +    +V P    P++ + P             + Y +  Q +F I+N + +    +P T++L        G  G RCM      N            PE   +       GN      SP C C+  G +     C D   G PP   RI +  D L NLTG N+SDYL+K + +     L  KI      +GG+        A+SS+ ++     D I  ++ Q +      +     RF      F  +   + N  +IW N+KG+ S+ ++ N+++N +LR+ +   ++   +GI+  N+P+  ++ ++SQ   +   ++V ++I VI A+SF+ ASFV+FLI ER++ +K  QF+SG+ P++YW++NF+WD+  YI+P  ++IIIF+ F   +Y+ S N     LLL+ YG +I P MYP SFF   PSTA+VVL + N+L+G   ++STF+L++   N   +  INDILK VFLIFP F LGRG++D+  N    ++++ +   N     L WD+ G+ LF++    + ++ + ++I+       I  +   S+LK I     ED DV  ER+R+ S     D+L +  LTKIY                     + ++ AV+ LC G+  GECFGLLGVNGAGKT+TF
Sbjct: 1102 GDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTMVKRDYDLALQSCRNSASTVSYSKKTEKEDSISESSSDAGLGSEPDSETTTIDVSLISNVIFKHVREARLVEDLGHELTYVLPYQSAKDGAFVELFHELDDRLTDLGISSYGISDTTLEEIFLKVAED-SGVDAVELSDGVVPTRTRRRHAFGDHQSCLKPFTEDEFDFNDSEGDPESRETDWLGGADGKGSFQVKGWSLKRQQFVALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALHP-------------SMYGE--QFSF-ISNDMPD----DPHTNKLLGALMEKPG-FGSRCMKGEPIPNTPCTAVEDEWAVPEVSESLRDIFAKGNWTRENPSPLCQCSCEGRKRMLPECPDGAGGLPPPQMRI-SDKDTLQNLTGRNVSDYLVKTYAQIIGKSLKNKIWVNEFRYGGFSL-----GARSSQFLSHK---DDIDVAIAQLRRRFHLERGTAADRFFHSLSSFI-QGLDSKNNVKIWFNNKGWHSISSFLNVMNNGILRASLPAGKDPTKFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSN--EIGGINDILKNVFLIFPHFCLGRGLIDMVKNQAM-ADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFCITVLIQYRFC---ITTRSSISHLKPI---GEEDEDVARERQRVLSGSGQSDILELRELTKIY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTF 1964          

HSP 2 Score: 51.9878 bits (123), Expect = 3.135e-6
Identity = 34/124 (27.42%), Postives = 60/124 (48.39%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADD 379
            R+AI+  G+ +C GS   LK +FGDGY +IL         + R         ++ FI+  +P + ++ +      + LP   S+    + +F  L +  + L    Y +S T+L++VF+  A D
Sbjct: 2121 RMAIMVNGRFRCLGSVQHLKNRFGDGYTIIL--RVAGPDPDLR--------PVMGFIERELPGSTLKEKHRNMLQYQLP---SSLTSLARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKD 2231          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000029534.1 (SMESG000029534.1)

HSP 1 Score: 1509.97 bits (3908), Expect = 0.000e+0
Identity = 776/857 (90.55%), Postives = 805/857 (93.93%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQP----QNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSW-NYGISVTNYPI-ADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAELILPILMITLMIALLKLVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNF++LSRK++GG+QF+LP+ F  SSKLI  SP W+ +RD VN SQ      NL  L+F+ Y Q+ F       +F+RIW+NSKGY SMPAYANI SNLLLRSR+  S   + +YGISV+N+PI  +  TK       ++LE++LAI+VI  LSFI ASFVIFL++ER+SGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYI SKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLN YNLLVGTITTISTFILDILE NYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF
Sbjct:  947 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAELILPILMITLMIALLKLVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFRKLSRKLYGGFQFVLPSTFGWSSKLIGDSPFWEELRDFVNASQANHNQSNLNSLKFIDYLQKTFKIYGIKTSFTRIWVNSKGYVSMPAYANIFSNLLLRSRLNKSAVKFIDYGISVSNFPIEMEQSTKFLDLVIQMILEMSLAIFVIFGLSFIPASFVIFLVEERVSGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNVYNLLVGTITTISTFILDILEGNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 1803          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000029537.1 (SMESG000029537.1)

HSP 1 Score: 1070.46 bits (2767), Expect = 0.000e+0
Identity = 593/854 (69.44%), Postives = 685/854 (80.21%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPA-KINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLE-DLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXX-XXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            SDR+AIISQGKLQCCGS VFLKRKFG+GY L L+KN N    + R     +G+ +L+F+K +I DA+M  E+  QW+ VLPQND NS KF+ LF NLD+ +  ++ +SYGLSDTSLEEVF++VADDP  K+  + K+      N+ ++ +  +    E FL+   D  Q  F+D+S           LL+GFPLL+QQII L IKR+HYAKR+ KG  AELIL  ++++ +++ L   + P + +P M+ISPWLMM K    NLNTFYRKEN         LG       L ++LESEYRSDLGESGIRCMNPSIYR  +Y+CF   +NN WSP    +IP++SPECDC+ TG QICND RSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYI SKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVG+ITT+STFILDI+E   E  +  N+ILKKVFLIFPQ++LGRG++DL  NY   + +    +Y+A  W++A EKL SL  L + WWI+LIIIE G++NR++   LK SY    +I+ TEDFD++LE+ RM+S+QK DDVL+VINLTKIYN    F+  C  K K+N ++N+ ++ AVNNLCFGVREGECFGLLGVNGAGKTTTF
Sbjct:  899 SDRVAIISQGKLQCCGSLVFLKRKFGEGYYLSLLKNQNNHSNSNR-----NGENILKFVKIYIADARMMEESRLQWTIVLPQNDINSRKFTELFKNLDQHMAEMSIISYGLSDTSLEEVFLKVADDPMNKLINKEKSYYSYYCNILKMKLRINATKTEIFLNQNPDQKQSKFLDQS---------DHLLKGFPLLQQQIIALHIKRYHYAKRDFKGFLAELILPVLMILFIILFLKISILPKKQIP-MQISPWLMMSKMGKENLNTFYRKENI-------SLG-------LINKLESEYRSDLGESGIRCMNPSIYRLDNYQCFYRNENNMWSPASILDIPMVSPECDCSKTGNQICNDLRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYIGSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGSITTMSTFILDIIEDTDETFRPTNEILKKVFLIFPQYDLGRGMIDLSSNYIKYNMTDGYAKYDAFDWEVASEKLASLILLFLLWWIILIIIERGVINRVLYRMLKVSYFNN-KIKKTEDFDISLEKNRMNSEQKFDDVLQVINLTKIYNRTFNFRSVCC-KNKNNDVENENQKFAVNNLCFGVREGECFGLLGVNGAGKTTTF 1721          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000032891.1 (SMESG000032891.1)

HSP 1 Score: 933.71 bits (2412), Expect = 0.000e+0
Identity = 511/855 (59.77%), Postives = 631/855 (73.80%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQ-QAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNL-EPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKI-SQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNT-EDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            SDRIAIISQGKLQCCGSSVFLK++FGDGY LILVKN  +Q+E+FR GIS+SG+K+L FI++HI DAKM  ET TQW+ VL QN+ N+ KFS LF ++D  +  LN +SYGLSDTSLEEVF++VADDPA   EE K++++  ++L+ +   G+       L   D  +   F D + I         LL G  LL QQ++GLQ+KRFHY KRN KG  AEL+LPIL+I +MIA  K+ + L   P MEISPWLMMPK+RS+NLNTFYRKEN              S N L D+L   YRSDL E+G RCMN S+YR   Y C      N+W+  P   IPL++  CDC  TGYQ+C++  SGGP NSYR+M S+DKLNNLTGYNISD+L+K F+   +K +GGYQFLLP+ F QS KLI   P WD IR   N S   +  + L FL YFQEFFN S    NF+RIWINSKGYAS+PAY NI SNLLLR+R +   N  NYGISV NYP+  +++ + S+ N  + +EV+LA++VI  LSFI ASFVIFLI+ERI+GSKRQQ VSG+NPYVYW+SNFLWDI+KYI+PI II++IF+AFDYQSYI SKN  AFI LLIFYGLAIIPHMYPFSF +STPSTAFVVL+AYNLLVG+ITTISTF LD+L+ + E LK +ND+LKKVFL+FPQ+ LGRG+MDL FNY   + S  K +Y+   W   GEKL SL  L +GWWIV++IIESGI+NR +CGK+KN  LK  EI++  ED DV +ERER+ S++ SDDVL+VI LTK+YN  L  K+ C +K   + ++N+ R++AVNNLCFGVREGECFGLLGVNGAGKTTTF
Sbjct:  873 SDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLSQNEINNGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITTEDLDSLTDDGNFPRPSSRLSFRDKREFPRFDDLNSIPYESGAPSSLLTGSALLCQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVIMIAFSKISSNLNYQPPMEISPWLMMPKARSLNLNTFYRKEN--------------SSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYPC-SSRTGNQWTGNPPEPIPLLTAACDCKKTGYQMCSNSSSGGPQNSYRLMASTDKLNNLTGYNISDHLIKKFKSYIKKQYGGYQFLLPSPFGQSCKLIGSLPIWDAIRSQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLLRTRFE--SNGSNYGISVANYPLKYTQSDLLSKLNTQMFIEVSLAVFVIFGLSFIPASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLVGSITTISTFFLDLLQKDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVLIIESGIINRTLCGKIKNRNLKAKEIKDEFEDVDVAVERERIISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDALENEKRKLAVNNLCFGVREGECFGLLGVNGAGKTTTF 1710          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000032861.1 (SMESG000032861.1)

HSP 1 Score: 930.243 bits (2403), Expect = 0.000e+0
Identity = 507/855 (59.30%), Postives = 634/855 (74.15%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQ-QAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNL-EPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKI-SQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNT-EDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            SDRIAIISQGKLQCCGSSVFLK++FGDGY LILVKN  +Q+E+FR GIS+SG+K+L FI++HI DAKM  ET TQW+ VLPQN+ NS KFS LF ++D  +  LN +SYGLSDTSLEEVF++VADDPA   EE K++++  ++L+ +   G+       L      +   F D + I         LL G  LL+QQ++GLQ+KRFHY KRN KG  AEL+LPIL+I +MIA  K+ + L   P MEISPWLMMPK+RS+NLNTFYRKEN              S N L D+L   YRSDL E+G RCMN S+YR   Y C      N+W+  P   IPL++  CDCNTTG+Q+C++  SGGP NSYR+M S+DKLNNLTGYNISD+L+K F+   +K +GG+QFLLP+ F QS KLI   P WD +R   N S   +  + L FL YFQEFFN S    NF+RIWINSKGYAS+PAY NI SNLL+R+R +   N  NYGISV NYP+  +++ + S+ N  + +EV+LA++VI  LSFI ASFVIFLI+ERI+GSKRQQ VSG+NPYVYW+SNFLWDI+KYI+PI II++IF+AFDYQSYI SKN  AFI LLIFYGLAIIPHMYPFSF +STPSTAFVVL+AYNLL+G+ITTISTF LD+L+ + E LK +ND+LKKVFL+FPQ+ LGRG+MDL FNY   + S  K +Y+   W   GEKL SL  L +GWWIV+ IIESGI+NR++CGK+KN  LK  E+++  ED DV +ERER+ S++ SDDVL+VI LTK+YN  L  K+ C +K   + ++N+ R++AVNNLCFGV+EGECFGLLGVNGAGKTTTF
Sbjct:  883 SDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINSGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITAEDLDSLTDDGNFPRPSSRLSFRCKREFPRFDDLNSIPYESGAPSSLLTGSALLRQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVVMIAFSKISSNLNYQPPMEISPWLMMPKARSLNLNTFYRKEN--------------SSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYPCSSSI-GNQWTGNPPEPIPLLTAACDCNTTGFQLCSNSSSGGPQNSYRLMASTDKLNNLTGYNISDHLIKKFKSYIKKQYGGFQFLLPSPFGQSCKLIGSLPIWDAMRSQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLMRTRFE--SNGSNYGISVANYPLKYTQSDLLSKLNTQMFVEVSLAVFVIFGLSFIPASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLLGSITTISTFFLDLLQQDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVFIIESGIINRMLCGKIKNRNLKAKEMKDEFEDVDVAVERERIISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDTLENEKRKLAVNNLCFGVQEGECFGLLGVNGAGKTTTF 1720          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000068605.1 (SMESG000068605.1)

HSP 1 Score: 918.302 bits (2372), Expect = 0.000e+0
Identity = 481/853 (56.39%), Postives = 624/853 (73.15%), Query Frame = 2
Query:    2 SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVYGDIENQEPFLDLEDLNQQAFVDK-SLISLNFNRNHKLLRGFPLLKQQIIGLQIKRFHYAKRNKKGIFAEXXXXXXXXXXXXXXXXXVNPLESLPAMEISPWLMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDLGESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTGYQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFGGYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEFFNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGISVTNYPIADSETKI-SQFNNLILLEVTLAIYVILALSFISASFVIFLIDERISGSKRQQFVSGINPYVYWVSNFLWDIMKYXXXXXXXXXXXXAFDYQSYICSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTITTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFYNSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICGKLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYLKFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTTF 2554
            SDRIAIISQGKLQCCGSSVFLK++FG+GY LI+VK  + Q E+F+  +S SG   L+FI++H+PDAKM  ET +QW+  LPQ+++N  KF  LF NLD  +++L  ++YGLSDTSLEEVF++VADDP+      K +KL P+ L+ +   G+       L L D ++ A +++   +S      + +L G  L  QQIIGLQIKRFHY +RN K   AEL+LP+LMI ++I LL + +PL   P M ISPWLMMPK+R +NLNTFYRKE+                N + D +E+ YRSD+GESG+RCMN ++YR  +Y C+PE   N+WS IP+  I L SPECDC+ TG+Q C+DP SGGP  S RIMTSSD+L N+TGYNISDYLLK F+   +K +GGYQFLLP++F  SS  I  SP WDGI   +N S   +   L FL Y Q FFN+S    N++RIW+NSKG+ SMPAY NI SN+LLRS++    +   YGISVTNYP+  S+T + SQ N  + LEV+LAI+VI  LSFI ASFVIFLI+ERISG+KRQQFVSG+NPY+YW+SNF+WD++KYIIP+ I+++IF+ F+YQSYI ++NA AFI+LL+FYGLAIIPHMYPFSF +S PSTAFV+L+AYNLLVG ITTI+TF LD+L+V+   LK  ND+LKK+FLIFPQ++LGRG+MDL FNY   + S  K  Y+   W+  G+KL SL  L I WW V+  IESGI+NR ICG++KN  LK  E+++ ED DV LERERM+  +++ DVL+VINLTKIYN  L   + C ++   + + ++ R++AVNN+CFGV+EGECFGLLGVNGAGKTTTF
Sbjct:  909 SDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIALPQSENNCSKFPDLFDNLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFIAELVLPVLMILMIIGLLNISSPLSDAPPMVISPWLMMPKTRLVNLNTFYRKES--------------PSNAIIDSMENVYRSDVGESGVRCMNSAVYRLGNYSCYPENNVNQWSAIPSAPISLSSPECDCSKTGFQFCSDPLSGGPTISSRIMTSSDQLGNITGYNISDYLLKKFKTFIKKQYGGYQFLLPSNFGLSSNSIGSSPIWDGISSYINSSPNNSNS-LGFLNYSQRFFNQSGIKTNYTRIWVNSKGFVSMPAYENIFSNILLRSKLNSFSDISKYGISVTNYPLKFSQTDLQSQLNTQMFLEVSLAIFVIFGLSFIPASFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWSVIFTIESGIINRSICGRIKNYKLKERELQHEEDTDVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTF 1746          

HSP 2 Score: 50.8322 bits (120), Expect = 5.964e-6
Identity = 41/133 (30.83%), Postives = 61/133 (45.86%), Query Frame = 2
Query:    8 RIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISNSGDKLLQFIKSHIPDA---KMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEEIDNLNALSYGLSDTSLEEVFIRVADDPAKINE 397
            R++I+  G+++C G+   LK KFGD Y + +  NF          I N  DK+   +K+  P     K E     Q+ F      + S K S +F   +    N     Y +S TSL+EVFI  A + +  NE
Sbjct: 1904 RLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNF----------IENESDKIKAIMKTQFPQGVSLKDENFITLQYRF------NCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNKSSNNE 2020          
The following BLAST results are available for this feature:
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA11.296e-11031.43ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA76.552e-10029.95ATP binding cassette subfamily A member 7 [Source:... [more]
ABCA41.497e-9629.27ATP binding cassette subfamily A member 4 [Source:... [more]
ABCA45.291e-8828.67ATP binding cassette subfamily A member 4 [Source:... [more]
ABCA22.465e-7732.35ATP binding cassette subfamily A member 2 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abt-21.912e-3427.70ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-22.089e-3427.70ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
ced-78.405e-2726.47ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
ced-71.088e-2626.47ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
ced-71.231e-2626.47ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG341204.769e-2826.12gene:FBgn0083956 transcript:FBtr0110827[more]
CG341205.065e-2826.12gene:FBgn0083956 transcript:FBtr0343018[more]
CG341206.588e-2826.12gene:FBgn0083956 transcript:FBtr0299591[more]
ABCA4.090e-2527.78gene:FBgn0031170 transcript:FBtr0306679[more]
ABCA4.707e-2527.78gene:FBgn0031170 transcript:FBtr0332489[more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca1b7.871e-11531.47ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1b2.190e-11331.10ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1a2.318e-10631.14ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1a2.318e-10631.14ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4b2.864e-10629.96ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA12.672e-11731.95ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA13.387e-11431.47ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA12.916e-11331.42ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA12.105e-11231.00ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA13.651e-11130.81ATP binding cassette subfamily A member 1 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abca12.302e-11331.82ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca47.879e-10329.25ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca71.265e-9429.84ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca71.265e-9429.84ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca41.794e-9428.54ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41233|ABCA1_MOUSE1.610e-11231.82Phospholipid-transporting ATPase ABCA1 OS=Mus musc... [more]
sp|O95477|ABCA1_HUMAN6.226e-11031.43Phospholipid-transporting ATPase ABCA1 OS=Homo sap... [more]
sp|O35600|ABCA4_MOUSE5.511e-10229.25Retinal-specific phospholipid-transporting ATPase ... [more]
sp|Q8IZY2|ABCA7_HUMAN3.146e-9929.95Phospholipid-transporting ATPase ABCA7 OS=Homo sap... [more]
sp|P78363|ABCA4_HUMAN7.189e-9629.27Retinal-specific phospholipid-transporting ATPase ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JVH44.999e-14734.25LOW QUALITY PROTEIN: ATP-binding cassette sub-fami... [more]
V4ABB82.403e-13435.11Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
N1PB024.893e-13134.52Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2T7NPT01.319e-12034.75Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1D1VFB88.082e-11935.51Uncharacterized protein OS=Ramazzottius varieornat... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016919.23.109e-11431.18pep primary_assembly:Astyanax_mexicanus-2.0:8:9912... [more]
zgc:1723024.579e-11332.66zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5][more]
zgc:1723027.591e-11131.51zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5][more]
abca1a5.662e-10931.52ATP-binding cassette sub-family A member 1-like [S... [more]
abca1a5.662e-10931.52ATP-binding cassette sub-family A member 1-like [S... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca129.145e-4930.02ATP-binding cassette, sub-family A (ABC1), member ... [more]
ENSPMAT00000002495.11.199e-4525.95pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene... [more]
ENSPMAT00000006855.11.873e-981.25pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene... [more]
ENSPMAT00000006988.11.178e-658.33pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-... [more]
ENSPMAT00000010397.13.255e-670.00pep scaffold:Pmarinus_7.0:GL480213:155963:163950:1... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468781.831e-11533.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388793.650e-10730.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489514.014e-3730.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320712.842e-829.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280924.649e-831.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000046301.11.873e-11932.28ATP-binding cassette sub-family A member 1-like [S... [more]
ENSORLT00000045391.12.004e-11932.28ATP-binding cassette sub-family A member 1-like [S... [more]
ENSORLT00000025407.22.184e-11431.53ATP-binding cassette sub-family A member 1 [Source... [more]
abca1a2.521e-11231.49ATP-binding cassette sub-family A member 1 [Source... [more]
abca1a7.277e-11231.49ATP-binding cassette sub-family A member 1 [Source... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029534.10.000e+090.55SMESG000029534.1[more]
SMESG000029537.10.000e+069.44SMESG000029537.1[more]
SMESG000032891.10.000e+059.77SMESG000032891.1[more]
SMESG000032861.10.000e+059.30SMESG000032861.1[more]
SMESG000068605.15.964e-656.39SMESG000068605.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007539 ID=SMED30007539|Name=ATP-binding cassette sub-family A member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2554bp
CAGTGACAGAATTGCTATCATTTCCCAGGGAAAACTCCAATGTTGCGGCT
CATCAGTGTTTTTGAAACGGAAATTCGGCGATGGATATCGATTGATCCTG
GTAAAGAATTTCAACGCTCAAAAAGAAAATTTCCGCAAAGGAATTTCTAA
TTCCGGAGATAAGTTATTGCAATTTATCAAGTCCCATATTCCGGATGCGA
AGATGGAAACCGAAACAATGACTCAATGGAGCTTTGTTTTACCGCAAAAT
GATAGCAATAGTTGCAAATTCTCTGGGCTATTTGTGAATCTCGATGAAGA
AATTGACAACTTGAATGCGTTGTCATATGGATTGTCGGACACATCTCTTG
AGGAAGTGTTTATTAGGGTAGCTGATGATCCAGCAAAAATAAACGAGGAA
ACAAAGAATGAAAAACTGATTCCAGATAACTTGAATAGAATTGCTGTCTA
TGGTGACATAGAAAACCAGGAACCCTTTCTAGACCTCGAGGACCTCAATC
AGCAGGCGTTTGTTGATAAATCCTTGATTTCATTGAATTTTAATAGAAAT
CATAAATTATTAAGAGGATTTCCCCTATTAAAACAGCAAATAATTGGACT
GCAAATTAAAAGATTCCATTACGCAAAACGAAACAAAAAAGGGATTTTCG
CTGAATTGATATTACCGATTTTAATGATTACACTAATGATTGCTTTATTG
AAACTCGTAAATCCCCTGGAAAGCTTACCGGCAATGGAAATCAGTCCCTG
GTTGATGATGCCAAAATCTAGATCAATAAATTTAAATACATTTTATCGGA
AAGAAAATCAATTAAATTTTTCGATAACAAATCAATTGGGAAATAAAAAT
TCAATAAATCCTTTGACGGATCGATTGGAAAGCGAATATCGATCCGATCT
CGGTGAATCGGGAATCAGGTGCATGAATCCATCAATTTATCGATCAACCC
ATTATCGGTGTTTCCCTGAATATAAAAACAATAAATGGTCACCTATTCCT
AATGGAAACATTCCATTAATTAGCCCAGAATGTGATTGCAATACAACCGG
ATATCAGATCTGCAATGATCCTCGCAGCGGTGGTCCACCGAATTCATACC
GAATAATGACCAGTAGTGATAAACTGAACAATTTAACCGGATATAATATA
TCGGATTATTTATTGAAAAATTTTCAAAGGTTATCGAGAAAAATTTTTGG
AGGTTACCAATTTTTATTGCCAAATGATTTTGCACAGTCATCGAAATTAA
TTGCTCAGTCCCCAACATGGGATGGAATACGTGATTCCGTAAATCAATCT
CAACCACAAAACCTGGAGCCATTAAGGTTTTTAAAATACTTTCAAGAGTT
TTTCAATAAGTCTAGCAAGACGATGAATTTTTCACGAATCTGGATAAATT
CTAAAGGATACGCATCAATGCCAGCGTACGCAAATATTCTGAGCAATTTG
TTGTTGCGATCTAGAATAAAATTATCACAAAATTCTTGGAACTATGGGAT
TTCCGTTACAAATTACCCAATTGCAGATAGTGAAACAAAGATTTCTCAGT
TTAATAATTTAATATTATTAGAAGTTACTTTGGCAATTTACGTAATATTG
GCGCTGTCATTTATATCAGCCAGTTTTGTTATTTTTCTAATAGACGAACG
AATTAGTGGCTCCAAGCGGCAGCAATTCGTGTCGGGAATCAACCCCTACG
TGTATTGGGTATCCAATTTCTTGTGGGACATCATGAAATACATCATTCCC
ATTATTATCATCATAATAATTTTTATTGCCTTTGATTATCAATCATATAT
CTGCAGCAAAAATGCTCTTGCTTTCATTCTTCTTTTAATTTTCTACGGAT
TAGCTATTATTCCCCATATGTATCCATTTAGCTTCTTCATTTCCACACCA
AGCACCGCATTTGTGGTGTTAAATGCCTACAATTTATTAGTCGGCACAAT
TACAACGATTTCCACATTTATTTTAGATATTTTGGAAGTCAATTATGAAT
ATTTAAAAGAGATTAATGACATTTTGAAAAAGGTTTTCTTAATATTCCCC
CAGTTCAATCTCGGTAGAGGGATCATGGATTTATTTTTTAATTACTTTTA
CAATAGTAATTCGATAGTTAAACATGAATATAACGCTTTACAGTGGGATA
TTGCCGGGGAGAAACTTTTTTCACTTTTCAGTTTGTCTATTGGATGGTGG
ATTGTTTTAATAATCATTGAAAGTGGGATTGTAAATCGAATTATTTGCGG
TAAGTTGAAAAACTCGTATTTGAAAAGAATAGAAATCAGAAATACAGAAG
ACTTTGATGTTAATTTAGAGAGAGAAAGAATGAGTTCAGACCAAAAATCT
GATGATGTGTTAAGAGTCATTAATTTAACTAAAATCTACAATGTGTATTT
AAAATTTAAAGACAATTGTGGTGAAAAAGGAAAAGATAACTATATTAAGA
ATAAAGCCCGTGAAGTGGCTGTTAATAATCTGTGTTTTGGTGTTCGAGAA
GGCGAATGTTTCGGATTGCTCGGCGTGAATGGCGCGGGTAAAACAACGAC
TTTT
back to top

protein sequence of SMED30007539-orf-1

>SMED30007539-orf-1 ID=SMED30007539-orf-1|Name=SMED30007539-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=851bp
SDRIAIISQGKLQCCGSSVFLKRKFGDGYRLILVKNFNAQKENFRKGISN
SGDKLLQFIKSHIPDAKMETETMTQWSFVLPQNDSNSCKFSGLFVNLDEE
IDNLNALSYGLSDTSLEEVFIRVADDPAKINEETKNEKLIPDNLNRIAVY
GDIENQEPFLDLEDLNQQAFVDKSLISLNFNRNHKLLRGFPLLKQQIIGL
QIKRFHYAKRNKKGIFAELILPILMITLMIALLKLVNPLESLPAMEISPW
LMMPKSRSINLNTFYRKENQLNFSITNQLGNKNSINPLTDRLESEYRSDL
GESGIRCMNPSIYRSTHYRCFPEYKNNKWSPIPNGNIPLISPECDCNTTG
YQICNDPRSGGPPNSYRIMTSSDKLNNLTGYNISDYLLKNFQRLSRKIFG
GYQFLLPNDFAQSSKLIAQSPTWDGIRDSVNQSQPQNLEPLRFLKYFQEF
FNKSSKTMNFSRIWINSKGYASMPAYANILSNLLLRSRIKLSQNSWNYGI
SVTNYPIADSETKISQFNNLILLEVTLAIYVILALSFISASFVIFLIDER
ISGSKRQQFVSGINPYVYWVSNFLWDIMKYIIPIIIIIIIFIAFDYQSYI
CSKNALAFILLLIFYGLAIIPHMYPFSFFISTPSTAFVVLNAYNLLVGTI
TTISTFILDILEVNYEYLKEINDILKKVFLIFPQFNLGRGIMDLFFNYFY
NSNSIVKHEYNALQWDIAGEKLFSLFSLSIGWWIVLIIIESGIVNRIICG
KLKNSYLKRIEIRNTEDFDVNLERERMSSDQKSDDVLRVINLTKIYNVYL
KFKDNCGEKGKDNYIKNKAREVAVNNLCFGVREGECFGLLGVNGAGKTTT
F
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR026082ABCA
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005102signaling receptor binding
GO:0005215transporter activity
GO:0005515protein binding
GO:0005524ATP binding
GO:0005548phospholipid transporter activity
GO:0008509anion transmembrane transporter activity
GO:0016887ATPase activity
GO:0017127cholesterol transporter activity
GO:0019905syntaxin binding
GO:0031267small GTPase binding
GO:0034185apolipoprotein binding
GO:0034186apolipoprotein A-I binding
GO:0034188apolipoprotein A-I receptor activity
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0051117ATPase binding
GO:0090554phosphatidylcholine-translocating ATPase activity
GO:0090556phosphatidylserine-translocating ATPase activity
Vocabulary: biological process
TermDefinition
GO:0002790peptide secretion
GO:0006497protein lipidation
GO:0006810transport
GO:0006911phagocytosis, engulfment
GO:0007040lysosome organization
GO:0007186G-protein coupled receptor signaling pathway
GO:0007584response to nutrient
GO:0008203cholesterol metabolic process
GO:0010875positive regulation of cholesterol efflux
GO:0015914phospholipid transport
GO:0015917aminophospholipid transport
GO:0016197endosomal transport
GO:0030301cholesterol transport
GO:0030819positive regulation of cAMP biosynthetic process
GO:0032367intracellular cholesterol transport
GO:0032489regulation of Cdc42 protein signal transduction
GO:0033344cholesterol efflux
GO:0033700phospholipid efflux
GO:0034380high-density lipoprotein particle assembly
GO:0034616response to laminar fluid shear stress
GO:0038027apolipoprotein A-I-mediated signaling pathway
GO:0042157lipoprotein metabolic process
GO:0042158lipoprotein biosynthetic process
GO:0042493response to drug
GO:0042632cholesterol homeostasis
GO:0043691reverse cholesterol transport
GO:0045332phospholipid translocation
GO:0050702interleukin-1 beta secretion
GO:0055085transmembrane transport
GO:0055091phospholipid homeostasis
GO:0055098response to low-density lipoprotein particle
GO:0060155platelet dense granule organization
GO:0071222cellular response to lipopolysaccharide
GO:0071300cellular response to retinoic acid
GO:0071397cellular response to cholesterol
GO:0098656anion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0009897external side of plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030139endocytic vesicle
GO:0034364high-density lipoprotein particle
GO:0043231intracellular membrane-bounded organelle
GO:0045121membrane raft
GO:0045335phagocytic vesicle
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF12698ABC2_membrane_3coord: 442..590
e-value: 1.0E-19
score: 70.9
NoneNo IPR availablePANTHERPTHR19229:SF185coord: 2..592
NoneNo IPR availableTMHMMTMhelixcoord: 214..236
NoneNo IPR availableTMHMMTMhelixcoord: 568..590
NoneNo IPR availableTMHMMTMhelixcoord: 525..547
IPR026082ABC transporter APANTHERPTHR19229ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A ABCAcoord: 2..592