Glycerol kinase

Overview
NameGlycerol kinase
Smed IDSMED30007536
Length (bp)1876
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycerol kinase (SMED30007536) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycerol kinase (SMED30007536) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycerol kinase (SMED30007536) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycerol kinase (SMED30007536) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007536

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30007536SMESG000032910.1 SMESG000032921.1 dd_Smed_v4_286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007536SMESG000032910.1 SMESG000032921.1 dd_Smed_v4_286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007536SMESG000032921.1 SMESG000032910.1 Contig29374uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007536SMESG000032921.1 SMESG000032910.1 Contig29374newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007536SMESG000032910.1 SMESG000032921.1 Contig2861newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007536SMESG000032910.1 SMESG000032921.1 Contig2861uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007536SMESG000065325.1 Contig2861newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007536SMESG000065325.1 Contig2861uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30007536SMESG000032910.1 SMESG000032921.1 dd_Smed_v6_286_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007536SMESG000032910.1 SMESG000032921.1 dd_Smed_v4_286_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30007536SMESG000032910.1 SMESG000032921.1 SMED30034219smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30007536SMESG000032910.1 SMESG000032921.1 SMED30034219smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30007536SMESG000032910.1 SMESG000032921.1 SMED30034219smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycerol kinase vs. Ensembl Human
Match: GK5 (glycerol kinase 5 [Source:HGNC Symbol;Acc:HGNC:28635])

HSP 1 Score: 348.977 bits (894), Expect = 1.135e-112
Identity = 184/516 (35.66%), Postives = 294/516 (56.98%), Query Frame = 2
Query:  104 GYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            G+V+G+DVGSS+++C ++D+   +   S +++E   P  G  E+DP  LW+ F  V K+ +  + + +  I  +GIS QR +F+ W + T       ISWQD+R+   VKSWN S  +KI + S ++ +F TR+ R   AS+  F +   S+RL  +LQ+  ++         C+G I+TWLL+ LT G  ++TD S AS TG++DP+   WS  I +L++IP  +LP V++T  NFG    +    G+ IPI  ++ D Q+A  G  CF  G+ K+T+GTG+FL+INTGN    +  G YP IGWK     +   E     TG+ I W + L+ F    E E++    +++ +D  S  V FVP+F GLQ P+NDP A    +GL P+T K  +V A++E+I    + + + +++E  + ++ IR +G V +N +++Q  +++    I+   + + SC GAA LAGL +G W    EL  + + + VF P+    E  +     W +A +RS NW
Sbjct:   19 GFVLGLDVGSSVIRCHVYDRAARVCGSSVQKVENLYPQIGWVEIDPDVLWIQFVAVIKEAVKAAGIQMNQIVGLGISTQRATFITWNKKTGNHFHNFISWQDLRAVELVKSWNNSLLMKIFHSSCRVLHFFTRSKRLFTASLFTFTTQQTSLRLVWILQNLTEVQKAVEEENCCFGTIDTWLLYKLTKGSVYATDFSNASTTGLFDPYKMCWSGMITSLISIPLSLLPPVRDTSHNFGSVDEEIF--GVPIPIVALVADQQSAMFGECCFQTGDVKLTMGTGTFLDINTGNSLQQTTGGFYPLIGWKIGQEVVCLAESNAGDTGTAIKWAQQLDLFTDAAETEKM----AKSLED--SEGVCFVPSFSGLQAPLNDPWACASFMGLKPSTSKYHLVRAILESIAFRNKQLYEMMKKEIHIPVRKIRADGGVCKNGFVMQMTSDLINENIDRPADIDMSCLGAASLAGLAVGFWTDKEELKKLRQSEVVFKPQKKCQE-YEMSLENWAKAVKRSMNW 525          
BLAST of Glycerol kinase vs. Ensembl Human
Match: GK (glycerol kinase [Source:HGNC Symbol;Acc:HGNC:4289])

HSP 1 Score: 205.682 bits (522), Expect = 2.865e-58
Identity = 163/533 (30.58%), Postives = 262/533 (49.16%), Query Frame = 2
Query:  104 GYVVG-IDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQE-VFKDCITKSQLSL--QDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASI-LNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLT---DGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKI--EACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNTS 1660
            G +VG +D G+S  +  +F+ K   + S    EI+   P +G  E DPK++     E + K C    QL++   +IKAIG+S QR + ++W++ T +P+   + W D+R+ S+V                 L+  I  N  ++ +   L   +   +++L  LL +  K+          +G I++WL+W LT   +G    TD + AS T +++  +  W + +     IP EILP V+++ + +G      L G   +PI   +GD  AA VG  CF  G+ K T GTG FL  NTG+    S  GL   + +K        Y +EG     G+ I WLR NL   KT +E+E+L        +   S   +FVPAF GL  P  +P+A G++ GL   T K  I FA +EA+    R ILDA+ ++ G+ L  ++V+G +  NK ++Q  A+I  + +   +  ET A     A  A   +G+W   LE  D+  +    F     +E+ + ++  WK+A  +S  W T+
Sbjct:   10 GPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTV---------------ESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEG---VPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLA------KEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWS--LEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTT 516          
BLAST of Glycerol kinase vs. Ensembl Human
Match: GK (glycerol kinase [Source:HGNC Symbol;Acc:HGNC:4289])

HSP 1 Score: 206.068 bits (523), Expect = 3.960e-58
Identity = 163/533 (30.58%), Postives = 262/533 (49.16%), Query Frame = 2
Query:  104 GYVVG-IDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQE-VFKDCITKSQLSL--QDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASI-LNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLT---DGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKI--EACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNTS 1660
            G +VG +D G+S  +  +F+ K   + S    EI+   P +G  E DPK++     E + K C    QL++   +IKAIG+S QR + ++W++ T +P+   + W D+R+ S+V                 L+  I  N  ++ +   L   +   +++L  LL +  K+          +G I++WL+W LT   +G    TD + AS T +++  +  W + +     IP EILP V+++ + +G      L G   +PI   +GD  AA VG  CF  G+ K T GTG FL  NTG+    S  GL   + +K        Y +EG     G+ I WLR NL   KT +E+E+L        +   S   +FVPAF GL  P  +P+A G++ GL   T K  I FA +EA+    R ILDA+ ++ G+ L  ++V+G +  NK ++Q  A+I  + +   +  ET A     A  A   +G+W   LE  D+  +    F     +E+ + ++  WK+A  +S  W T+
Sbjct:   10 GPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTV---------------ESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEG---VPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKL------AKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWS--LEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTT 516          
BLAST of Glycerol kinase vs. Ensembl Human
Match: GK3P (glycerol kinase 3 pseudogene [Source:HGNC Symbol;Acc:HGNC:4292])

HSP 1 Score: 206.068 bits (523), Expect = 4.904e-58
Identity = 161/533 (30.21%), Postives = 260/533 (48.78%), Query Frame = 2
Query:  104 GYVVG-IDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQE-VFKDCITKSQLSL--QDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASI-LNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLT---DGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKI--EACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNTS 1660
            G +VG +D G+S  +  +F+ +   + S    EI+   P +G  E DPK++     E + K C    QL++   +IKAIG+S QR + ++W++ T +P+   + W D+R+ S+V                 L+  I  N  ++ +   L   +   +++L  LL +  K+          +G I++WL+W LT   +G    TD + AS T +++  +  W + +     IP EILP V+++ + +G      L G   +PI   +GD  AA VG  CF  G+ K T GTG FL  NTG+    S  GL   + +K        Y +EG     G+ I WLR NL   KT +E+E+L        +   S   +FVPAF GL  P  +P+A G++ GL   T K  I FA +EA+    R ILDA+ ++ G+ L  ++V+G +  NK ++Q  A+I  + +      ET A     A  A   + +W   LE  D+  +    F     +E+ + ++  WK+A  +S  W T+
Sbjct:   10 GPLVGAVDQGTSSTRFLVFNSRTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIGISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTV---------------ESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPHVRSSSEIYGLMKAGALEG---VPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKL------AKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPLMPETTALGAAMAAGAAEGVDVWS--LEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTT 516          
BLAST of Glycerol kinase vs. Ensembl Human
Match: GK (glycerol kinase [Source:HGNC Symbol;Acc:HGNC:4289])

HSP 1 Score: 205.297 bits (521), Expect = 5.574e-58
Identity = 164/536 (30.60%), Postives = 264/536 (49.25%), Query Frame = 2
Query:  104 GYVVG-IDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQE-VFKDCITKSQLSL--QDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASI-LNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLT---DGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFG--RTSTDFLGGGL-SIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKI--EACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNTS 1660
            G +VG +D G+S  +  +F+ K   + S    EI+   P +G  E DPK++     E + K C    QL++   +IKAIG+S QR + ++W++ T +P+   + W D+R+ S+V                 L+  I  N  ++ +   L   +   +++L  LL +  K+          +G I++WL+W LT   +G    TD + AS T +++  +  W + +     IP EILP V+++ + +G  + S     G L  +PI   +GD  AA VG  CF  G+ K T GTG FL  NTG+    S  GL   + +K        Y +EG     G+ I WLR NL   KT +E+E+L        +   S   +FVPAF GL  P  +P+A G++ GL   T K  I FA +EA+    R ILDA+ ++ G+ L  ++V+G +  NK ++Q  A+I  + +   +  ET A     A  A   +G+W   LE  D+  +    F     +E+ + ++  WK+A  +S  W T+
Sbjct:   10 GPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTV---------------ESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKISHSVKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLA------KEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWS--LEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTT 522          
BLAST of Glycerol kinase vs. Ensembl Celegans
Match: C55B6.1 (pep chromosome:WBcel235:X:7200370:7204044:1 gene:WBGene00016939.1 transcript:C55B6.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C55B6.1)

HSP 1 Score: 257.299 bits (656), Expect = 6.079e-78
Identity = 162/526 (30.80%), Postives = 270/526 (51.33%), Query Frame = 2
Query:   92 ESESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGH------YELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEIL-PEVKNTIDNFGRTS-TDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKS-IRVNGSVARNKWILQRLANITKLKIEACTETE-ASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQR 1639
            +    +V+ +D+G++ ++  ++D     K   S + ++N             E++P++L++ F  V K       L       +G+  QRNS +LW + T K  T II W D R+++   + N S+ LK +N +    +F+TR  R+LAA  L F   +VS RL   +    KL      G++CYG +ETWLL   +       +AS  S +G++DP+   ++  I+ ++  P ++L P V + + +  +    D    G    I  II D QAA  G G + +G+ KITLGTG+F+N++TG +P+ SM GLYP +GW+    T +  EG    T   ++W +++  F    E   + +S +       S  V F+PAF G+Q PIND TA    + + P T K  +V A++E+I   +  I  A + E  +   S +R+ G V+ N +I Q +A++   K+E  T+++  +  G A L G + GIW    +L ++  ++ +F P Y   + L K F  WK+A  R
Sbjct:    3 DDSENFVLTVDIGTTTIRSVVYDS--KCKERGSYQEKVNTIYTTRNDDEVLVEIEPEQLFLQFLRVIKKAY--ETLPPNAHVDVGLCTQRNSIVLWNKRTLKEETRIICWNDKRANNKCHNLNNSFLLKALNLAGGFLHFVTRKNRFLAAQRLKFLGGMVSHRLMVTIDRSEKLKLMKADGDLCYGSLETWLLMRSSKSNILCVEASNISPSGMFDPWIGAYNTLIMKIIGFPTDMLFPIVDSNLKDMNKLPIIDSSHIGKEFTISSIIADQQAAMFGCGTWERGDVKITLGTGTFVNVHTGKVPYASMSGLYPLVGWRINGETDFIAEGNAHDTAVILHWAQSIGLFNDVTETSDIALSVND------SNGVVFIPAFCGIQTPINDETACSGFMCIRPDTTKVHMVRAILESIAFRVYQIYAAAESEVNINKNSPVRICGGVSNNNFICQCIADLLGRKVERMTDSDHVAARGVALLTGFSSGIWTK-EKLRELVTVEDIFTPNYESRKGLLKTFQTWKKAVDR 517          
BLAST of Glycerol kinase vs. Ensembl Celegans
Match: C55B6.1 (pep chromosome:WBcel235:X:7200364:7204044:1 gene:WBGene00016939.1 transcript:C55B6.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C55B6.1)

HSP 1 Score: 257.299 bits (656), Expect = 6.079e-78
Identity = 162/526 (30.80%), Postives = 270/526 (51.33%), Query Frame = 2
Query:   92 ESESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGH------YELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEIL-PEVKNTIDNFGRTS-TDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKS-IRVNGSVARNKWILQRLANITKLKIEACTETE-ASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQR 1639
            +    +V+ +D+G++ ++  ++D     K   S + ++N             E++P++L++ F  V K       L       +G+  QRNS +LW + T K  T II W D R+++   + N S+ LK +N +    +F+TR  R+LAA  L F   +VS RL   +    KL      G++CYG +ETWLL   +       +AS  S +G++DP+   ++  I+ ++  P ++L P V + + +  +    D    G    I  II D QAA  G G + +G+ KITLGTG+F+N++TG +P+ SM GLYP +GW+    T +  EG    T   ++W +++  F    E   + +S +       S  V F+PAF G+Q PIND TA    + + P T K  +V A++E+I   +  I  A + E  +   S +R+ G V+ N +I Q +A++   K+E  T+++  +  G A L G + GIW    +L ++  ++ +F P Y   + L K F  WK+A  R
Sbjct:    3 DDSENFVLTVDIGTTTIRSVVYDS--KCKERGSYQEKVNTIYTTRNDDEVLVEIEPEQLFLQFLRVIKKAY--ETLPPNAHVDVGLCTQRNSIVLWNKRTLKEETRIICWNDKRANNKCHNLNNSFLLKALNLAGGFLHFVTRKNRFLAAQRLKFLGGMVSHRLMVTIDRSEKLKLMKADGDLCYGSLETWLLMRSSKSNILCVEASNISPSGMFDPWIGAYNTLIMKIIGFPTDMLFPIVDSNLKDMNKLPIIDSSHIGKEFTISSIIADQQAAMFGCGTWERGDVKITLGTGTFVNVHTGKVPYASMSGLYPLVGWRINGETDFIAEGNAHDTAVILHWAQSIGLFNDVTETSDIALSVND------SNGVVFIPAFCGIQTPINDETACSGFMCIRPDTTKVHMVRAILESIAFRVYQIYAAAESEVNINKNSPVRICGGVSNNNFICQCIADLLGRKVERMTDSDHVAARGVALLTGFSSGIWTK-EKLRELVTVEDIFTPNYESRKGLLKTFQTWKKAVDR 517          
BLAST of Glycerol kinase vs. Ensembl Celegans
Match: R11F4.1 (Probable glycerol kinase [Source:UniProtKB/Swiss-Prot;Acc:Q21944])

HSP 1 Score: 191.815 bits (486), Expect = 9.156e-54
Identity = 153/527 (29.03%), Postives = 251/527 (47.63%), Query Frame = 2
Query:  110 VVGIDVGSSILKCQIFDK-LGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKS-------QLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQ--ETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            +  ID G+S  +  +F+   G + +    E+    P  G  E+DP +L+    +    CI+K+        +S  +IK++G++ QR + ++W++ T KP+   I W D R+SS           K  +              + A + L       +++L  L Q+ P++      G + +G ++TWL+W LT    + TD S AS T + D     WS  +    ++P EILPE++++ + +G      L G   +P+   +GD QAA VG  C N G+ K T GTG+F+  N G  P +S  GL   +G++    +  +Y +EG     G+ + +LR N +F     E+E L  S      +D S   +FVP+F GL  P  D TA G ++GL   T +E I  A + A+      ++ AV+Q  E G K+ +++V+G +  NK   +  A+I    I     TE S  GAA   G+      SL E       D+ + P+   + +   +  +WKEA +RS  W
Sbjct:    4 LAAIDQGTSSSRFLVFEADTGELVTSHQIEVRQLFPHGGWVEMDPMELY----DTVVSCISKTIEKLENLGISADEIKSVGVANQRETSIVWDKETGKPLYNAIVWLDTRTSSLADEAISRTASKSKDE-------------FRAKTGLPIHPYFSALKLKWLFQNVPEVKKAYADGNLMFGTVDTWLIWKLTGA--YVTDVSNASRTLLLDLHKRKWSTQLCEFFDLPIEILPEIRSSAEVYGHFDKGPLEG---VPLSGCLGDQQAAMVGHQCLNAGQTKNTYGTGTFMLCNIGTRPIISKNGLLTTVGFQFGADSPVVYALEGSGSIGGNVVRFLRDNFKFISDAKEMEGLCRS-----VEDTSG-AYFVPSFTGLYTPYWDSTARGTILGLTQVTQREHICLAALRAVAFQSAEMIAAVEQDLEGGTKVTTLKVDGGMIANKLFNEIQADIMGRDIVTPKITEISGWGAAVAGGIGAQ-QISLDEFLQQSSEDNRYTPQKDDNWR-SAELARWKEAVKRSCGW 500          
BLAST of Glycerol kinase vs. Ensembl Celegans
Match: R11F4.1 (Probable glycerol kinase [Source:UniProtKB/Swiss-Prot;Acc:Q21944])

HSP 1 Score: 191.815 bits (486), Expect = 9.156e-54
Identity = 153/527 (29.03%), Postives = 251/527 (47.63%), Query Frame = 2
Query:  110 VVGIDVGSSILKCQIFDK-LGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKS-------QLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQ--ETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            +  ID G+S  +  +F+   G + +    E+    P  G  E+DP +L+    +    CI+K+        +S  +IK++G++ QR + ++W++ T KP+   I W D R+SS           K  +              + A + L       +++L  L Q+ P++      G + +G ++TWL+W LT    + TD S AS T + D     WS  +    ++P EILPE++++ + +G      L G   +P+   +GD QAA VG  C N G+ K T GTG+F+  N G  P +S  GL   +G++    +  +Y +EG     G+ + +LR N +F     E+E L  S      +D S   +FVP+F GL  P  D TA G ++GL   T +E I  A + A+      ++ AV+Q  E G K+ +++V+G +  NK   +  A+I    I     TE S  GAA   G+      SL E       D+ + P+   + +   +  +WKEA +RS  W
Sbjct:    4 LAAIDQGTSSSRFLVFEADTGELVTSHQIEVRQLFPHGGWVEMDPMELY----DTVVSCISKTIEKLENLGISADEIKSVGVANQRETSIVWDKETGKPLYNAIVWLDTRTSSLADEAISRTASKSKDE-------------FRAKTGLPIHPYFSALKLKWLFQNVPEVKKAYADGNLMFGTVDTWLIWKLTGA--YVTDVSNASRTLLLDLHKRKWSTQLCEFFDLPIEILPEIRSSAEVYGHFDKGPLEG---VPLSGCLGDQQAAMVGHQCLNAGQTKNTYGTGTFMLCNIGTRPIISKNGLLTTVGFQFGADSPVVYALEGSGSIGGNVVRFLRDNFKFISDAKEMEGLCRS-----VEDTSG-AYFVPSFTGLYTPYWDSTARGTILGLTQVTQREHICLAALRAVAFQSAEMIAAVEQDLEGGTKVTTLKVDGGMIANKLFNEIQADIMGRDIVTPKITEISGWGAAVAGGIGAQ-QISLDEFLQQSSEDNRYTPQKDDNWR-SAELARWKEAVKRSCGW 500          
BLAST of Glycerol kinase vs. Ensembl Celegans
Match: C55B6.1 (pep chromosome:WBcel235:X:7200805:7204044:1 gene:WBGene00016939.1 transcript:C55B6.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C55B6.1)

HSP 1 Score: 164.466 bits (415), Expect = 1.063e-45
Identity = 92/267 (34.46%), Postives = 144/267 (53.93%), Query Frame = 2
Query:  845 GLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKS-IRVNGSVARNKWILQRLANITKLKIEACTETE-ASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQR 1639
            G    I  II D QAA  G G + +G+ KITLGTG+F+N++TG +P+ SM GLYP +GW+    T +  EG    T   ++W +++  F    E   + +S +       S  V F+PAF G+Q PIND TA    + + P T K  +V A++E+I   +  I  A + E  +   S +R+ G V+ N +I Q +A++   K+E  T+++  +  G A L G + GIW    +L ++  ++ +F P Y   + L K F  WK+A  R
Sbjct:   34 GKEFTISSIIADQQAAMFGCGTWERGDVKITLGTGTFVNVHTGKVPYASMSGLYPLVGWRINGETDFIAEGNAHDTAVILHWAQSIGLFNDVTETSDIALSVND------SNGVVFIPAFCGIQTPINDETACSGFMCIRPDTTKVHMVRAILESIAFRVYQIYAAAESEVNINKNSPVRICGGVSNNNFICQCIADLLGRKVERMTDSDHVAARGVALLTGFSSGIWTK-EKLRELVTVEDIFTPNYESRKGLLKTFQTWKKAVDR 293          
BLAST of Glycerol kinase vs. Ensembl Fly
Match: CG1271 (gene:FBgn0035392 transcript:FBtr0072987)

HSP 1 Score: 285.034 bits (728), Expect = 5.747e-88
Identity = 166/531 (31.26%), Postives = 279/531 (52.54%), Query Frame = 2
Query:  104 GYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGK------EFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEV-KNTIDNFGRTSTDFLG---GGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTT-----MYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
             +++ +DVG++ ++  + D+   ++  +   +E+  P  G++E++P+ LW     V    +  +QL+  DI  + IS QR +FL W+  + +     I+W+D+R+   V  WN SW    +N  S   + +TR  R+LA S+L   +  V+ RL   + ++ KL       +     +++W+L  L  G       E  TD + ++ TG+YDPFT +WS  I  L  I  +ILP V  N    FG       G       IPI   + D  AA  G  CF K + K+T+GTG+FLN+ TG+     + G+YP + W+ K  T     +Y +EG +   G+ + W ++ E F +      +    +Q+  D  + DV F+PAF GL  P+ND  ++   IGL P+T K  +V A++E+I   +  +++A ++ET  KL  IRV+G V+RN ++ Q LA++++L++E     E+S  GA ++AG+N+GIW+ + +L    K+  VF P     E +  +  KW     R  +W
Sbjct:   31 AFILALDVGTTCVRSFVLDEQCEVRGSAVDAVELLNPQPGYFEIEPESLWRKIVGVITQAVKNAQLTPPDITCLTISTQRCTFLTWDHRSGEYYHNFITWKDLRADELVDQWNASWTKSSMNWFSYALFLLTRQSRFLAGSVLQLMNGQVTPRLLFEIMNNKKLKQALMQKKARVELLDSWILHKLRTGSSRDKDVEHITDVTSSTATGLYDPFTLSWSPLISWLFGINSKILPRVVDNGYKGFGHVHPTAFGPDWANTEIPIAASLSDQTAAIWGSQCFQKNDVKVTMGTGAFLNLVTGDRCQAVISGMYPLVAWQFKKPTRQQGAVYCIEGASHDFGTVVTWAQSCELFDSPANTSDI----AQSVPD--TNDVFFMPAFSGLGPPVNDYRSASGFIGLTPSTTKAHMVRALLESIVFRLVQLIEAAEKETSQKLHMIRVDGGVSRNDFVCQFLADLSRLRVERADNAESSIMGATFMAGINLGIWRDVNDLKRFRKVARVFEPRPKEYETIANRMDKWSRTIARFSDW 555          
BLAST of Glycerol kinase vs. Ensembl Fly
Match: CG1271 (gene:FBgn0035392 transcript:FBtr0072988)

HSP 1 Score: 275.018 bits (702), Expect = 1.969e-84
Identity = 164/531 (30.89%), Postives = 274/531 (51.60%), Query Frame = 2
Query:  104 GYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGK------EFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEV-KNTIDNFGRTSTDFLG---GGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTT-----MYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
             +++ +DVG++ ++  + D+   ++  +   +E+  P  G++E++P+ LW     V    +  +QL+  DI  + IS QR +FL W+  + +     I+W+D+R+   V  WN SW    +N  S   + +TR  R+LA S+L             L+     +  +AR        +++W+L  L  G       E  TD + ++ TG+YDPFT +WS  I  L  I  +ILP V  N    FG       G       IPI   + D  AA  G  CF K + K+T+GTG+FLN+ TG+     + G+YP + W+ K  T     +Y +EG +   G+ + W ++ E F +      +    +Q+  D  + DV F+PAF GL  P+ND  ++   IGL P+T K  +V A++E+I   +  +++A ++ET  KL  IRV+G V+RN ++ Q LA++++L++E     E+S  GA ++AG+N+GIW+ + +L    K+  VF P     E +  +  KW     R  +W
Sbjct:   31 AFILALDVGTTCVRSFVLDEQCEVRGSAVDAVELLNPQPGYFEIEPESLWRKIVGVITQAVKNAQLTPPDITCLTISTQRCTFLTWDHRSGEYYHNFITWKDLRADELVDQWNASWTKSSMNWFSYALFLLTRQSRFLAGSVLQ------------LMNGQALMQKKARVE-----LLDSWILHKLRTGSSRDKDVEHITDVTSSTATGLYDPFTLSWSPLISWLFGINSKILPRVVDNGYKGFGHVHPTAFGPDWANTEIPIAASLSDQTAAIWGSQCFQKNDVKVTMGTGAFLNLVTGDRCQAVISGMYPLVAWQFKKPTRQQGAVYCIEGASHDFGTVVTWAQSCELFDSPANTSDI----AQSVPD--TNDVFFMPAFSGLGPPVNDYRSASGFIGLTPSTTKAHMVRALLESIVFRLVQLIEAAEKETSQKLHMIRVDGGVSRNDFVCQFLADLSRLRVERADNAESSIMGATFMAGINLGIWRDVNDLKRFRKVARVFEPRPKEYETIANRMDKWSRTIARFSDW 538          
BLAST of Glycerol kinase vs. Ensembl Fly
Match: CG1271 (gene:FBgn0035392 transcript:FBtr0072986)

HSP 1 Score: 231.106 bits (588), Expect = 3.181e-69
Identity = 134/411 (32.60%), Postives = 215/411 (52.31%), Query Frame = 2
Query:  464 INHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGK------EFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEV-KNTIDNFGRTSTDFLG---GGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTT-----MYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            +N  S   + +TR  R+LA S+L   +  V+ RL   + ++ KL       +     +++W+L  L  G       E  TD + ++ TG+YDPFT +WS  I  L  I  +ILP V  N    FG       G       IPI   + D  AA  G  CF K + K+T+GTG+FLN+ TG+     + G+YP + W+ K  T     +Y +EG +   G+ + W ++ E F +      +    +Q+  D  + DV F+PAF GL  P+ND  ++   IGL P+T K  +V A++E+I   +  +++A ++ET  KL  IRV+G V+RN ++ Q LA++++L++E     E+S  GA ++AG+N+GIW+ + +L    K+  VF P     E +  +  KW     R  +W
Sbjct:    1 MNWFSYALFLLTRQSRFLAGSVLQLMNGQVTPRLLFEIMNNKKLKQALMQKKARVELLDSWILHKLRTGSSRDKDVEHITDVTSSTATGLYDPFTLSWSPLISWLFGINSKILPRVVDNGYKGFGHVHPTAFGPDWANTEIPIAASLSDQTAAIWGSQCFQKNDVKVTMGTGAFLNLVTGDRCQAVISGMYPLVAWQFKKPTRQQGAVYCIEGASHDFGTVVTWAQSCELFDSPANTSDI----AQSVPD--TNDVFFMPAFSGLGPPVNDYRSASGFIGLTPSTTKAHMVRALLESIVFRLVQLIEAAEKETSQKLHMIRVDGGVSRNDFVCQFLADLSRLRVERADNAESSIMGATFMAGINLGIWRDVNDLKRFRKVARVFEPRPKEYETIANRMDKWSRTIARFSDW 405          
BLAST of Glycerol kinase vs. Ensembl Fly
Match: Gk1 (gene:FBgn0025592 transcript:FBtr0072529)

HSP 1 Score: 191.43 bits (485), Expect = 3.370e-53
Identity = 161/540 (29.81%), Postives = 258/540 (47.78%), Query Frame = 2
Query:  107 YVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEIN--IPADGHYELDPKKLWVDFQEVFKDCITKSQLSL-------QDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASI-LNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTG-NIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDK-----KFVKWKEACQRSRNWNTS 1660
            +V  ID G++  +  IF + G  +     +IE+      +G  E DP  +         +CIT +   L       ++I  IGI+ QR S ++W+R++ +P+   I W D R++S+V+       L+ I +++       RNI YL     L        ++L  L  + P ++     G   +G I+TWL++ LT GK+     TD + AS T + +  T  W   ++    +PK ILPE+ ++ + +G  +   L G   I I  ++GD QAA VG  C  KG+ K T GTG FL  NTG +I H S  GL   +G++   K    Y +EG     G+  NWLR N+   +   ++E +       +  D S DV+FVPAF GL  P  +  A G++ GL+  T  E IV A +EA+   +R ILD++ ++  + L  + V+G +  N   LQ  +++  +++      E +  GAA  A      +K++     +    S   P   I   +       ++ KWK A  RS NW TS
Sbjct:   19 FVGAIDEGTTSARFIIF-RAGTDEIVCFHQIEVESIFQKEGWCEQDPMAI----VNTVNECITGACKKLVAVGGKVEEIITIGITNQRESTVVWDRNSGQPLVNAIIWLDNRTTSTVEEL-----LETIPNNA-------RNINYLRPLCGLPLSPYFSGVKLRWLRDNVPVVSQAMEKGTAMFGTIDTWLMYNLTGGKDCGVHKTDVTNASRTMLMNIETLQWDANLLKFFGLPKTILPEICSSSEFYGSIAQGVLQG---IGITSVLGDQQAALVGQQCLAKGQAKATYGTGCFLLYNTGPSIVH-STHGLLTTVGYQLGRKAVPFYALEGSVSIAGAAFNWLRDNMNLIQNSGQIETMA------STVDNSLDVYFVPAFNGLYAPYWNQDARGVICGLSEETTSEHIVRATLEAVCFQVRDILDSMHKDCKIPLAKLMVDGGMTVNNLFLQLQSDLVGIQVLRAKIAETTALGAAMAA------YKAVENRYQMEAPLSKSGPREAIKPSISATDRNLRYQKWKMAIDRSLNWETS 525          
BLAST of Glycerol kinase vs. Ensembl Fly
Match: Gk1 (gene:FBgn0025592 transcript:FBtr0072530)

HSP 1 Score: 189.889 bits (481), Expect = 4.042e-53
Identity = 144/465 (30.97%), Postives = 230/465 (49.46%), Query Frame = 2
Query:  305 LQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASI-LNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTG-NIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDK-----KFVKWKEACQRSRNWNTS 1660
            +++I  IGI+ QR S ++W+R++ +P+   I W D R++S+V+       L+ I +++       RNI YL     L        ++L  L  + P ++     G   +G I+TWL++ LT GK+     TD + AS T + +  T  W   ++    +PK ILPE+ ++ + +G  +   L G   I I  ++GD QAA VG  C  KG+ K T GTG FL  NTG +I H S  GL   +G++   K    Y +EG     G+  NWLR N+   +   ++E +       +  D S DV+FVPAF GL  P  +  A G++ GL+  T  E IV A +EA+   +R ILD++ ++  + L  + V+G +  N   LQ  +++  +++      E +  GAA  A      +K++     +    S   P   I   +       ++ KWK A  RS NW TS
Sbjct:   25 VEEIITIGITNQRESTVVWDRNSGQPLVNAIIWLDNRTTSTVEEL-----LETIPNNA-------RNINYLRPLCGLPLSPYFSGVKLRWLRDNVPVVSQAMEKGTAMFGTIDTWLMYNLTGGKDCGVHKTDVTNASRTMLMNIETLQWDANLLKFFGLPKTILPEICSSSEFYGSIAQGVLQG---IGITSVLGDQQAALVGQQCLAKGQAKATYGTGCFLLYNTGPSIVH-STHGLLTTVGYQLGRKAVPFYALEGSVSIAGAAFNWLRDNMNLIQNSGQIETMA------STVDNSLDVYFVPAFNGLYAPYWNQDARGVICGLSEETTSEHIVRATLEAVCFQVRDILDSMHKDCKIPLAKLMVDGGMTVNNLFLQLQSDLVGIQVLRAKIAETTALGAAMAA------YKAVENRYQMEAPLSKSGPREAIKPSISATDRNLRYQKWKMAIDRSLNWETS 461          
BLAST of Glycerol kinase vs. Ensembl Zebrafish
Match: gk5 (glycerol kinase 5 [Source:NCBI gene;Acc:777765])

HSP 1 Score: 372.859 bits (956), Expect = 4.507e-122
Identity = 196/528 (37.12%), Postives = 303/528 (57.39%), Query Frame = 2
Query:   83 NKMESESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVK-----WKEACQRSRNW 1651
            N       +++ +DVG++ ++C ++DK  +I+   S ++ +  P  G  E+DP +LW  F  V K  +  S L +  ++++GIS QR +F+ W+R+T KP    I+WQD+R++  V+SWN S  +K ++   K+ +F++R  R+LAAS++ F +  VS+RL   L + P+L      G   +G I+TWLL+ LT G   +TD S AS T I+D +   WS  + +LL+IP  ILP+V++T   FG   +     G+ IPI C++ D QAA  G  CF+ G+ KIT+GTG+F++INTG+ PH S+ GLYP +GWK     +Y  EG    TG+ I W ++LE F    E E +       T  + S  V FVP+F GLQ P+NDP A    +GL P+T K  +V A++E+I    + + D + +ET + +  IR +G V  N +I+Q  A++   KI   +  + SC GAA++AGL  G W++  EL  +   D  F P    SE       +     W++A QRS +W
Sbjct:    6 NGYSKRETFILSVDVGTTSIRCHVYDKSASIRGSCSAKVSLLYPQPGWVEIDPDELWDGFVTVVKGAVQDSGLQMCQMESLGISTQRATFMTWDRNTGKPFHKFITWQDMRAAELVRSWNGSCTMKTVHGVMKMLHFLSRQKRFLAASLVVFTTQHVSLRLVWALNNIPQLRQAVEDGTCYFGTIDTWLLYKLTKGLVHATDYSNASATAIFDSYQMCWSGFLCSLLSIPLSILPKVQDTSHKFGLCDSSIF--GVPIPIMCVMADQQAAMFGECCFDTGDVKITMGTGTFMDINTGSKPHTSVAGLYPLVGWKIGADVVYLAEGNAAGTGAAIKWAQDLELFSDVKETEAI------ATSVEDSDGVFFVPSFSGLQAPLNDPKACASFMGLKPSTTKRHLVRAILESIAFRNKQLFDVMLRETRIPITKIRADGGVCTNDFIMQLTADLLGRKIARPSHFDMSCLGAAFVAGLGTGYWRNQEELKKLLSTDQHFLPRRSKSEGEKGGLYRGVLQSWEKALQRSMHW 525          
BLAST of Glycerol kinase vs. Ensembl Zebrafish
Match: GK3P (zgc:172295 [Source:ZFIN;Acc:ZDB-GENE-080204-72])

HSP 1 Score: 222.631 bits (566), Expect = 1.275e-64
Identity = 158/529 (29.87%), Postives = 267/529 (50.47%), Query Frame = 2
Query:  110 VVGIDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVF-KDC--ITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASI-LNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKI--EACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNT 1657
            V  ID G+S  +  +F+ K   + S    EI+ + P +G  E DPK++     E   + C  +T+  + + +IKA+G++ QR + L+W++ T +P+   I W D+R+ S+V+        ++IN +        +N  +L     L   +   +++L  L+ +  K++    +    +G +++WL+WCLT GK      TD + AS T +++  T  W   +    +IP  ILP+V+++ + +G   +  L G   +PI   +GD  AA VG  CF  G+ K T GTG FL  N G  P +S  GL   + +K        Y +EG     G+ + WL+ NL   +T  ELE+L            S   +FVPAF GL  P  +P+A G++ GL   T +  + FA +EA+    R ILDA+ Q++G+ L  ++V+G +  N+ ++Q  A+I  + +   +  ET A     A  A   + +W   L   D+ ++ S  F      E+ + ++ +WK+A QR+ NW T
Sbjct:   18 VAAIDQGTSSTRFLVFNAKTAELLSHHQVEIKQSFPKEGWVEEDPKEILQSVYECMDRTCEKLTQLNIDVSNIKAVGVTNQRETTLVWDKQTGEPLYNAIVWLDLRTQSTVE--------RLINKTPG------KNKNHLKDKTGLPISTYFSAVKLRWLMDNVEKVHEAVLSHRAMFGTVDSWLIWCLTGGKNGGVHCTDVTNASRTMLFNIHTMDWDPELCIYFDIPMGILPKVRSSSEIYGLMKSGPLTG---VPISGCLGDQSAALVGQMCFKDGQAKNTYGTGCFLLKNVGTKPVMSDHGLLTTVAYKLGRDKPACYALEGSVAIAGAVVRWLKDNLGIIQTSTELEKLAADVG------TSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNRSHLAFAALEAVCFQTREILDAMNQDSGINLSQLQVDGGMTSNRLLMQLQADILCIPVVKPSMPETTALGAAMAAGAAEGVSVWS--LNPEDLTEVTSEKFEPQINPEESELRYARWKKAVQRAMNWET 521          
BLAST of Glycerol kinase vs. Ensembl Xenopus
Match: GK5 (glycerol kinase 5 [Source:NCBI gene;Acc:101734558])

HSP 1 Score: 363.999 bits (933), Expect = 4.411e-118
Identity = 193/523 (36.90%), Postives = 300/523 (57.36%), Query Frame = 2
Query:   95 SESGY----VVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            + +GY    +V +DVGSS+L+C ++++ G I   +  ++++  P  G+ E+DP+ LW  F  + K+ I  + + +  +  +GIS QR +F+ W + T +P    ISWQD+R++  V SWN S  LK ++      +F TR  R+LAAS++NF +  VS+RL  +LQ+ P++   A+ G  C+G I+TWLL+ LT G  F+TD S AS T I+DP+   WS  + +LL+IP  I P V++T  NFG       G   ++PI  ++ D QAA  G  CF+ G  K+T+GTGSF++INTG   H S+ GLYP IGWK     +   EG    TG+ I W   L  F +  + E +    +++  D     ++FVP+F GLQ P+NDP A    +GL P+T K  +V A++E++    + + D V +ET + +  IR +G V+ N +I+Q  A++    I+    T+ S  GAA+LAGL +G+W +  EL  +      F P+    E  ++    W+ A QR  NW
Sbjct:    4 ARNGYRDRLIVAVDVGSSVLRCHLYNQAGQICGSAEDKLKVLYPQTGYVEIDPESLWDQFVGIVKEAIKDAGIQMSQVAGLGISTQRATFITWNKTTGEPFHNFISWQDLRAADLVSSWNSSVLLKAVHGVCTALHFFTRRKRFLAASLINFTTQHVSLRLVWVLQNIPQVRQEAKIGNCCFGTIDTWLLYKLTSGTVFATDYSNASGTAIFDPYLMCWSSFLCSLLSIPMSIFPSVEDTSHNFGLADPIIFGA--AVPIRALVADQQAAMFGQCCFDVGNVKLTMGTGSFISINTGERLHTSIAGLYPLIGWKIGKEVVCLAEGNASDTGTAIKWAEELNLFTSVADTEAM----ARSVPD--CGGIYFVPSFSGLQAPVNDPYACASFMGLKPSTSKNHLVRAILESVAYRNKQLYDTVLRETTIPITLIRADGGVSNNNFIMQMTADLLGQTIDKPKHTDMSSLGAAFLAGLAVGLWSTKDELKKLRTTQCEFEPQAKWKE-YEQSMGSWEVALQRCSNW 517          
BLAST of Glycerol kinase vs. Ensembl Xenopus
Match: GK5 (glycerol kinase 5 [Source:NCBI gene;Acc:101734558])

HSP 1 Score: 332.028 bits (850), Expect = 5.050e-106
Identity = 180/485 (37.11%), Postives = 273/485 (56.29%), Query Frame = 2
Query:  197 IEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            +++  P  G+ E+DP+ LW  F  + K+ I  + + +  +  +GIS QR +F+ W + T +P    ISWQD+R++  V SWN S  LK ++      +F TR  R+LAAS++NF +  VS+RL  +LQ+ P++   A+ G  C+G I+TWLL+ LT G  F+TD S AS T I+DP+   WS  + +LL+IP  I P V++T  NFG       G  + I     + D QAA  G  CF+ G  K+T+GTGSF++INTG   H S+ GLYP IGWK     +   EG    TG+ I W   L  F +  + E +    +++  D     ++FVP+F GLQ P+NDP A    +GL P+T K  +V A++E++    + + D V +ET + +  IR +G V+ N +I+Q  A++    I+    T+ S  GAA+LAGL +G+W +  EL  +      F P+    E  ++    W+ A QR  NW
Sbjct:   18 LKVLYPQTGYVEIDPESLWDQFVGIVKEAIKDAGIQMSQVAGLGISTQRATFITWNKTTGEPFHNFISWQDLRAADLVSSWNSSVLLKAVHGVCTALHFFTRRKRFLAASLINFTTQHVSLRLVWVLQNIPQVRQEAKIGNCCFGTIDTWLLYKLTSGTVFATDYSNASGTAIFDPYLMCWSSFLCSLLSIPMSIFPSVEDTSHNFGLADPIIFGAAVPIR----VADQQAAMFGQCCFDVGNVKLTMGTGSFISINTGERLHTSIAGLYPLIGWKIGKEVVCLAEGNASDTGTAIKWAEELNLFTSVADTEAM----ARSVPD--CGGIYFVPSFSGLQAPVNDPYACASFMGLKPSTSKNHLVRAILESVAYRNKQLYDTVLRETTIPITLIRADGGVSNNNFIMQMTADLLGQTIDKPKHTDMSSLGAAFLAGLAVGLWSTKDELKKLRTTQCEFEPQAKWKE-YEQSMGSWEVALQRCSNW 491          
BLAST of Glycerol kinase vs. Ensembl Xenopus
Match: GK5 (glycerol kinase 5 [Source:NCBI gene;Acc:101734558])

HSP 1 Score: 323.553 bits (828), Expect = 1.574e-102
Identity = 181/521 (34.74%), Postives = 288/521 (55.28%), Query Frame = 2
Query:   89 MESESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            +E++  ++  +DVGSS+L+C ++++ G I       +++  P  G+ E+DP+ LW  F  + K+ I  + + +  +  +GIS QR +F+ W + T +P    ISWQD+R++  V SWN S  LK ++      +F TR  R+LAAS++NF +  VS+RL  +LQ+ P++  +++ G  C+G I+TWLL+ LT     S  + C             WS  + +LL+IP  I P V++T  NFG       G   ++PI  ++ D QAA  G  CF+ G  K+T+GTGSF++INTG   H S+ GLYP IGWK     +   EG    TG+ I W   L  F +  + E +    +++  D     ++FVP+F GLQ P+NDP A    +GL P+T K  +V A++E++    + + D V +ET + +  IR +G V+ N +I+Q  A++    I+    T+ S  GAA+LAGL +G+W +  EL  +      F P+    E  ++    W+ A QR  NW
Sbjct:   22 LEAQRPFLFAVDVGSSVLRCHLYNQAGQI----CGSLKVLYPQTGYVEIDPESLWDQFVGIVKEAIKDAGIQMSQVAGLGISTQRATFITWNKTTGEPFHNFISWQDLRAADLVSSWNSSVLLKAVHGVCTALHFFTRRKRFLAASLINFTTQHVSLRLVWVLQNIPQV-PKSKIGNCCFGTIDTWLLYKLT-----SVPSMC-------------WSSFLCSLLSIPMSIFPSVEDTSHNFGLADPIIFGA--AVPIRALVADQQAAMFGQCCFDVGNVKLTMGTGSFISINTGERLHTSIAGLYPLIGWKIGKEVVCLAEGNASDTGTAIKWAEELNLFTSVADTEAM----ARSVPD--CGGIYFVPSFSGLQAPVNDPYACASFMGLKPSTSKNHLVRAILESVAYRNKQLYDTVLRETTIPITLIRADGGVSNNNFIMQMTADLLGQTIDKPKHTDMSSLGAAFLAGLAVGLWSTKDELKKLRTTQCEFEPQAKWKE-YEQSMGSWEVALQRCSNW 510          
BLAST of Glycerol kinase vs. Ensembl Xenopus
Match: GK5 (glycerol kinase 5 [Source:NCBI gene;Acc:101734558])

HSP 1 Score: 322.783 bits (826), Expect = 3.852e-102
Identity = 185/529 (34.97%), Postives = 290/529 (54.82%), Query Frame = 2
Query:   95 SESGY----VVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTD---ASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            + +GY    +V +DVGSS+L+C ++++ G I       +++  P  G+ E+DP+ LW  F  + K+ I  + + +  +  +GIS QR +F+ W + T +P    ISWQD+R++  V SWN S  LK ++      +F TR  R+LAAS++NF +  VS+RL  +LQ+ P++  +++ G  C+G I+TWLL+ LT G        D        V+G        WS  + +LL+IP  I P V++T  NFG       G   ++PI  ++ D QAA  G  CF+ G  K+T+GTGSF++INTG   H S+ GLYP IGWK     +   EG    TG+ I W   L  F +  + E +    +++  D     ++FVP+F GLQ P+NDP A    +GL P+T K  +V A++E++    + + D V +ET + +  IR +G V+ N +I+Q  A++    I+    T+ S  GAA+LAGL +G+W +  EL  +      F P+    E  ++    W+ A QR  NW
Sbjct:    4 ARNGYRDRLIVAVDVGSSVLRCHLYNQAGQI----CGSLKVLYPQTGYVEIDPESLWDQFVGIVKEAIKDAGIQMSQVAGLGISTQRATFITWNKTTGEPFHNFISWQDLRAADLVSSWNSSVLLKAVHGVCTALHFFTRRKRFLAASLINFTTQHVSLRLVWVLQNIPQV-PKSKIGNCCFGTIDTWLLYKLTSGGAAWALPRDLLFCDFLPVSGFTFLLQMCWSSFLCSLLSIPMSIFPSVEDTSHNFGLADPIIFGA--AVPIRALVADQQAAMFGQCCFDVGNVKLTMGTGSFISINTGERLHTSIAGLYPLIGWKIGKEVVCLAEGNASDTGTAIKWAEELNLFTSVADTEAM----ARSVPD--CGGIYFVPSFSGLQAPVNDPYACASFMGLKPSTSKNHLVRAILESVAYRNKQLYDTVLRETTIPITLIRADGGVSNNNFIMQMTADLLGQTIDKPKHTDMSSLGAAFLAGLAVGLWSTKDELKKLRTTQCEFEPQAKWKE-YEQSMGSWEVALQRCSNW 518          
BLAST of Glycerol kinase vs. Ensembl Xenopus
Match: GK5 (glycerol kinase 5 [Source:NCBI gene;Acc:101734558])

HSP 1 Score: 319.701 bits (818), Expect = 3.106e-101
Identity = 182/519 (35.07%), Postives = 285/519 (54.91%), Query Frame = 2
Query:   95 SESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            S S   + +DVGSS+L+C ++++ G I       +++  P  G+ E+DP+ LW  F  + K+ I  + + +  +  +GIS QR +F+ W + T +P    ISWQD+R++  V SWN S  LK ++      +F TR  R+LAAS++NF +  VS+RL  +LQ+ P++  +++ G  C+G I+TWLL+ LT     S  + C             WS  + +LL+IP  I P V++T  NFG       G   ++PI  ++ D QAA  G  CF+ G  K+T+GTGSF++INTG   H S+ GLYP IGWK     +   EG    TG+ I W   L  F +  + E +    +++  D     ++FVP+F GLQ P+NDP A    +GL P+T K  +V A++E++    + + D V +ET + +  IR +G V+ N +I+Q  A++    I+    T+ S  GAA+LAGL +G+W +  EL  +      F P+    E  ++    W+ A QR  NW
Sbjct:    8 SSSQQGLAVDVGSSVLRCHLYNQAGQI----CGSLKVLYPQTGYVEIDPESLWDQFVGIVKEAIKDAGIQMSQVAGLGISTQRATFITWNKTTGEPFHNFISWQDLRAADLVSSWNSSVLLKAVHGVCTALHFFTRRKRFLAASLINFTTQHVSLRLVWVLQNIPQV-PKSKIGNCCFGTIDTWLLYKLT-----SVPSMC-------------WSSFLCSLLSIPMSIFPSVEDTSHNFGLADPIIFGA--AVPIRALVADQQAAMFGQCCFDVGNVKLTMGTGSFISINTGERLHTSIAGLYPLIGWKIGKEVVCLAEGNASDTGTAIKWAEELNLFTSVADTEAM----ARSVPD--CGGIYFVPSFSGLQAPVNDPYACASFMGLKPSTSKNHLVRAILESVAYRNKQLYDTVLRETTIPITLIRADGGVSNNNFIMQMTADLLGQTIDKPKHTDMSSLGAAFLAGLAVGLWSTKDELKKLRTTQCEFEPQAKWKE-YEQSMGSWEVALQRCSNW 494          
BLAST of Glycerol kinase vs. Ensembl Mouse
Match: Gk5 (glycerol kinase 5 (putative) [Source:MGI Symbol;Acc:MGI:2443336])

HSP 1 Score: 349.362 bits (895), Expect = 6.692e-113
Identity = 186/518 (35.91%), Postives = 295/518 (56.95%), Query Frame = 2
Query:  101 SGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTG-NIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            S +V+G+DVGS++++C ++D+   ++  S++++E   P  G  E+DP  LW  F  V KD +  + + +  I  +GIS QR +F+ W + T       ISWQD+R++  VKSWN S  +K+++ ++++ +F +R+   L  S  NF +   ++RL  +LQ+  ++         C+G I+TWLL+ LT G  ++TD S AS TG +DP+   WS  I  +++IP  ILP VK+T  NFG         G+ IP+  ++GD Q+A  G  CF  G+ K+T+GTG+FL+INTG N+ HV+  G YP IGWK     +   EG    TG+ I W + L+ F    E E++ +S         S  V+FVP+F GLQ P+NDP A    +GL  +T K  +V A++E+I    + + D +Q+E  + + +IR +G V  N +++Q  +++   KI+     + SC GAA LAGL +G W    EL  + + + VF P+    E  +     W +A +RS NW
Sbjct:   23 SRFVLGLDVGSTVIRCHVYDQTARVRGSSAQKVENVYPQPGWVEIDPDSLWAQFVAVIKDAVKAAGVQMNQIVGLGISTQRATFITWNKKTGHHFHNFISWQDLRAAELVKSWNNSLIMKLLHGATRVLHFFSRSKVMLTVSRFNFSTQHATLRLTWILQNLSEVKRAVEEDNCCFGTIDTWLLYKLTKGSSYATDYSNASTTGFFDPYAMRWSRLITTMVSIPLSILPPVKDTSYNFGSVDEKIF--GVPIPVVALVGDQQSAMFGECCFETGDVKLTMGTGTFLDINTGKNLQHVN-GGFYPLIGWKIGQELVCLAEGNAGDTGTAIMWAQKLDLFTDAAETEKMALSLED------SEGVYFVPSFSGLQAPLNDPCACASFMGLKHSTNKYHLVRAILESIAFRNKQLYDMLQREIQIPVTNIRADGGVCNNAFVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVGFWADKEELQKLRQSEMVFKPQKKWQE-YEVNMENWVKAVKRSMNW 530          
BLAST of Glycerol kinase vs. Ensembl Mouse
Match: Gk5 (glycerol kinase 5 (putative) [Source:MGI Symbol;Acc:MGI:2443336])

HSP 1 Score: 341.658 bits (875), Expect = 4.023e-110
Identity = 179/494 (36.23%), Postives = 285/494 (57.69%), Query Frame = 2
Query:  101 SGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTG-NIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPE 1579
            S +V+G+DVGS++++C ++D+   ++  S++++E   P  G  E+DP  LW  F  V KD +  + + +  I  +GIS QR +F+ W + T       ISWQD+R++  VKSWN S  +K+++ ++++ +F +R+   L  S  NF +   ++RL  +LQ+  ++         C+G I+TWLL+ LT G  ++TD S AS TG +DP+   WS  I  +++IP  ILP VK+T  NFG         G+ IP+  ++GD Q+A  G  CF  G+ K+T+GTG+FL+INTG N+ HV+  G YP IGWK     +   EG    TG+ I W + L+ F    E E++ +S         S  V+FVP+F GLQ P+NDP A    +GL  +T K  +V A++E+I    + + D +Q+E  + + +IR +G V  N +++Q  +++   KI+     + SC GAA LAGL +G W    EL  + + + VF P+
Sbjct:   23 SRFVLGLDVGSTVIRCHVYDQTARVRGSSAQKVENVYPQPGWVEIDPDSLWAQFVAVIKDAVKAAGVQMNQIVGLGISTQRATFITWNKKTGHHFHNFISWQDLRAAELVKSWNNSLIMKLLHGATRVLHFFSRSKVMLTVSRFNFSTQHATLRLTWILQNLSEVKRAVEEDNCCFGTIDTWLLYKLTKGSSYATDYSNASTTGFFDPYAMRWSRLITTMVSIPLSILPPVKDTSYNFGSVDEKIF--GVPIPVVALVGDQQSAMFGECCFETGDVKLTMGTGTFLDINTGKNLQHVN-GGFYPLIGWKIGQELVCLAEGNAGDTGTAIMWAQKLDLFTDAAETEKMALSLED------SEGVYFVPSFSGLQAPLNDPCACASFMGLKHSTNKYHLVRAILESIAFRNKQLYDMLQREIQIPVTNIRADGGVCNNAFVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVGFWADKEELQKLRQSEMVFKPQ 507          
BLAST of Glycerol kinase vs. Ensembl Mouse
Match: Gykl1 (glycerol kinase-like 1 [Source:MGI Symbol;Acc:MGI:891990])

HSP 1 Score: 209.92 bits (533), Expect = 1.041e-59
Identity = 149/532 (28.01%), Postives = 264/532 (49.62%), Query Frame = 2
Query:  104 GYVVG-IDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKS-------QLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLT---DGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLRN-LEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKID-SVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            G +VG +D G+S  +  +F+ +   +      EI    P +G  E DPK +    Q V+ +CI K+        + + +IKAIG++ QR + ++W++ T +P+   + W D+R+ S+         ++ ++ S  ++    +N   L  S     +   +++L+ L+++  K+      G   +G +++WL+WC+T   +G    TD S AS T +++  +  W E + +   IP  ILP ++++ + +G   +  L G   +PI   +GD  AA VG  C   G+ K T GTG FL  NTG     S  GL   + ++   +    Y +EG     G+ ++W++N L+  ++  E+E+L            S   +FVPAF GL  P  DP+A G++ GL   T K  I FA +EA+    R ILDA+  + G+ L  ++V+G +  N+ ++Q  A+I  + +      E +  G A  AG   G+    L+  D+  +    F P+ ++ E  + ++  WK+A  +S  W
Sbjct:   10 GPLVGAVDQGTSSTRFLVFNPQTAELLCHHQVEIAQEFPKEGWVEQDPKAI---LQSVY-ECIEKACEKLGQQSIDISNIKAIGVTNQRETTIVWDKFTGEPLYNAVVWLDLRTQST---------VENLSKSISVSNNFVKNKTGLPIS-----TYFSAVKLHWLIENVRKVQKAIEDGRAIFGTVDSWLIWCMTGGINGGVHCTDVSNASRTMLFNIHSLQWDEELCDFFGIPMTILPRIRSSSEIYGLVKSGVLEG---VPISGCLGDQSAALVGQLCLQDGQAKSTYGTGCFLLCNTGQKCVNSEHGLLTTVAYQLGRQEPVYYALEGSVAIAGAVVSWIKNNLQIIQSSSEIEKL------AEVAGTSYGCYFVPAFSGLYAPYWDPSARGIICGLTQFTNKFHIAFAALEAVCFQTREILDAMNSDCGIPLTHLQVDGGMTANRVLMQLQADILCIPVMKPFMPETTALGVAMAAGAAEGVSVWSLDPKDLSSVQMEKFEPQINVEES-EGRYATWKKAVLKSMGW 513          
BLAST of Glycerol kinase vs. Ensembl Mouse
Match: Gk (glycerol kinase [Source:MGI Symbol;Acc:MGI:106594])

HSP 1 Score: 206.068 bits (523), Expect = 1.376e-58
Identity = 162/537 (30.17%), Postives = 263/537 (48.98%), Query Frame = 2
Query:  104 GYVVG-IDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKS-------QLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASI-LNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKI--EACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNTS 1660
            G +VG +D G+S  +  +F+ K   + S    EI+   P +G  E DPK++    Q V+ +CI K+        + + +IKAIG+S QR + ++W++ T +P+   + W D+R+ S+V                 L+  I  N  ++ +   L   +   +++L  LL +  K+          +G I++WL+W LT G       TD + AS T +++  +  W + +     IP EILP V+++ + +G      L G   +PI   +GD  AA VG  CF  G+ K T GTG FL  NTG+    S  GL   + +K        Y +EG     G+ I WLR NL   K+ +E+E+L        +   S   +FVPAF GL  P  +P+A G++ GL   T K  I FA +EA+    R ILDA+ ++ G+ L  ++V+G +  NK ++Q  A+I  + +   +  ET A     A  A   +G+W   LE  D+  +    F     +E+ + ++  WK+A  +S  W T+
Sbjct:   10 GPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI---LQSVY-ECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKVTGEPLYNAVVWLDLRTQSTV---------------ENLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVKKVQEAVEENRALFGTIDSWLIWSLTGGIHGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFGIPMEILPNVRSSSEIYGLMKAGALEG---VPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGHKCVFSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKLA------KEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWS--LEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSIGWVTT 516          
BLAST of Glycerol kinase vs. Ensembl Mouse
Match: Gk (glycerol kinase [Source:MGI Symbol;Acc:MGI:106594])

HSP 1 Score: 206.068 bits (523), Expect = 2.583e-58
Identity = 162/537 (30.17%), Postives = 263/537 (48.98%), Query Frame = 2
Query:  104 GYVVG-IDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKS-------QLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASI-LNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKI--EACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNTS 1660
            G +VG +D G+S  +  +F+ K   + S    EI+   P +G  E DPK++    Q V+ +CI K+        + + +IKAIG+S QR + ++W++ T +P+   + W D+R+ S+V                 L+  I  N  ++ +   L   +   +++L  LL +  K+          +G I++WL+W LT G       TD + AS T +++  +  W + +     IP EILP V+++ + +G      L G   +PI   +GD  AA VG  CF  G+ K T GTG FL  NTG+    S  GL   + +K        Y +EG     G+ I WLR NL   K+ +E+E+L        +   S   +FVPAF GL  P  +P+A G++ GL   T K  I FA +EA+    R ILDA+ ++ G+ L  ++V+G +  NK ++Q  A+I  + +   +  ET A     A  A   +G+W   LE  D+  +    F     +E+ + ++  WK+A  +S  W T+
Sbjct:   10 GPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI---LQSVY-ECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKVTGEPLYNAVVWLDLRTQSTV---------------ENLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVKKVQEAVEENRALFGTIDSWLIWSLTGGIHGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFGIPMEILPNVRSSSEIYGLMKAGALEG---VPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGHKCVFSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKL------AKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWS--LEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSIGWVTT 516          
BLAST of Glycerol kinase vs. UniProt/SwissProt
Match: sp|A0JPE9|GLPK5_DANRE (Putative glycerol kinase 5 OS=Danio rerio OX=7955 GN=gk5 PE=2 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 5.725e-118
Identity = 192/514 (37.35%), Postives = 296/514 (57.59%), Query Frame = 2
Query:  125 VGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVK-----WKEACQRSRNW 1651
            +G++ ++C ++DK  +I+   S ++ +  P  G  E+DP +LW  F  V K  +  S L +  ++++GIS QR +F+ W+R+T KP    I+WQD+R++  V+SWN S  +K ++   K+ +F++R  R+LAAS++ F +  VS+RL   L + P+L      G   +G I+TWLL+ LT G   +TD S AS T I+D +   WS  + +LL+IP  ILP+V++T   FG   +     G+ IPI C++ D Q A  G  CF+ G+ KIT+GTG+F++INTG+ PH S+ GLYP +GWK     +Y  EG    TG+ I W ++LE F    E E +       T  + S  V FVP+F GLQ P+NDP A    +GL P+T K  +V A++E+I    + + D + +ET + +  IR +G V  N +I+Q  A++   KI   +  + SC GAA++AGL  G W++  EL  +   D  F P    SE       +     W++A QRS +W
Sbjct:    1 MGTTSIRCHVYDKSASIRGSCSAKVSLLYPQPGWVEIDPDELWDGFVTVVKGAVQDSGLQMCQMESLGISTQRATFMTWDRNTGKPFHKFITWQDMRAAELVRSWNGSCAMKTVHGVMKMLHFLSRQKRFLAASLVVFTTQHVSLRLVWALNNIPQLRQAVEDGSCYFGTIDTWLLYKLTKGLVHATDYSNASATAIFDSYQMCWSGFLCSLLSIPLSILPKVQDTSHKFGLCDSSIF--GVPIPIMCVMADQQTAMFGECCFDTGDVKITMGTGTFMDINTGSKPHTSVAGLYPLVGWKIGADVVYLAEGNAAGTGAAIKWAQDLELFSDVKETEAI------ATSVEDSDGVFFVPSFSGLQAPLNDPKACASFMGLKPSTTKRHLVRAILESIAFRNKQLFDVMLRETRIPITKIRADGGVCTNDFIMQLTADLLGRKIARPSHFDMSCLGAAFVAGLGTGYWRNQEELKKLLSTDQHFLPRRSKSEGEKGGLYRGVLQSWEKALQRSMHW 506          
BLAST of Glycerol kinase vs. UniProt/SwissProt
Match: sp|Q5ZMJ4|GLPK5_CHICK (Putative glycerol kinase 5 OS=Gallus gallus OX=9031 GN=GK5 PE=2 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 6.092e-115
Identity = 190/515 (36.89%), Postives = 301/515 (58.45%), Query Frame = 2
Query:  107 YVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            YVVG+DVGS+ +KC ++D+   ++  S +++E   P  G  ELDP+ LW  F  V K+ +  + L ++ + A+GIS QR++F+ W + T KP    ISWQD+RS+  V SWN+S  LK+I+    + +F T N RYLA S+L F +   S++L  + ++ P+ +  A+    C+G ++TWLL+ LT G  F+TD S AS TG+++PFT  W+ T+ +LL+IP  I P VK+T  NFG   ++    G+ +PI  ++ D Q+A  G  CF  G+ K+T+GTG F N+NTG     S KGLYP IGWK     +Y  EG   + G+TI W +++  F   DE  ++    +++  D  S  V FVP   G QV  NDP      +GL PTT +  +V A++E++    + + D + ++  + L+++R +G V+ N +++Q  +++   KIE  + T+ S  GAA+LAGL  G+W    +L  + +I++VF P+    E        W  A + S +W
Sbjct:   15 YVVGVDVGSTTVKCHVYDRAAGVRGSSCRKVESLYPRPGWVELDPEVLWSQFVGVIKEAVQAAGLHMRQVAALGISTQRSTFITWHKRTGKPFHNFISWQDLRSAELVNSWNRSLLLKVIHVIFTVLHFFTGNDRYLAPSVLTFSTQQTSMKLSWVFKNIPEADEAAKKNNCCFGTVDTWLLYRLTKGSVFATDYSNASSTGVFEPFTKCWNPTLCHLLSIPMSIYPPVKDTSFNFGSADSEIF--GVPVPIMALVADQQSAMFGECCFQPGDVKLTMGTGGFWNVNTGGNLFASHKGLYPLIGWKIGEEVVYLTEGSMSNIGTTIKWAQDINLFTNVDETAKM----ARSIVD--SQGVCFVP---GFQVSANDPYLCASFMGLKPTTTRNHLVRAILESVAFRNKQLFDIIVKKVRIPLQTVRADGGVSNNSFVMQMTSDLINKKIEKPSNTDMSSLGAAFLAGLASGLWTDKEQLKKLRQIETVFEPQKDEKE-YKPAMDTWMRAVKCSLHW 517          
BLAST of Glycerol kinase vs. UniProt/SwissProt
Match: sp|Q08D86|GLPK5_BOVIN (Putative glycerol kinase 5 OS=Bos taurus OX=9913 GN=GK5 PE=2 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 9.967e-115
Identity = 195/517 (37.72%), Postives = 306/517 (59.19%), Query Frame = 2
Query:  101 SGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            +G+V+G+DVGSS+++C ++D+   I   S++++E   P  G  E+DP  LW+ F  V K+ +  + +    I  +GIS QR +F+ W++ T K     ISWQD+R++  VKSWN S  +K+I+ S ++ +F TR+ ++LAAS+  F +  VS+RL  +LQ+  ++         C+G ++TWLL  LT G EF+TD S AS TG++DP+   WS+ + +LL+IP  +LP VK+T  NFG    +    G+ IPI  ++ D QAA  G  CF  G+ K+T+GTG+FL+INTGN P  S+ G YP IGWK     +   E     TG+ I W + L+ F    E E++    +Q+ +D  S  V+FVP+F GLQ P+NDP A    +GL P+T K  +V A++E+I    + + + +Q+E  + ++ IR +G V +N +++Q  +++    I+     + SC GAA LAGL +G W    EL  + + + VF P+    E  +     W +A +RS NW
Sbjct:   18 AGFVLGVDVGSSMIRCHVYDRAARICGSSAQKVESLYPQPGWVEIDPDVLWLQFVAVIKESVKAAGIETNQIVGLGISTQRATFITWDKKTGKHFHNFISWQDLRATELVKSWNGSLLMKLIHSSCRVLHFFTRSKQFLAASLFTFTTQHVSLRLAWILQNLTEVQKAVEEENCCFGTVDTWLLHKLTKGSEFATDFSNASTTGLFDPYEMCWSKIVTSLLSIPLSLLPPVKDTSHNFGSVDEEIF--GVPIPIVALVADQQAAMFGECCFQTGDVKLTMGTGTFLDINTGNNPQQSVGGFYPLIGWKIGQEVVCLAESNAGDTGTAIEWAQQLDLFTDAAETEKM----AQSLED--SEGVYFVPSFSGLQAPLNDPCACASFMGLKPSTNKYHLVRAILESIAFRNKQLYETMQKEIHIPVRKIRADGGVCKNSFVMQMTSDLINETIDRPVHIDMSCSGAASLAGLAVGFWSDKEELKKLRQSEMVFKPQKKWQE-YEVNMGNWVKAVKRSMNW 525          
BLAST of Glycerol kinase vs. UniProt/SwissProt
Match: sp|Q8BX05|GLPK5_MOUSE (Putative glycerol kinase 5 OS=Mus musculus OX=10090 GN=Gk5 PE=2 SV=2)

HSP 1 Score: 349.362 bits (895), Expect = 4.681e-112
Identity = 186/518 (35.91%), Postives = 295/518 (56.95%), Query Frame = 2
Query:  101 SGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTG-NIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            S +V+G+DVGS++++C ++D+   ++  S++++E   P  G  E+DP  LW  F  V KD +  + + +  I  +GIS QR +F+ W + T       ISWQD+R++  VKSWN S  +K+++ ++++ +F +R+   L  S  NF +   ++RL  +LQ+  ++         C+G I+TWLL+ LT G  ++TD S AS TG +DP+   WS  I  +++IP  ILP VK+T  NFG         G+ IP+  ++GD Q+A  G  CF  G+ K+T+GTG+FL+INTG N+ HV+  G YP IGWK     +   EG    TG+ I W + L+ F    E E++ +S         S  V+FVP+F GLQ P+NDP A    +GL  +T K  +V A++E+I    + + D +Q+E  + + +IR +G V  N +++Q  +++   KI+     + SC GAA LAGL +G W    EL  + + + VF P+    E  +     W +A +RS NW
Sbjct:   23 SRFVLGLDVGSTVIRCHVYDQTARVRGSSAQKVENVYPQPGWVEIDPDSLWAQFVAVIKDAVKAAGVQMNQIVGLGISTQRATFITWNKKTGHHFHNFISWQDLRAAELVKSWNNSLIMKLLHGATRVLHFFSRSKVMLTVSRFNFSTQHATLRLTWILQNLSEVKRAVEEDNCCFGTIDTWLLYKLTKGSSYATDYSNASTTGFFDPYAMRWSRLITTMVSIPLSILPPVKDTSYNFGSVDEKIF--GVPIPVVALVGDQQSAMFGECCFETGDVKLTMGTGTFLDINTGKNLQHVN-GGFYPLIGWKIGQELVCLAEGNAGDTGTAIMWAQKLDLFTDAAETEKMALSLED------SEGVYFVPSFSGLQAPLNDPCACASFMGLKHSTNKYHLVRAILESIAFRNKQLYDMLQREIQIPVTNIRADGGVCNNAFVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVGFWADKEELQKLRQSEMVFKPQKKWQE-YEVNMENWVKAVKRSMNW 530          
BLAST of Glycerol kinase vs. UniProt/SwissProt
Match: sp|Q6ZS86|GLPK5_HUMAN (Putative glycerol kinase 5 OS=Homo sapiens OX=9606 GN=GK5 PE=2 SV=2)

HSP 1 Score: 348.977 bits (894), Expect = 5.448e-112
Identity = 184/516 (35.66%), Postives = 294/516 (56.98%), Query Frame = 2
Query:  104 GYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            G+V+G+DVGSS+++C ++D+   +   S +++E   P  G  E+DP  LW+ F  V K+ +  + + +  I  +GIS QR +F+ W + T       ISWQD+R+   VKSWN S  +KI + S ++ +F TR+ R   AS+  F +   S+RL  +LQ+  ++         C+G I+TWLL+ LT G  ++TD S AS TG++DP+   WS  I +L++IP  +LP V++T  NFG    +    G+ IPI  ++ D Q+A  G  CF  G+ K+T+GTG+FL+INTGN    +  G YP IGWK     +   E     TG+ I W + L+ F    E E++    +++ +D  S  V FVP+F GLQ P+NDP A    +GL P+T K  +V A++E+I    + + + +++E  + ++ IR +G V +N +++Q  +++    I+   + + SC GAA LAGL +G W    EL  + + + VF P+    E  +     W +A +RS NW
Sbjct:   19 GFVLGLDVGSSVIRCHVYDRAARVCGSSVQKVENLYPQIGWVEIDPDVLWIQFVAVIKEAVKAAGIQMNQIVGLGISTQRATFITWNKKTGNHFHNFISWQDLRAVELVKSWNNSLLMKIFHSSCRVLHFFTRSKRLFTASLFTFTTQQTSLRLVWILQNLTEVQKAVEEENCCFGTIDTWLLYKLTKGSVYATDFSNASTTGLFDPYKMCWSGMITSLISIPLSLLPPVRDTSHNFGSVDEEIF--GVPIPIVALVADQQSAMFGECCFQTGDVKLTMGTGTFLDINTGNSLQQTTGGFYPLIGWKIGQEVVCLAESNAGDTGTAIKWAQQLDLFTDAAETEKM----AKSLED--SEGVCFVPSFSGLQAPLNDPWACASFMGLKPSTSKYHLVRAILESIAFRNKQLYEMMKKEIHIPVRKIRADGGVCKNGFVMQMTSDLINENIDRPADIDMSCLGAASLAGLAVGFWTDKEELKKLRQSEVVFKPQKKCQE-YEMSLENWAKAVKRSMNW 525          
BLAST of Glycerol kinase vs. TrEMBL
Match: H3AHT7 (Glycerol kinase 5 OS=Latimeria chalumnae OX=7897 GN=GK5 PE=3 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 3.205e-127
Identity = 210/534 (39.33%), Postives = 317/534 (59.36%), Query Frame = 2
Query:   62 YCLINILNKMESESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNTSV 1663
            Y + +  N    +  Y++GID+GS+ +KC I+D    IK  S+K IE+  P  G  ELDP+ LW  F  V K+ +  S LS+++I  +GIS QR +F+ W + T +     ISWQD R++  VK+WN S+ LK+++ SSK+ YF+TR  R+L+ S++ F +  VS+RL  +LQ+   +   A  G  C+G I+TWLL+ LT G  F+TD S AS TGI+DP+   WS  + +LL+IP  I P V++T   FG T       G+ IP+  ++ D Q+A  G  CF+ G+ K+T+GTG+F++INTG+ PH S+ GLYP +GWK     ++  EG    TG+ I W + +E F    E E L    +++ +D  S  V FVPAF GLQ P+NDP A    +GL P+T K  +V A++E+I    + + + + +ET + L SIR +G V  N +I+Q  +N+   KI+     + SC GA +LAGL IG W +  EL  + +++ VF P  +  +  +    KW EA  RS +W + +
Sbjct:   10 YSMGSRRNGYSKDGNYILGIDIGSTAIKCHIYDSQAKIKGSSTKSIELLYPKPGWVELDPEDLWDHFVTVIKETVQASNLSMKEIATLGISTQRATFITWNKKTGETFHNFISWQDRRAADLVKAWNYSFTLKVLHGSSKVLYFLTRASRFLSGSVITFSTQHVSLRLAWVLQNMKNVREAAEKGNCCFGTIDTWLLYKLTKGAVFATDYSNASTTGIFDPYQMCWSRLLTSLLSIPMSIFPPVEDTSHYFGSTEVSIF--GVPIPVTALVADQQSAMFGECCFDIGDVKLTIGTGTFMDINTGSKPHASLAGLYPLVGWKFGDEIVFLAEGNAADTGTAIKWAQEIELFSNATETEIL----AESVQD--SDGVCFVPAFNGLQAPLNDPLACASFMGLKPSTTKNHLVRAILESIAFRNKQLYETMLKETSVPLGSIRADGKVCSNSFIMQLTSNLFGKKIDRPKHVDMSCLGATFLAGLAIGFWATKEELRKLRQVEKVFKP--NNVKDYEPIMDKWLEALNRSMHWYSKI 533          
BLAST of Glycerol kinase vs. TrEMBL
Match: A0A452J3R0 (Glycerol kinase 5 OS=Gopherus agassizii OX=38772 GN=GK5 PE=3 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 6.497e-123
Identity = 203/515 (39.42%), Postives = 305/515 (59.22%), Query Frame = 2
Query:  107 YVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            YVVG+DVGS+ L+C ++DK   I+  SSK++E   P  G  ELDP+ LW  F +V K+ +  + L +  I  +GIS QR +F+ W + T KP    ISWQD+R+++ V SWN+S  LK+I+  S + +F+T + RY+ AS L F +  VS+RL  +LQ+  ++   A     C+G I+TWLL+ LT G  ++TD S AS TG++DPF   WS  +  L +IP  I P V++T  +FG    +    G+ IPI  ++ D QAA  G  CF++G+ K+T+GTG F ++NTGN  H    GLYP IGWK     ++  EG     GSTI W + L+ F + DE  R+    +++  D  S  V FVP+F GLQVP+NDP A    +GL P+T +  ++ A++E+I    + + D + +E  + L +IR +G V+ N +I+Q  +++   KI+    T+ SC GAA+LAGL +G W    +L  + + + VF P+   S +       W +A QRS NW
Sbjct:   17 YVVGVDVGSTTLRCHVYDKKAAIRGSSSKKVETLYPHLGWVELDPEVLWTQFMDVIKEAVQAAGLQMNQIAGLGISTQRGTFITWNKKTGKPFHNFISWQDLRAAALVNSWNRSLILKVIHVISTMLHFLTWSDRYVIASSLTFTTHHVSLRLSWVLQNITEVQQAANENNCCFGTIDTWLLYKLTKGSVYATDYSNASSTGVFDPFQMCWSSVLSKLFSIPMSIYPPVEDTNHSFGSVDAEIF--GVPIPIAALVADQQAAMFGECCFHEGDVKLTMGTGIFWDVNTGNHLHTPSSGLYPLIGWKIGKEVVFLAEGNASDAGSTIKWAKELDLFTSVDETARM----ARSVVD--SEGVCFVPSFSGLQVPVNDPCACASFMGLKPSTTRNHLIRAMLESIAFRNKQLYDTIVKEVRVPLTNIRTDGGVSNNSFIMQMTSDLINKKIDKPVNTDMSCLGAAFLAGLALGFWTDKEQLKKLRRTEIVFEPQRD-SGEYKLAMDNWTKAVQRSLNW 522          
BLAST of Glycerol kinase vs. TrEMBL
Match: A0A5A9PAS1 (Putative glycerol kinase 5 OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti007624 PE=3 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 1.364e-122
Identity = 201/528 (38.07%), Postives = 306/528 (57.95%), Query Frame = 2
Query:   83 NKMESESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISE-----KLDKKFVKWKEACQRSRNW 1651
            N    +  +V+ +DVG++ ++C ++DK  NI+   S ++ +  P  G  E+DP++LW  F  V K  +  S L +  ++ +GIS QR +FL WER+T KP    I+WQD+R++   +SWN+S  +K+++  +K+ +F+TR  R+LAAS++ F +  VS+RL   L + P+L      G   +G I+TWLL+ LT G   +TD S AS TGI+D +   WS  + +LL+IP  ILP+V+NT   FG         G+ IPI C++ D QAA  G  CF+ G+ KIT+GTG+F++INTGN PH S+ GLYP +GWK     ++  EG    TG+ I W ++LE F    E E +  S +       S  V+FVP+F GLQ P+NDP A    +GL P+T K  +V A++E+I    + + D +  ET + +  IR +G V  N +I+Q  +++   KI      + SC GAA++AGL  G W++  EL  +   D  F P+ + SE     +       W+ A QRS +W
Sbjct:    6 NGFSKKETFVLSVDVGTTSVRCHVYDKCANIRGSCSSKVSLLYPQPGWAEIDPEELWKGFVTVVKGAVQDSGLQMCQMEGLGISTQRATFLTWERNTGKPFHNFITWQDLRAAELARSWNRSCTMKMVHGVTKMLHFLTRQKRFLAASLVVFSTQHVSLRLVWALNNIPQLRQAVEDGTCYFGTIDTWLLYKLTKGAVHATDFSNASATGIFDSYQMCWSGFLCSLLSIPLSILPKVQNTSHKFGSCDPSIF--GVPIPIMCVMADQQAAMFGECCFDIGDVKITMGTGTFMDINTGNKPHTSVAGLYPLVGWKIGADVVFLAEGNAAGTGAAIKWAQDLELFTDVKETEAIATSVAD------SDGVYFVPSFSGLQAPLNDPKACASFMGLKPSTTKSHLVRAILESIAFRNKQLYDIMLGETHIPITKIRADGGVCTNDFIMQLTSDLLGRKIARPNHFDMSCLGAAFVAGLGTGYWRNQEELKKIQSTDQHFNPQRNKSEGDKGGQYRSVLQSWERALQRSMHW 525          
BLAST of Glycerol kinase vs. TrEMBL
Match: A0A452J3Q6 (Glycerol kinase 5 OS=Gopherus agassizii OX=38772 GN=GK5 PE=3 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 5.327e-122
Identity = 204/515 (39.61%), Postives = 305/515 (59.22%), Query Frame = 2
Query:  107 YVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            YVVG+DVGS+ L+C ++DK   I+  SSK++E   P  G  ELDP+ LW  F +V K+ +  + L +  I  +GIS QR +F+ W + T KP    ISWQD+R+++ V SWN+S  LK+I+  S + +F+T + RY+ AS L F +  VS+RL  +LQ+  ++   A     C+G I+TWLL+ LT G  ++TD S AS TG++DPF   WS  +  L +IP  I P V++T  NFG    +    G+ IPI  ++ D QAA  G  CF++G+ K+T+GTG F ++NTGN  H    GLYP IGWK     ++  EG     GSTI W + L+ F + DE  R+    +++  D  S  V FVP+F GLQVP+NDP A    +GL P+T +  ++ A++E+I    + + D + +E  + L +IR +G V+ N +I+Q  +++   KI+    T+ SC GAA+LAGL +G W    +L  + + + VF P+   S +       W +A QRS NW
Sbjct:   23 YVVGVDVGSTTLRCHVYDKKAAIRGSSSKKVETLYPHLGWVELDPEVLWTQFMDVIKEAVQAAGLQMNQIAGLGISTQRGTFITWNKKTGKPFHNFISWQDLRAAALVNSWNRSLILKVIHVISTMLHFLTWSDRYVIASSLTFTTHHVSLRLSWVLQNITEVQQAANENNCCFGTIDTWLLYKLTKGSVYATDYSNASSTGVFDPFQMCWSSVLSKLFSIPMSIYPPVEDT--NFGSVDAEIF--GVPIPIAALVADQQAAMFGECCFHEGDVKLTMGTGIFWDVNTGNHLHTPSSGLYPLIGWKIGKEVVFLAEGNASDAGSTIKWAKELDLFTSVDETARM----ARSVVD--SEGVCFVPSFSGLQVPVNDPCACASFMGLKPSTTRNHLIRAMLESIAFRNKQLYDTIVKEVRVPLTNIRTDGGVSNNSFIMQMTSDLINKKIDKPVNTDMSCLGAAFLAGLALGFWTDKEQLKKLRRTEIVFEPQRD-SGEYKLAMDNWTKAVQRSLNW 526          
BLAST of Glycerol kinase vs. TrEMBL
Match: A0A452J3P6 (Glycerol kinase 5 OS=Gopherus agassizii OX=38772 GN=GK5 PE=3 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 6.717e-122
Identity = 203/515 (39.42%), Postives = 305/515 (59.22%), Query Frame = 2
Query:  107 YVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            YVVG+DVGS+ L+C ++DK   I+  SSK++E   P  G  ELDP+ LW  F +V K+ +  + L +  I  +GIS QR +F+ W + T KP    ISWQD+R+++ V SWN+S  LK+I+  S + +F+T + RY+ AS L F +  VS+RL  +LQ+  ++   A     C+G I+TWLL+ LT G  ++TD S AS TG++DPF   WS  +  L +IP  I P V++T  +FG    +    G+ IPI  ++ D QAA  G  CF++G+ K+T+GTG F ++NTGN  H    GLYP IGWK     ++  EG     GSTI W + L+ F + DE  R+    +++  D  S  V FVP+F GLQVP+NDP A    +GL P+T +  ++ A++E+I    + + D + +E  + L +IR +G V+ N +I+Q  +++   KI+    T+ SC GAA+LAGL +G W    +L  + + + VF P+   S +       W +A QRS NW
Sbjct:   53 YVVGVDVGSTTLRCHVYDKKAAIRGSSSKKVETLYPHLGWVELDPEVLWTQFMDVIKEAVQAAGLQMNQIAGLGISTQRGTFITWNKKTGKPFHNFISWQDLRAAALVNSWNRSLILKVIHVISTMLHFLTWSDRYVIASSLTFTTHHVSLRLSWVLQNITEVQQAANENNCCFGTIDTWLLYKLTKGSVYATDYSNASSTGVFDPFQMCWSSVLSKLFSIPMSIYPPVEDTNHSFGSVDAEIF--GVPIPIAALVADQQAAMFGECCFHEGDVKLTMGTGIFWDVNTGNHLHTPSSGLYPLIGWKIGKEVVFLAEGNASDAGSTIKWAKELDLFTSVDETARM----ARSVVD--SEGVCFVPSFSGLQVPVNDPCACASFMGLKPSTTRNHLIRAMLESIAFRNKQLYDTIVKEVRVPLTNIRTDGGVSNNSFIMQMTSDLINKKIDKPVNTDMSCLGAAFLAGLALGFWTDKEQLKKLRRTEIVFEPQRD-SGEYKLAMDNWTKAVQRSLNW 558          
BLAST of Glycerol kinase vs. Ensembl Cavefish
Match: gk5 (glycerol kinase 5 [Source:NCBI gene;Acc:777765])

HSP 1 Score: 324.709 bits (831), Expect = 4.966e-104
Identity = 183/528 (34.66%), Postives = 280/528 (53.03%), Query Frame = 2
Query:   83 NKMESESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVK-----WKEACQRSRNW 1651
            N        V+ +DVG++ ++C ++DK+  I+   +K++ +  P  G  E+DP++LW  F  V K  +  S L +  ++AIGIS QR                                        ++   K+ +F+TR  R+LAAS++ F    VS+RL   LQ+ P+L      G   +G I+TWLL+ LT G   +TD S AS T I+D +   WS  + +LL++P  I P+V+NT  NFG +     G  + IPI  ++ D QAA  G  CF+ G+ KIT+GTG+F++INTGN PH S+ GLYP +GWK  +  +Y  EG    TG+ I W + +E F   D  + +++++S    D V     FVP+F GLQ P+NDP A    +GL P+T K  +V A++E+I    + + D + +ET + +  IR +G V  N +I+Q   ++   KI      + SC GAA++AGL +G WKS  EL  +   D +F P+    +  +    K     W+EA QRS +W
Sbjct:    6 NGFSKRESCVLSVDVGTTSIRCHVYDKVAKIRGSCTKKVSLLYPEPGRVEMDPEELWQGFVSVVKGAVQDSGLEMSQMEAIGISTQR---------------------------------------AVHGVMKMLHFLTRRKRFLAASLVVFTPQHVSLRLLWALQNLPQLRQAVDEGTCLFGTIDTWLLYKLTKGLVHATDYSNASSTAIFDSYQMCWSGFLCSLLSLPLSIFPKVQNTSHNFGSSDPSIFG--VPIPIMSVMADQQAAMFGECCFHTGDVKITMGTGTFMDINTGNKPHTSVAGLYPLVGWKIGSEVVYLAEGNAAGTGTAIKWAQEIELFS--DVKDTVVMANSVKDSDGVC----FVPSFSGLQAPLNDPKACAAFMGLKPSTTKSHLVRAILESIAFRNKQLFDVMLRETRIPITKIRADGGVCTNDFIMQLTTDLLGRKISRPAHFDMSCLGAAFVAGLGVGYWKSKEELKKLQMTDRLFLPQCGKGDCCNGAVYKPVLQNWEEALQRSMHW 486          
BLAST of Glycerol kinase vs. Ensembl Cavefish
Match: gk5 (glycerol kinase 5 [Source:NCBI gene;Acc:777765])

HSP 1 Score: 292.352 bits (747), Expect = 1.505e-91
Identity = 181/528 (34.28%), Postives = 279/528 (52.84%), Query Frame = 2
Query:   83 NKMESESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVK-----WKEACQRSRNW 1651
            N        V+ +DVG++ ++C ++DK+  I+   +K++ +  P  G  E+DP++LW  F  V K  + +S L +  ++AIGIS QR +F  W+                                 ++   K+ +F+TR  R+LAAS++ F    VS+RL   LQ+ P+L      G   +G I+TWLL+ LT     +TD S AS T I+D +   WS  + +LL++P  I P+V+NT  NFG +     G  + IPI  ++ D QAA  G  CF+ G+ KIT+GTG+F++INTGN PH S+  LYP +GWK  +  +Y  EG    TG+ I W + + F    D      +  + + KD  S  V FVP+F GLQ P+NDP A    +GL P+T K  +V A++E+I  + + + D + +ET + +  I  +G V  N +I+Q   ++   KI      + SC GAA++AGL +  WKS  EL  +   D +F P+    +  +    K     W+EA QRS +W
Sbjct:    6 NGFSKRESCVLSVDVGTTSIRCHVYDKVAKIRGSCTKKVSLLYPEPGRVEMDPEELWQGFVSVVKGAV-QSGLEMSQMEAIGISTQRATFTTWD--------------------------------AVHGVMKMLHFLTRRKRFLAASLVVFTPQHVSLRLLWALQNLPQLRQAVDEGTCLFGTIDTWLLYKLTKLVH-ATDYSNASSTAIFDSYQMCWSGFLCSLLSLPLSIFPKVQNT-HNFGSSDPSIFG--VPIPIMSVMADQQAAMFGECCFHTGDVKITMGTGTFMDINTGNKPHTSV-ALYPLVGWKIGSEVVYLAEGNAAGTGTAIKWAQEILFSDVKDT-----VVMANSVKD--SDGVCFVPSFSGLQAPLNDPKACAAFMGLKPSTTKSHLVRAILESIAFN-KQLFDVMLRETRIPITKI-ADGGVCTNDFIMQLTTDLLGRKISRPAHFDMSCLGAAFVAGLGV-YWKSKEELKKLQMTDRLFLPQCGKGDCCNGAVYKPVLQNWEEALQRSMHW 485          
BLAST of Glycerol kinase vs. Ensembl Cavefish
Match: zgc:172295 (pep primary_assembly:Astyanax_mexicanus-2.0:12:17081319:17102457:1 gene:ENSAMXG00000005230.2 transcript:ENSAMXT00000005352.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:zgc:172295)

HSP 1 Score: 185.652 bits (470), Expect = 2.309e-51
Identity = 136/453 (30.02%), Postives = 230/453 (50.77%), Query Frame = 2
Query:  110 VVGIDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVF-KDC--ITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASI-LNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANI 1435
            V  ID G+S  +  +F+ K   + S    EI+ + P +G  E DPK++     E   + C  +T+  + + +IKAIG++ QR + L+W++ T +P+   I W D+R+ S+V+        ++IN +        RN  +L     L   +   +++L  L+ +  +++    +    +G I++WL+WCLT GK+     TD + AS T +++  T  W   +    +IP EILP+V+++ + +G   +  L G   +PI   +GD  AA VG  CF  G+ K    T   + +     P +S  GL   + +K        Y +E      G+ + WL+ NL   +T  ELE+L  S         S   +FVPAF GL  P  +P+A G++ GL   T K  + FA +EA+    R ILDA+ Q++G+ L  ++V+G +  N+ ++Q  A+I
Sbjct:   14 VAAIDQGTSSTRFLVFNAKTAELLSHHQVEIQQSFPKEGWVEEDPKEILQSVYECMDRTCEKLTQLNIDISNIKAIGVTNQRETTLVWDKETGEPLYNAIVWLDLRTQSTVE--------RLINKTPG------RNKNHLKHKTGLPISTYFSAVKLRWLMDNVDEVHKAVLSHRAMFGTIDSWLIWCLTGGKKGGVHCTDVTNASRTMLFNIHTMDWDPDLCKYFDIPMEILPKVRSSSEIYGLMKSGALTG---VPISGCLGDQSAALVGQMCFQDGQAK---NTSKCILLFFVLQPVMSDHGLLTTVAYKLGRDKPACYALE-----LGAVVRWLKDNLGIIQTSTELEKLAASVG------TSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKSHLAFAALEAVCFQTREILDAMNQDSGIPLNQLQVDGGMTSNRLLMQLQADI 435          
BLAST of Glycerol kinase vs. Ensembl Cavefish
Match: ENSAMXT00000050907.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001506.1:29570:99220:1 gene:ENSAMXG00000035717.1 transcript:ENSAMXT00000050907.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.576 bits (340), Expect = 9.423e-35
Identity = 93/304 (30.59%), Postives = 154/304 (50.66%), Query Frame = 2
Query:  320 AIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGL 1213
            A+G++ QR + ++W++ T KP+   I W D+R+ ++VKS  +    K  NH           +++     L   +   +++L  L+ +  ++     A    +G +++WL+WCLT G+      TD + AS T +++  T  W E +    ++P EILP+V+++ + +G  S+  L G   +PI   +GD  AA VG  CF  G+ K T GTG F+  NTG  P +S  GL   + +K      T Y +EG     G+ + WL+ NL   K+  ++E L  +         S   +FVPAF GL
Sbjct:   36 ALGVTNQRETTIVWDKETGKPLYNAIVWLDLRTQTTVKSLIEKTPGKNKNH-----------LKHKTG--LPISTYFSALKLRWLMDNVGEVAEAVDARRAIFGTVDSWLIWCLTGGQNGGVHCTDVTNASRTMLFNIDTMKWDEELCKYFDVPIEILPQVRSSSEIYGYMSSGSLAG---VPISGCLGDQSAALVGQMCFKDGQAKNTYGTGCFMLKNTGTKPVMSDHGLLTTVAYKLGRDQPTYYALEGSVAIAGAVVRWLKDNLGIIKSSSDIENLAAAAG------TSYGCYFVPAFSGL 317          
BLAST of Glycerol kinase vs. Ensembl Cavefish
Match: ENSAMXT00000032765.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001506.1:29570:99409:1 gene:ENSAMXG00000035717.1 transcript:ENSAMXT00000032765.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.806 bits (338), Expect = 2.466e-34
Identity = 93/304 (30.59%), Postives = 152/304 (50.00%), Query Frame = 2
Query:  320 AIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGL 1213
            A+G++ QR + ++W++ T KP+   I W D+R+ ++VKS  +    K  NH                 + L   +   +++L  L+ +  ++     A    +G +++WL+WCLT G+      TD + AS T +++  T  W E +    ++P EILP+V+++ + +G  S+  L G   +PI   +GD  AA VG  CF  G+ K T GTG F+  NTG  P +S  GL   + +K      T Y +EG     G+ + WL+ NL   K+  ++E L  +         S   +FVPAF GL
Sbjct:   36 ALGVTNQRETTIVWDKETGKPLYNAIVWLDLRTQTTVKSLIEKTPGKNKNHLKH-------------KTGLPISTYFSALKLRWLMDNVGEVAEAVDARRAIFGTVDSWLIWCLTGGQNGGVHCTDVTNASRTMLFNIDTMKWDEELCKYFDVPIEILPQVRSSSEIYGYMSSGSLAG---VPISGCLGDQSAALVGQMCFKDGQAKNTYGTGCFMLKNTGTKPVMSDHGLLTTVAYKLGRDQPTYYALEGSVAIAGAVVRWLKDNLGIIKSSSDIENLAAAAG------TSYGCYFVPAFSGL 317          
BLAST of Glycerol kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007993.1 (pep scaffold:Pmarinus_7.0:GL477962:41173:55973:-1 gene:ENSPMAG00000007173.1 transcript:ENSPMAT00000007993.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.481 bits (441), Expect = 2.126e-48
Identity = 121/392 (30.87%), Postives = 195/392 (49.74%), Query Frame = 2
Query:  530 LNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFL--GGGLS-IPICCI----IGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEAC---TETEASCCGAAYLAGL--NIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            L   +   ++++  LL +   +      G   +G +++WL+W LT GK      TD + AS T +++  T  W   +     IP +ILP V+++ + +G    D     G LS +PI  +    +GD  AA VG  C + G+ K T GTG FL  NTG  P +S  GL   + +K      T Y +EG     G+ ++WLR NL   +T  ++E++            S   +FVPAF GL  P  +P+A G++ GL   T K  I FA +EAI    R ++DA+ Q++G  L +++V+G +  N+ ++Q  A+I  + +      T  E +  GAA  AG    +G+W   LE  D+  +    F     +E+   ++++WK+A Q S  W
Sbjct:   32 LPISTYFSAVKMRWLLDNSDAVKLAVAEGRALFGTVDSWLIWNLTGGKHGGVHCTDVTNASRTMLFNIHTQEWDPELCRFFEIPSDILPRVRSSSEIYGLLKLDPTTKSGPLSGLPISGLRGQCLGDQSAALVGQMCLSDGQAKNTYGTGCFLLHNTGTKPVLSEHGLLTTVAYKLGRDKPTYYALEGSVAIAGAMVSWLRDNLGIIQTAADIEKM------AQLAGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKSHIAFAALEAICFQTRELIDAMNQDSGYVLTALQVDGGMTVNRVLMQLQADILSIPVAGAVRPTMPETTALGAAMAAGSAEGVGVWS--LEADDLTAVTVERFEPQINTEESQVRYMRWKKAVQCSMGW 415          
BLAST of Glycerol kinase vs. Ensembl Sea Lamprey
Match: fggy (FGGY carbohydrate kinase domain containing [Source:NCBI gene;Acc:406567])

HSP 1 Score: 69.707 bits (169), Expect = 5.715e-13
Identity = 52/212 (24.53%), Postives = 103/212 (48.58%), Query Frame = 2
Query: 1040 MYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKD-----------------DVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIV---FAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLE-LSDVCKIDSVFFPEYHISEKLDKKF 1612
            ++  EG   +TGS I  +  +     Y+EL+++  +  Q+T +                  +++D+H  P F G + P+ D +  GM+IGL+ +   +S+V    A ++A+ +  R IL+A+ Q +G  + +I + G +++N   +Q  A+ T L +    E EA   GAA L       + S+ E +  + ++  V  P+  +    ++K+
Sbjct:  168 LWLNEGGQSATGSLIEHI--VTGHPAYNELKKIADASGQSTYEWLNRRVVSMATEGAAPATLTSDLHVCPDFHGNRSPLADSSRKGMVIGLDLSHTCDSLVQLYLATLQALALGTRHILNAMTQ-SGHNVSAIFMCGGLSKNSLYVQAHADATGLPVVLPAEAEAVVVGAAILGACASKDFTSMQEAMQHMVRVGKVIHPDPAVRSFYERKY 376          
BLAST of Glycerol kinase vs. Ensembl Yeast
Match: GUT1 (Glycerol kinase; converts glycerol to glycerol-3-phosphate; glucose repression of expression is mediated by Adr1p and Ino2p-Ino4p; derepression of expression on non-fermentable carbon sources is mediated by Opi1p and Rsf1p [Source:SGD;Acc:S000001024])

HSP 1 Score: 129.798 bits (325), Expect = 5.340e-32
Identity = 151/593 (25.46%), Postives = 244/593 (41.15%), Query Frame = 2
Query:  155 FDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKA--------------IGISVQRNSFLLWERHTSKPITPI-ISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSI-RLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEI--LPEVKNTIDNFGRTS-TDFLGGGL--------------SIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGL-------YPEI----GWKTKTTTMYF-VEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQET---GMK-----------------LKSIRVNGSVARNKWILQRLANITK--LKIEACTETEASCCGAAYLAGLNIG------IWKSLLELSDVCKIDSVFF----------PEYHISEKL----------DKKFVKWKEACQRSRNW 1651
            F K+  +  D   E  +  P  G  E  P+KL V+  +    C+  S LSLQ I +              +GI+  R + +LW R T KPI    I W D R+            +KI+    +    + R ++    + L   S+  S  +L   L ++P         ++ +G ++TWL++ LT  K F +D + AS TG  +  T  +   ++    I K +  +PE+ ++   +G     D++   L              ++PI   +GD  A+ VG   +  G  K T GTG FL  NTG    +S  G        +P +    G K + +  +F +EG     G+ + WLR NL      +++  +      +T  D S  V FVPAF GL  P  DP A   ++G++  T    I  A +E +    R IL A+  +    G K                 L  + V+G ++R+  ++Q  A+I    +K+      E +  GAA  A +         +WK   +L DV K   VF+          PE H + K+           K +  W+ A +RS+ W
Sbjct:  129 FLKIEELDLDFHNEPTLKFPKPGWVECHPQKLLVNVVQ----CLASSLLSLQTINSERVANGLPPYKVICMGIANMRETTILWSRRTGKPIVNYGIVWNDTRT------------IKIVRDKWQNTS-VDRQLQLRQKTGLPLLSTYFSCSKLRWFLDNEPLCTKAYEENDLMFGTVDTWLIYQLTKQKAFVSDVTNASRTGFMNLSTLKYDNELLEFWGIDKNLIHMPEIVSSSQYYGDFGIPDWIMEKLHDSPKTVLRDLVKRNLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTGTKKLISQHGALTTLAFWFPHLQEYGGQKPELSKPHFALEGSVAVAGAVVQWLRDNLRLIDKSEDVGPI-----ASTVPD-SGGVVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIARAAVEGVCFQARAILKAMSSDAFGEGSKDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALGAAIAANMAFKDVNERPLWK---DLHDVKKW--VFYNGMEKNEQISPEAHPNLKIFRSESDDAERRKHWKYWEVAVERSKGW 693          
BLAST of Glycerol kinase vs. Ensembl Nematostella
Match: EDO39329 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA94])

HSP 1 Score: 332.028 bits (850), Expect = 6.513e-107
Identity = 182/516 (35.27%), Postives = 299/516 (57.95%), Query Frame = 2
Query:  110 VVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSAD-VHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMK-LKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNW 1651
            ++ +DVG++++ C +FDK G  K ++S+++++  P  G  E++P +LW  FQ+V  + +    L+ + + A+GIS QR +F+ W+R T +P    I+WQD+R+S    SWN+S  LK ++  SK  + ++R  +YLA S++NF ++ VS+RL+ L +S P+L+ +A  G + +G I+TWL+W LT  +   TD S AS TG++DPF   WS  + ++ +IP  I P++ +T      T+ D  G    IPI  ++ D Q A  G  CF+ G+ K T+GTG+F+++NTG+ PHVS                   V G N   GS    L+ ++ FK +      + S S       S+D + FVPAF GLQ P+ND  A   L+G+  +T K  IV A++E+I      + D V +ET +  + SI+ +G V  N ++++  +++T   ++  ++T+ S  GAA+LAG+  G+WKS  EL  +    ++F P+  I  K  K + +WKEA  RS++W
Sbjct:   17 IIAVDVGTTLITCHLFDKTGLSKYNTSRKVQLLYPKPGWVEIEPYQLWEQFQDVLTEVMEAENLAPEQVTALGISTQRGTFVTWDRKTGRPQHNFITWQDLRASDHTDSWNKSLTLKGLHAGSKFLHMVSRRKQYLAGSVVNFSTAQVSMRLHHLFKSHPELHKKAENGSLLFGTIDTWLVWKLTRNRYHITDYSNASSTGLFDPFVMEWSSLLGSMFSIPLNIFPKLVDTSGIICDTAKDIFGA--PIPIRSLVADQQGAMFGQCCFDVGDVKCTMGTGTFVDVNTGSQPHVS-------------------VAGKNEHNGSCFISLQFIK-FKCFTGFFTDVASTSNMAFSVESSDGLCFVPAFHGLQAPVNDNKACTSLMGIKASTTKAHIVRAILESIAFRFVQLYDTVVEETQVPIMSSIKTDGGVCNNDFVMELTSSLTGQSMDRPSQTDMSVLGAAFLAGMATGVWKSREELRAIRCTHALFQPKSSIRTKYAKSYEQWKEAVHRSKSW 510          
BLAST of Glycerol kinase vs. Ensembl Nematostella
Match: EDO35639 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKX9])

HSP 1 Score: 204.527 bits (519), Expect = 1.592e-58
Identity = 162/522 (31.03%), Postives = 258/522 (49.43%), Query Frame = 2
Query:  104 GYVVG-IDVGSSILKCQIF-DKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQ---LSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLT---DGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACT--ETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDS-VFFPEYHISEKLDKKFVKWKE 1627
            G +VG ID G+S  +  +F      + +    E +   P +G  E DPK L     +  +  +   +   ++  DIKA+GI+ QR + ++W++ T +P+   I W D R+ S+V         KI++ +SK       N+R +    +N   S V +R   L+ +   +      G   +G +++WLLW +T   +G +  TD + AS T + +  T  W   +    ++P  +LP +K++ + +G+     L G    PI  ++GD QAA VG  CF +GE K T GTG FL  NTG  P +S  GL   + +K      T Y +EG     G+ + WLR N++  +   E+E L  S         SA V+FVPAF GL  P     A G+++GL   T +  I  A +EA+    R +LDA+ ++ G+ L S+ V+G +  N+ ++Q  A+I  + +E  T  ET A     A  A   I +W   L   D  +I++ VF P    SE+ D+ F KWK+
Sbjct:    8 GPLVGAIDQGTSSSRFLLFASNTAELLAFHQVEFQSIYPKEGWVEQDPKTLLSSVYQCMEQTLQSCKELNINPTDIKAVGITNQRETTVVWDKVTGEPLHNAIVWLDTRTKSTVD--------KIVSKNSKSTL---ENVRSICGLPVNTYFSAVKLRW--LIDNSEPVRKAVDDGRCMFGTVDSWLLWNMTGGPNGGQHITDITNASRTMLLNLKTQEWDPYLCKFFDLPMSVLPTIKSSSEIYGKLCDGPLSG---TPISGVLGDQQAALVGQMCFRRGEAKNTYGTGCFLLYNTGIEPVLSHNGLLTTVAYKLGPDQPTFYALEGSVAIAGAAVQWLRDNMKLIENSSEIEALASSVP------TSAGVYFVPAFSGLYAPYWQMDARGVIVGLTQFTNRAHIARATLEAVCFQTRELLDAMNEDCGIPLASLLVDGGMTVNRLLMQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVWD--LNPEDKSQINTEVFDPAMDTSER-DRHFSKWKK 504          
BLAST of Glycerol kinase vs. Ensembl Nematostella
Match: EDO46944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNK8])

HSP 1 Score: 49.2914 bits (116), Expect = 4.315e-6
Identity = 50/218 (22.94%), Postives = 93/218 (42.66%), Query Frame = 2
Query: 1052 EGYNPSTGSTINWLRNLEFFKTYDEL-------------------ERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIV---FAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLE-LSDVCKIDSVFFPEYHIS---EKLDKKFVKWKE 1627
            EG   +TG  I+ +  +E    YD+L                   E+L      ++   ++   H +P F G + PI D    GM+ GLN +T  + +     A I+A+    R I+D++   +G  + ++ + G + +N   +Q  A+IT +      E ++   G+  L       + SL E +  +  + S+  P+  +    EK  K F+K + 
Sbjct:  330 EGGQTATGKLIDHM--IETHPCYDKLKEKAETSGISVYDLLNQQAEKLASERGLSSPAFLTCHFHMLPDFHGNRSPIADADMRGMVCGLNLSTSLDDLAIKYLASIQALAHGTRHIIDSMNV-SGHHVSTLFMCGGLTKNTLYVQVHADITGMPCVLPREEDSVLVGSGILGACAARDFSSLQEAMKAMTAVGSIVRPDPRLQKFYEKKHKVFLKMQR 544          
BLAST of Glycerol kinase vs. Ensembl Medaka
Match: gk5 (glycerol kinase 5 [Source:NCBI gene;Acc:101157006])

HSP 1 Score: 372.474 bits (955), Expect = 5.866e-122
Identity = 193/522 (36.97%), Postives = 300/522 (57.47%), Query Frame = 2
Query:  107 YVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFV----KWKEACQRSRNWNTS 1660
            +V+ +DVG++ ++C ++DK   I+   S+++    P +GH E+DP+ LW  F  V +  +T + + +  ++A+G+S QR +F  W+R T  P    ISWQD R++  V+SWN S  +K+I+   K+AYF+T+  RYLAAS++ F    V++RL  +LQ   ++      G  C+G I+TWLL+ LT G+  +TD S AS TGI+D +   WS  + +L+++P  I P V+NT  NFG       G    IPI  ++ D QAA  G  CFN G+ KIT+GTG+F++INTG+ PH S+ GLYP +GWK  +  +Y  EG    TG+ I W + LE F    +   +  S         S  V FVP+F GLQ P+NDP A   L+GL P++ K  ++ A++E++    + + + + +ET + + +IRV+G V+ N +++Q  A++   K+      E SC GAA +AGL  G W++  EL  +     VF P          ++     +W+ A QRS NW  S
Sbjct:   13 FVLSVDVGTTSIRCHVYDKEAKIRGSCSEKVVPLFPEEGHVEVDPEALWKSFISVVRGAVTDAGIRMHQVEALGMSTQRATFTTWDRKTGVPFHNFISWQDQRAADLVRSWNASCTMKVIHGLMKVAYFLTQQKRYLAASLIVFSPQHVTMRLLWVLQRCAQVRRACDEGTCCFGTIDTWLLYKLTKGRVHATDYSNASSTGIFDSYQMCWSGFLCSLVSLPLSIFPTVQNTSHNFGSIDPSIFGE--PIPIMSVMADQQAAMFGECCFNVGDVKITMGTGTFMDINTGSKPHTSVAGLYPVVGWKIGSEVVYLAEGNAADTGTAIRWAQELELFSDVSQTSSMAYSVPD------SDGVCFVPSFSGLQAPLNDPKACASLMGLRPSSTKSHLIRAILESVAFRNKQLYETMLRETNIPITNIRVDGGVSSNDFVMQLTADLFGRKLVRLQHREMSCLGAALVAGLGTGFWRTRDELRKLQSTGEVFLPRGAAMGGPQGEYAPVLQRWERALQRSMNWYKS 526          
BLAST of Glycerol kinase vs. Ensembl Medaka
Match: ENSORLT00000010126.2 (glycerol kinase-like [Source:NCBI gene;Acc:101157895])

HSP 1 Score: 230.335 bits (586), Expect = 9.473e-68
Identity = 161/528 (30.49%), Postives = 267/528 (50.57%), Query Frame = 2
Query:  110 VVGIDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQE-VFKDCITKSQLS--LQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLRN-LEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKI--EACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNT 1657
            V  +D G+S  +  +F+ K   + S    EI  + P +G  E DPK++     E + K C   SQL   +  +KA+G++ QR + L+W+R T +P+   I W D+R+ S+V+   +    +  NH           +++L    L   +   +++L  LL +  ++    R G   +G +++W++W LT G+     +TD S AS T +++  +  W   +    +IP EILP+V+++ + +G   +  L G   +PI   +GD  AA VG  CF +G+ K T GTG FL  NTG  P +S  GL   + +K        Y +EG     G+ + WL+N +   +T  E+E+L        +   S   +FVPAF GL  P  +P+A G++ GL   T K+ + FA +EA+    R ILDA+ Q++G+ L  +RV+G +  N+ ++Q  A+I  + +     +ET A     A  A   + +W   L    +  I S  F      E+ D +F +WK+A Q++ NW T
Sbjct:    5 VAAVDQGTSSTRVLVFNAKTAEVISQHQVEIRQSFPKEGWVEEDPKEIMQSVHECIEKTCEKLSQLKVDISRVKAVGVTNQRETTLVWDRATGEPLYNAIVWLDLRTQSTVERLIKKAPGENKNH-----------LKHLTG--LPISTYFSAVKLRWLLDNVDEVREAVRTGRALFGTVDSWIIWNLTGGRSGGVHATDVSNASRTMLFNIHSMEWDPELCRYFDIPMEILPDVRSSSEVYGWMKSGTLAG---VPISGCLGDQSAALVGQMCFEEGQAKNTYGTGCFLLQNTGCKPVMSNHGLLTTVAYKLGRHMPCCYALEGSVAIAGAVVQWLKNNMGMVQTSSEIEKLA------AEVGTSHGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKKHLAFAALEAVCFQTREILDAMNQDSGVPLTQLRVDGGMTTNRLLMQLQADILCIPVVRPTMSETTALGAAVAAGAAEGVDVWS--LSPGHLPLIKSETFQPQINPEESDFRFSRWKKAVQKAMNWET 508          
BLAST of Glycerol kinase vs. Ensembl Medaka
Match: ENSORLT00000010125.2 (glycerol kinase-like [Source:NCBI gene;Acc:101157895])

HSP 1 Score: 230.72 bits (587), Expect = 1.311e-67
Identity = 161/528 (30.49%), Postives = 267/528 (50.57%), Query Frame = 2
Query:  110 VVGIDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQE-VFKDCITKSQLS--LQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLRN-LEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKI--EACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNT 1657
            V  +D G+S  +  +F+ K   + S    EI  + P +G  E DPK++     E + K C   SQL   +  +KA+G++ QR + L+W+R T +P+   I W D+R+ S+V+   +    +  NH           +++L    L   +   +++L  LL +  ++    R G   +G +++W++W LT G+     +TD S AS T +++  +  W   +    +IP EILP+V+++ + +G   +  L G   +PI   +GD  AA VG  CF +G+ K T GTG FL  NTG  P +S  GL   + +K        Y +EG     G+ + WL+N +   +T  E+E+L        +   S   +FVPAF GL  P  +P+A G++ GL   T K+ + FA +EA+    R ILDA+ Q++G+ L  +RV+G +  N+ ++Q  A+I  + +     +ET A     A  A   + +W   L    +  I S  F      E+ D +F +WK+A Q++ NW T
Sbjct:    5 VAAVDQGTSSTRVLVFNAKTAEVISQHQVEIRQSFPKEGWVEEDPKEIMQSVHECIEKTCEKLSQLKVDISRVKAVGVTNQRETTLVWDRATGEPLYNAIVWLDLRTQSTVERLIKKAPGENKNH-----------LKHLTG--LPISTYFSAVKLRWLLDNVDEVREAVRTGRALFGTVDSWIIWNLTGGRSGGVHATDVSNASRTMLFNIHSMEWDPELCRYFDIPMEILPDVRSSSEVYGWMKSGTLAG---VPISGCLGDQSAALVGQMCFEEGQAKNTYGTGCFLLQNTGCKPVMSNHGLLTTVAYKLGRHMPCCYALEGSVAIAGAVVQWLKNNMGMVQTSSEIEKLA------AEVGTSHGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKKHLAFAALEAVCFQTREILDAMNQDSGVPLTQLRVDGGMTTNRLLMQLQADILCIPVVRPTMSETTALGAAVAAGAAEGVDVWS--LSPGHLPLIKSETFQPQINPEESDFRFSRWKKAVQKAMNWET 508          
BLAST of Glycerol kinase vs. Ensembl Medaka
Match: zgc:172295 (glycerol kinase [Source:NCBI gene;Acc:101169344])

HSP 1 Score: 228.409 bits (581), Expect = 8.178e-67
Identity = 164/538 (30.48%), Postives = 267/538 (49.63%), Query Frame = 2
Query:  110 VVGIDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFK---DCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLA------YFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFG--RTSTDFLGGGLS-IPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKI--EACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNTS 1660
            V  ID G+S  +  +F+ K   + S    EI+ + P +G  E DPK++     E  +   + +T+  + + +IKAIG++ QR + L+W++ T +P+   I W D+R+ S+V+S       +  NH           YF    +R+L  ++     ++VS R                     +G +++WL+WCLT GK      TD + AS T +++  T  W   +     IP EILP V+++ + +G  + S     G LS IPI   +GD  AA VG  CF  G+ K T GTG FL  NTG  P +S  GL   + +K        Y +EG     G+ + WL+ NL    + +ELE+L  S         S   +FVPAF GL  P  +P+A G++ GL   T +  + FA +EA+    R ILDA+ Q++G+ L  ++V+G +  N+ ++Q  A+I  + +   +  ET A     A  A   + +W   L   D+ ++ S  F      E+ + ++ +WK+A ++S+NW T+
Sbjct:   14 VAAIDQGTSSTRFLVFNSKTAELLSHHQVEIKQSFPKEGWVEEDPKEILQSVYECMERTCEKLTQLNIDISNIKAIGVTNQRETTLVWDKETGEPLYNAIVWLDLRTQSTVESLINKTPGRNKNHLKHKTGLPISTYFSAVKLRWLMDNVDEVHQAVVSHRAM-------------------FGTVDSWLIWCLTGGKSGGVHCTDVTNASRTMLFNIHTMNWDPELCKYFGIPMEILPSVRSSSEIYGLMKISASRKSGALSGIPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLRNTGAKPVMSDHGLLTTVAYKLGRDKPACYALEGSVAIAGAVVRWLKDNLGIIGSSEELEKLAASVG------TSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNRSHLAFAALEAVCFQTREILDAMNQDSGIPLTQLQVDGGMTSNRLLMQLQADILCIPVVKPSMPETTALGAAMAAGAAEGVSVWS--LNPEDLSEVTSEKFEPQINPEESEFRYARWKKAVEKSKNWETT 524          
BLAST of Glycerol kinase vs. Ensembl Medaka
Match: zgc:172295 (glycerol kinase [Source:NCBI gene;Acc:101169344])

HSP 1 Score: 228.794 bits (582), Expect = 1.351e-66
Identity = 162/535 (30.28%), Postives = 265/535 (49.53%), Query Frame = 2
Query:  110 VVGIDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFK---DCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLA------YFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKE---FSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKI--EACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNTS 1660
            V  ID G+S  +  +F+ K   + S    EI+ + P +G  E DPK++     E  +   + +T+  + + +IKAIG++ QR + L+W++ T +P+   I W D+R+ S+V+S       +  NH           YF    +R+L  ++     ++VS R                     +G +++WL+WCLT GK      TD + AS T +++  T  W   +     IP EILP V+++ + +G   +  L G   IPI   +GD  AA VG  CF  G+ K T GTG FL  NTG  P +S  GL   + +K        Y +EG     G+ + WL+ NL    + +ELE+L  S         S   +FVPAF GL  P  +P+A G++ GL   T +  + FA +EA+    R ILDA+ Q++G+ L  ++V+G +  N+ ++Q  A+I  + +   +  ET A     A  A   + +W   L   D+ ++ S  F      E+ + ++ +WK+A ++S+NW T+
Sbjct:   14 VAAIDQGTSSTRFLVFNSKTAELLSHHQVEIKQSFPKEGWVEEDPKEILQSVYECMERTCEKLTQLNIDISNIKAIGVTNQRETTLVWDKETGEPLYNAIVWLDLRTQSTVESLINKTPGRNKNHLKHKTGLPISTYFSAVKLRWLMDNVDEVHQAVVSHRAM-------------------FGTVDSWLIWCLTGGKSGGVHCTDVTNASRTMLFNIHTMNWDPELCKYFGIPMEILPSVRSSSEIYGLMKSGALSG---IPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLRNTGAKPVMSDHGLLTTVAYKLGRDKPACYALEGSVAIAGAVVRWLKDNLGIIGSSEELEKLAASVG------TSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNRSHLAFAALEAVCFQTREILDAMNQDSGIPLTQLQVDGGMTSNRLLMQLQADILCIPVVKPSMPETTALGAAMAAGAAEGVSVWS--LNPEDLSEVTSEKFEPQINPEESEFRYARWKKAVEKSKNWETT 518          
BLAST of Glycerol kinase vs. Planmine SMEST
Match: SMESG000032921.1 (SMESG000032921.1)

HSP 1 Score: 1046.96 bits (2706), Expect = 0.000e+0
Identity = 525/526 (99.81%), Postives = 526/526 (100.00%), Query Frame = 2
Query:   89 MESESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNTSVN 1666
            MESESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRSSSSVKSWNQSWKLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGL+IGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNTSVN
Sbjct:    1 MESESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELDPKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRSSSSVKSWNQSWKLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLHIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRNWNTSVN 526          
BLAST of Glycerol kinase vs. Planmine SMEST
Match: SMESG000006785.1 (SMESG000006785.1)

HSP 1 Score: 178.333 bits (451), Expect = 9.327e-49
Identity = 149/528 (28.22%), Postives = 254/528 (48.11%), Query Frame = 2
Query:  110 VVGIDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLW---VDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIR-YLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFG----RTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVEGYNPSTGSTINWLR-NLEFFKTYD-ELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESIVFAVIEAIPMSIRWILDAVQQETG--MKLKSIRVNGSVARNKWILQRLANITKLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHISEKLDKKFVKWKEACQRSRN 1648
            V+ ID G++  +  I++ K G I++   KE++   P  G  E    +++   V   E     I K     ++IK IGI+ QR + ++W++ T KP+   I W D R+   V+        K+IN S +      +N   ++    L   +   +++L  LL+   ++    ++G + +G ++ WL+W LTDG    TD + AS T + +  T  W + +     + K ILP + ++ + FG      +   L G   + I  ++GD QA+ +G  C + G+ K T GTG+FL  N G    +S KGL   + ++  +K+  +Y  EG  P     INWL+ NLE F + D E ++++ +   N         +FVPAF GL  P     A G+++GL+ T  K  +  A +EAI    + ILD +  ++   + + + +++G V ++    Q LA+I  L I+     EA+  GAA  A   +G     L    +    S  F      E +D+ + +WK A  +S N
Sbjct:    6 VLSIDSGTTSSRILIYNLKTGKIEASCQKELKQIFPKSGWMEESADEIFSSAVSCMEETLSMIMKKGYKKENIKGIGITNQRETTIVWDKVTKKPLYNAIVWSDTRTCELVE--------KLINLSPE------KNANSFMKIVGLPLSTYFSALKLKWLLEEVDEVKKSYKSGNLLFGTVDCWLIWKLTDGINHVTDVTNASRTMLMNLSTLKWDDNMCKFFGVEKSILPTILSSAELFGVLKLENTKSLLNG---LKITGVLGDQQASLIGQNCVSFGQTKCTYGTGAFLLTNIGEKVLISKKGLLTTVAYQFGSKSPPIYAFEGSIPVAAGAINWLKNNLELFNSVDQEFDKMVKAVPDN------GGCYFVPAFYGLFCPHWRSDARGVIVGLSQTVNKNHLCRATLEAIAFQTKEILDVISSDSEKLITINTFKIDGGVTKSNCFNQILADICGLTIDKPESIEATALGAAVAATHGLG-----LTAEHLINQSSKEFCSKLPQETVDQMYKEWKSAIIKSIN 505          
BLAST of Glycerol kinase vs. Planmine SMEST
Match: SMESG000006785.1 (SMESG000006785.1)

HSP 1 Score: 118.627 bits (296), Expect = 3.656e-29
Identity = 90/326 (27.61%), Postives = 159/326 (48.77%), Query Frame = 2
Query:  110 VVGIDVGSSILKCQIFD-KLGNIKSDSSKEIEINIPADGHYELDPKKLW---VDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIR-YLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFG----RTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSMKGLYPEIGWK--TKTTTMYFVE 1054
            V+ ID G++  +  I++ K G I++   KE++   P  G  E    +++   V   E     I K     ++IK IGI+ QR + ++W++ T KP+   I W D R+   V+        K+IN S +      +N   ++    L   +   +++L  LL+   ++    ++G + +G ++ WL+W LTDG    TD + AS T + +  T  W + +     + K ILP + ++ + FG      +   L G   + I  ++GD QA+ +G  C + G+ K T GTG+FL  N G    +S KGL   + ++  +K+  +Y  E
Sbjct:    6 VLSIDSGTTSSRILIYNLKTGKIEASCQKELKQIFPKSGWMEESADEIFSSAVSCMEETLSMIMKKGYKKENIKGIGITNQRETTIVWDKVTKKPLYNAIVWSDTRTCELVE--------KLINLSPE------KNANSFMKIVGLPLSTYFSALKLKWLLEEVDEVKKSYKSGNLLFGTVDCWLIWKLTDGINHVTDVTNASRTMLMNLSTLKWDDNMCKFFGVEKSILPTILSSAELFGVLKLENTKSLLNG---LKITGVLGDQQASLIGQNCVSFGQTKCTYGTGAFLLTNIGEKVLISKKGLLTTVAYQFGSKSPPIYAFE 314          
BLAST of Glycerol kinase vs. Planmine SMEST
Match: SMESG000023631.1 (SMESG000023631.1)

HSP 1 Score: 97.8265 bits (242), Expect = 4.775e-21
Identity = 110/470 (23.40%), Postives = 210/470 (44.68%), Query Frame = 2
Query:  200 EIN---IPADGHYELDPKKLWVDFQEVFK--DCITKSQLSL----QDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSM---------KGLYPEIGW---------KTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLI-GLNPTTLKES-IVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNG-SVARNKWILQRLANITKLKIEACTETEASCCGAAYLA--GLNI 1513
            EIN   +  +G  EL P+ L    ++ FK   C   +  SL    + I  + I   RN+ ++W   T K +   ++  D R + + +        K+I+ S + +     N ++L    L   +    ++L  L+ +   +    R G++ +G +++WLLW LT G+ ++TD + AS T + +   C W  +I   + I   +LPE+K++ + FG+ + D   G   +PI   + D +A+   +GC     G ++L     + ++     HV++         + +   IG+           K+  +Y +E    ++ + + W R+     +        +    N+  D S   +F+P       P+       + I GLN T  +   IV A +E++ + I  +L ++    G   K + V+G  + R++   Q LA++T L++E    +EA   G A LA  G+N+
Sbjct:   75 EINNLIVKREGCKELSPEDL---IEKAFKCIKCAVNNFKSLNYDFKKIVCMSICTSRNAVVVWSNKTGKSLYNALAEDDCRCNDTCQ--------KLIHKSWRKS---RTNFQHLCG--LPISARWAGVKLKWLIDNINTVQEAYRNGDLRFGTLDSWLLWQLTAGECYATDVTNASYTMLMNLHRCCWDSSICKFIEIDINMLPEIKSSSELFGKVTQDSPSGIGGLPITGSVCDIKASI--IGCQATQPGSVSLHIDPKIGVS-----HVTITIGEELLFYRSMLKGIGYVLSTASYQFGKKSNVVYSLEATLYNSQNLLTWFRDCLHLSS----SSEDVDSVANSVTD-SNGCYFIPTTGASHSPLERSQYRHVNIWGLNLTNSRPGHIVRASLESVAIEINQLLTSLSSVVGRPYKVLNVSGRGLDRSEAFCQTLADLTGLRVERLAMSEAVILGGALLAVYGVNL 516          
BLAST of Glycerol kinase vs. Planmine SMEST
Match: SMESG000023631.1 (SMESG000023631.1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.382e-21
Identity = 110/470 (23.40%), Postives = 210/470 (44.68%), Query Frame = 2
Query:  200 EIN---IPADGHYELDPKKLWVDFQEVFK--DCITKSQLSL----QDIKAIGISVQRNSFLLWERHTSKPITPIISWQDIRXXXXXXXXXXXXXLKIINHSSKLAYFITRNIRYLAASILNFKSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTDASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFLGGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHVSM---------KGLYPEIGW---------KTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERLLISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLI-GLNPTTLKES-IVFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNG-SVARNKWILQRLANITKLKIEACTETEASCCGAAYLA--GLNI 1513
            EIN   +  +G  EL P+ L    ++ FK   C   +  SL    + I  + I   RN+ ++W   T K +   ++  D R + + +        K+I+ S + +     N ++L    L   +    ++L  L+ +   +    R G++ +G +++WLLW LT G+ ++TD + AS T + +   C W  +I   + I   +LPE+K++ + FG+ + D   G   +PI   + D +A+   +GC     G ++L     + ++     HV++         + +   IG+           K+  +Y +E    ++ + + W R+     +        +    N+  D S   +F+P       P+       + I GLN T  +   IV A +E++ + I  +L ++    G   K + V+G  + R++   Q LA++T L++E    +EA   G A LA  G+N+
Sbjct:   67 EINNLIVKREGCKELSPEDL---IEKAFKCIKCAVNNFKSLNYDFKKIVCMSICTSRNAVVVWSNKTGKSLYNALAEDDCRCNDTCQ--------KLIHKSWRKS---RTNFQHLCG--LPISARWAGVKLKWLIDNINTVQEAYRNGDLRFGTLDSWLLWQLTAGECYATDVTNASYTMLMNLHRCCWDSSICKFIEIDINMLPEIKSSSELFGKVTQDSPSGIGGLPITGSVCDIKASI--IGCQATQPGSVSLHIDPKIGVS-----HVTITIGEELLFYRSMLKGIGYVLSTASYQFGKKSNVVYSLEATLYNSQNLLTWFRDCLHLSS----SSEDVDSVANSVTD-SNGCYFIPTTGASHSPLERSQYRHVNIWGLNLTNSRPGHIVRASLESVAIEINQLLTSLSSVVGRPYKVLNVSGRGLDRSEAFCQTLADLTGLRVERLAMSEAVILGGALLAVYGVNL 508          
The following BLAST results are available for this feature:
BLAST of Glycerol kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GK51.135e-11235.66glycerol kinase 5 [Source:HGNC Symbol;Acc:HGNC:286... [more]
GK2.865e-5830.58glycerol kinase [Source:HGNC Symbol;Acc:HGNC:4289][more]
GK3.960e-5830.58glycerol kinase [Source:HGNC Symbol;Acc:HGNC:4289][more]
GK3P4.904e-5830.21glycerol kinase 3 pseudogene [Source:HGNC Symbol;A... [more]
GK5.574e-5830.60glycerol kinase [Source:HGNC Symbol;Acc:HGNC:4289][more]
back to top
BLAST of Glycerol kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C55B6.16.079e-7830.80pep chromosome:WBcel235:X:7200370:7204044:1 gene:W... [more]
C55B6.16.079e-7830.80pep chromosome:WBcel235:X:7200364:7204044:1 gene:W... [more]
R11F4.19.156e-5429.03Probable glycerol kinase [Source:UniProtKB/Swiss-... [more]
R11F4.19.156e-5429.03Probable glycerol kinase [Source:UniProtKB/Swiss-... [more]
C55B6.11.063e-4534.46pep chromosome:WBcel235:X:7200805:7204044:1 gene:W... [more]
back to top
BLAST of Glycerol kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG12715.747e-8831.26gene:FBgn0035392 transcript:FBtr0072987[more]
CG12711.969e-8430.89gene:FBgn0035392 transcript:FBtr0072988[more]
CG12713.181e-6932.60gene:FBgn0035392 transcript:FBtr0072986[more]
Gk13.370e-5329.81gene:FBgn0025592 transcript:FBtr0072529[more]
Gk14.042e-5330.97gene:FBgn0025592 transcript:FBtr0072530[more]
back to top
BLAST of Glycerol kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gk54.507e-12237.12glycerol kinase 5 [Source:NCBI gene;Acc:777765][more]
GK3P1.275e-6429.87zgc:172295 [Source:ZFIN;Acc:ZDB-GENE-080204-72][more]
back to top
BLAST of Glycerol kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GK54.411e-11836.90glycerol kinase 5 [Source:NCBI gene;Acc:101734558][more]
GK55.050e-10637.11glycerol kinase 5 [Source:NCBI gene;Acc:101734558][more]
GK51.574e-10234.74glycerol kinase 5 [Source:NCBI gene;Acc:101734558][more]
GK53.852e-10234.97glycerol kinase 5 [Source:NCBI gene;Acc:101734558][more]
GK53.106e-10135.07glycerol kinase 5 [Source:NCBI gene;Acc:101734558][more]
back to top
BLAST of Glycerol kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gk56.692e-11335.91glycerol kinase 5 (putative) [Source:MGI Symbol;Ac... [more]
Gk54.023e-11036.23glycerol kinase 5 (putative) [Source:MGI Symbol;Ac... [more]
Gykl11.041e-5928.01glycerol kinase-like 1 [Source:MGI Symbol;Acc:MGI:... [more]
Gk1.376e-5830.17glycerol kinase [Source:MGI Symbol;Acc:MGI:106594][more]
Gk2.583e-5830.17glycerol kinase [Source:MGI Symbol;Acc:MGI:106594][more]
back to top
BLAST of Glycerol kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0JPE9|GLPK5_DANRE5.725e-11837.35Putative glycerol kinase 5 OS=Danio rerio OX=7955 ... [more]
sp|Q5ZMJ4|GLPK5_CHICK6.092e-11536.89Putative glycerol kinase 5 OS=Gallus gallus OX=903... [more]
sp|Q08D86|GLPK5_BOVIN9.967e-11537.72Putative glycerol kinase 5 OS=Bos taurus OX=9913 G... [more]
sp|Q8BX05|GLPK5_MOUSE4.681e-11235.91Putative glycerol kinase 5 OS=Mus musculus OX=1009... [more]
sp|Q6ZS86|GLPK5_HUMAN5.448e-11235.66Putative glycerol kinase 5 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of Glycerol kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H3AHT73.205e-12739.33Glycerol kinase 5 OS=Latimeria chalumnae OX=7897 G... [more]
A0A452J3R06.497e-12339.42Glycerol kinase 5 OS=Gopherus agassizii OX=38772 G... [more]
A0A5A9PAS11.364e-12238.07Putative glycerol kinase 5 OS=Triplophysa tibetana... [more]
A0A452J3Q65.327e-12239.61Glycerol kinase 5 OS=Gopherus agassizii OX=38772 G... [more]
A0A452J3P66.717e-12239.42Glycerol kinase 5 OS=Gopherus agassizii OX=38772 G... [more]
back to top
BLAST of Glycerol kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gk54.966e-10434.66glycerol kinase 5 [Source:NCBI gene;Acc:777765][more]
gk51.505e-9134.28glycerol kinase 5 [Source:NCBI gene;Acc:777765][more]
zgc:1722952.309e-5130.02pep primary_assembly:Astyanax_mexicanus-2.0:12:170... [more]
ENSAMXT00000050907.19.423e-3530.59pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000032765.12.466e-3430.59pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Glycerol kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007993.12.126e-4830.87pep scaffold:Pmarinus_7.0:GL477962:41173:55973:-1 ... [more]
fggy5.715e-1324.53FGGY carbohydrate kinase domain containing [Source... [more]
back to top
BLAST of Glycerol kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GUT15.340e-3225.46Glycerol kinase; converts glycerol to glycerol-3-p... [more]
back to top
BLAST of Glycerol kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO393296.513e-10735.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356391.592e-5831.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469444.315e-622.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycerol kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gk55.866e-12236.97glycerol kinase 5 [Source:NCBI gene;Acc:101157006][more]
ENSORLT00000010126.29.473e-6830.49glycerol kinase-like [Source:NCBI gene;Acc:1011578... [more]
ENSORLT00000010125.21.311e-6730.49glycerol kinase-like [Source:NCBI gene;Acc:1011578... [more]
zgc:1722958.178e-6730.48glycerol kinase [Source:NCBI gene;Acc:101169344][more]
zgc:1722951.351e-6630.28glycerol kinase [Source:NCBI gene;Acc:101169344][more]
back to top
BLAST of Glycerol kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032921.10.000e+099.81SMESG000032921.1[more]
SMESG000006785.19.327e-4928.22SMESG000006785.1[more]
SMESG000006785.13.656e-2927.61SMESG000006785.1[more]
SMESG000023631.14.775e-2123.40SMESG000023631.1[more]
SMESG000023631.15.382e-2123.40SMESG000023631.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007536 ID=SMED30007536|Name=Glycerol kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1876bp
ATTTTAAAACGTCGCACATTTTGAAACTTTTCTTATATTATTATTTATAA
TAAAATTAAAATATTGTTTAATAAATATTTTAAATAAAATGGAGTCAGAA
TCAGGTTATGTAGTTGGTATAGATGTTGGTAGCTCAATTCTTAAATGCCA
AATATTTGATAAATTAGGGAATATTAAATCAGATTCTTCTAAAGAGATTG
AAATAAACATTCCAGCTGATGGTCATTATGAATTGGATCCTAAGAAACTA
TGGGTTGATTTTCAAGAAGTTTTTAAAGATTGTATCACAAAAAGTCAACT
TTCTTTGCAAGACATAAAAGCAATTGGTATTTCTGTCCAAAGAAATAGTT
TTCTTTTATGGGAAAGGCATACCTCAAAGCCAATAACGCCTATAATATCC
TGGCAAGATATTAGATCGTCTTCCAGTGTCAAAAGTTGGAATCAGTCATG
GAAATTAAAGATAATCAATCACAGCAGTAAACTAGCATATTTCATAACGA
GAAATATTAGATATCTTGCAGCAAGTATTTTAAACTTCAAAAGCTCTCTT
GTTAGTATACGATTGTATGACTTGTTACAATCGGATCCTAAATTAAATTC
CAGAGCTCGAGCAGGGGAAATCTGCTATGGTTGTATTGAAACTTGGTTAC
TATGGTGTCTGACAGATGGAAAAGAATTTTCAACAGATGCTAGTTGTGCG
AGCGTCACAGGAATTTATGACCCATTTACATGCACGTGGAGTGAAACAAT
AATCAATTTATTAAATATTCCAAAAGAAATTCTTCCTGAAGTTAAAAACA
CTATAGATAATTTCGGTAGAACCAGTACTGATTTTTTGGGTGGTGGTCTT
TCGATACCTATTTGTTGTATTATTGGAGATTCACAGGCAGCTACTGTTGG
AGTAGGATGCTTCAATAAAGGTGAAGGTAAAATTACTCTAGGAACTGGGT
CATTCCTCAACATTAACACTGGAAATATACCTCACGTTTCAATGAAAGGA
CTTTATCCAGAAATAGGTTGGAAAACTAAAACCACTACAATGTATTTTGT
AGAAGGTTACAATCCATCTACGGGATCAACTATTAATTGGTTACGAAATT
TAGAATTTTTTAAGACTTACGACGAACTTGAAAGGTTATTAATTTCTCAT
TCACAAAATACTAAAGATGATGTTTCTGCTGATGTACATTTCGTGCCTGC
ATTTATGGGACTTCAAGTTCCAATAAATGACCCAACTGCCAGTGGTATGC
TGATAGGATTAAATCCCACCACATTAAAAGAATCCATTGTATTCGCTGTT
ATCGAAGCTATTCCAATGTCAATCAGGTGGATATTGGACGCAGTACAACA
AGAAACAGGAATGAAATTAAAATCAATACGAGTTAATGGAAGCGTTGCCC
GAAATAAATGGATCCTGCAAAGATTGGCAAATATAACTAAATTAAAAATT
GAGGCTTGTACTGAAACCGAAGCTAGTTGCTGTGGTGCGGCATACTTAGC
CGGGCTAAACATAGGAATTTGGAAATCTTTATTAGAACTATCAGATGTTT
GTAAAATAGATTCTGTATTTTTCCCAGAGTATCACATATCAGAAAAATTA
GACAAAAAGTTCGTAAAATGGAAAGAAGCCTGCCAAAGGTCTAGAAATTG
GAACACTTCTGTCAATTAGGTATTCACAACAATGCATCGCCAATTAAATT
AATGTGTTATTCCAAATTGCCTTCGACAAATGATACAGTAGTCATAATCA
CATGAAACATCATATTTTGATATAAATACATGAAAATTTTTATAACTTTA
ATTGTCCAGCGATAGAAATTTCACTGGTATTTGATTATGAATTAATGTCT
ACAAACGCAATGAATTTAAACTGTCA
back to top

protein sequence of SMED30007536-orf-1

>SMED30007536-orf-1 ID=SMED30007536-orf-1|Name=SMED30007536-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=527bp
MESESGYVVGIDVGSSILKCQIFDKLGNIKSDSSKEIEINIPADGHYELD
PKKLWVDFQEVFKDCITKSQLSLQDIKAIGISVQRNSFLLWERHTSKPIT
PIISWQDIRSSSSVKSWNQSWKLKIINHSSKLAYFITRNIRYLAASILNF
KSSLVSIRLYDLLQSDPKLNSRARAGEICYGCIETWLLWCLTDGKEFSTD
ASCASVTGIYDPFTCTWSETIINLLNIPKEILPEVKNTIDNFGRTSTDFL
GGGLSIPICCIIGDSQAATVGVGCFNKGEGKITLGTGSFLNINTGNIPHV
SMKGLYPEIGWKTKTTTMYFVEGYNPSTGSTINWLRNLEFFKTYDELERL
LISHSQNTKDDVSADVHFVPAFMGLQVPINDPTASGMLIGLNPTTLKESI
VFAVIEAIPMSIRWILDAVQQETGMKLKSIRVNGSVARNKWILQRLANIT
KLKIEACTETEASCCGAAYLAGLNIGIWKSLLELSDVCKIDSVFFPEYHI
SEKLDKKFVKWKEACQRSRNWNTSVN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004370glycerol kinase activity
GO:0005524ATP binding
GO:0016773phosphotransferase activity, alcohol group as acceptor
GO:0008168methyltransferase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006071glycerol metabolic process
GO:0006072glycerol-3-phosphate metabolic process
GO:0019563glycerol catabolic process
GO:0005975carbohydrate metabolic process
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000140anterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR018485Carb_kinase_FGGY_C
IPR018484Carb_kinase_FGGY_N
IPR000577Carb_kinase_FGGY
IPR001678MeTrfase_RsmB/NOP2
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000577Carbohydrate kinase, FGGYPIRSFPIRSF000538GlpKcoord: 5..526
e-value: 8.5E-110
score: 365.0
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 4..272
e-value: 3.1E-74
score: 251.5
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 273..526
e-value: 4.7E-69
score: 234.4
NoneNo IPR availablePANTHERPTHR10196:SF68GLYCEROL KINASE 5-RELATEDcoord: 5..522
NoneNo IPR availablePANTHERPTHR10196SUGAR KINASEcoord: 5..522
IPR018484Carbohydrate kinase, FGGY, N-terminalPFAMPF00370FGGY_Ncoord: 7..271
e-value: 8.9E-41
score: 140.1
IPR018485Carbohydrate kinase, FGGY, C-terminalPFAMPF02782FGGY_Ccoord: 281..473
e-value: 8.4E-36
score: 123.6
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 273..520
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 7..274