Transcription initiation factor TFIID subunit 12

Overview
NameTranscription initiation factor TFIID subunit 12
Smed IDSMED30007519
Length (bp)1219
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription initiation factor TFIID subunit 12 (SMED30007519) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription initiation factor TFIID subunit 12 (SMED30007519) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription initiation factor TFIID subunit 12 (SMED30007519) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription initiation factor TFIID subunit 12 (SMED30007519) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007519

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30007519SMESG000069808.1 dd_Smed_v4_9302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007519SMESG000069808.1 dd_Smed_v4_9302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007519SMESG000069808.1 dd_Smed_v4_9302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007519SMESG000069808.1 dd_Smed_v4_9302_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Human
Match: TAF12 (TATA-box binding protein associated factor 12 [Source:HGNC Symbol;Acc:HGNC:11545])

HSP 1 Score: 68.9366 bits (167), Expect = 2.216e-13
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKSSTL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   82 EMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 161          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Human
Match: TAF12 (TATA-box binding protein associated factor 12 [Source:HGNC Symbol;Acc:HGNC:11545])

HSP 1 Score: 68.9366 bits (167), Expect = 2.216e-13
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKSSTL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   82 EMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 161          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Fly
Match: Taf12 (gene:FBgn0011290 transcript:FBtr0335213)

HSP 1 Score: 53.5286 bits (127), Expect = 2.949e-8
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 2
Query:  824 LEEFLFHITEKAVE--------LAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            +EE L  I +  VE         AK RKS+ ++ +D Q  FE  +N+++PG+ +   +P K++  TE HK R++LI+K  KK
Sbjct:   78 VEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKK 159          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Fly
Match: Taf12 (gene:FBgn0011290 transcript:FBtr0290205)

HSP 1 Score: 53.5286 bits (127), Expect = 2.949e-8
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 2
Query:  824 LEEFLFHITEKAVE--------LAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            +EE L  I +  VE         AK RKS+ ++ +D Q  FE  +N+++PG+ +   +P K++  TE HK R++LI+K  KK
Sbjct:   78 VEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKK 159          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Fly
Match: Taf12 (gene:FBgn0011290 transcript:FBtr0082442)

HSP 1 Score: 53.9138 bits (128), Expect = 3.250e-8
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 2
Query:  824 LEEFLFHITEKAVE--------LAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            +EE L  I +  VE         AK RKS+ ++ +D Q  FE  +N+++PG+ +   +P K++  TE HK R++LI+K  KK
Sbjct:  114 VEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKK 195          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Fly
Match: Taf12 (gene:FBgn0011290 transcript:FBtr0082440)

HSP 1 Score: 53.9138 bits (128), Expect = 3.250e-8
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 2
Query:  824 LEEFLFHITEKAVE--------LAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            +EE L  I +  VE         AK RKS+ ++ +D Q  FE  +N+++PG+ +   +P K++  TE HK R++LI+K  KK
Sbjct:  114 VEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKK 195          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Zebrafish
Match: taf12 (TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-031030-5])

HSP 1 Score: 68.5514 bits (166), Expect = 2.577e-13
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKSSTL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   83 EMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTTKK 162          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Zebrafish
Match: taf12 (TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-031030-5])

HSP 1 Score: 68.5514 bits (166), Expect = 2.577e-13
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKSSTL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   83 EMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTTKK 162          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Zebrafish
Match: taf12 (TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-031030-5])

HSP 1 Score: 68.5514 bits (166), Expect = 2.577e-13
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKSSTL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   83 EMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTTKK 162          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Zebrafish
Match: taf12 (TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-031030-5])

HSP 1 Score: 68.5514 bits (166), Expect = 2.577e-13
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKSSTL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   83 EMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTTKK 162          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Xenopus
Match: mast1 (microtubule associated serine/threonine kinase 1 [Source:Xenbase;Acc:XB-GENE-1006519])

HSP 1 Score: 68.1662 bits (165), Expect = 1.332e-12
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKS+TL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LIKK  KK
Sbjct:  139 EMLLQIADDFIESVVSAACQLARHRKSNTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIKKTQKK 218          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Xenopus
Match: mast1 (microtubule associated serine/threonine kinase 1 [Source:Xenbase;Acc:XB-GENE-1006519])

HSP 1 Score: 55.8398 bits (133), Expect = 6.658e-9
Identity = 28/73 (38.36%), Postives = 43/73 (58.90%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSL 1021
            E+     ++F+  +   A +LA+ RKS+TL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK  M L
Sbjct:   73 EMLLQIADDFIESVVSAACQLARHRKSNTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQVMWL 145          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Mouse
Match: Taf12 (TATA-box binding protein associated factor 12 [Source:MGI Symbol;Acc:MGI:1913714])

HSP 1 Score: 68.9366 bits (167), Expect = 1.566e-13
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKSSTL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   82 EMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 161          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Mouse
Match: Taf12 (TATA-box binding protein associated factor 12 [Source:MGI Symbol;Acc:MGI:1913714])

HSP 1 Score: 68.9366 bits (167), Expect = 4.908e-13
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKSSTL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:  134 EMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 213          
BLAST of Transcription initiation factor TFIID subunit 12 vs. UniProt/SwissProt
Match: sp|Q3T174|TAF12_BOVIN (Transcription initiation factor TFIID subunit 12 OS=Bos taurus OX=9913 GN=TAF12 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.054e-12
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKSSTL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   82 EMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 161          
BLAST of Transcription initiation factor TFIID subunit 12 vs. UniProt/SwissProt
Match: sp|Q16514|TAF12_HUMAN (Transcription initiation factor TFIID subunit 12 OS=Homo sapiens OX=9606 GN=TAF12 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.064e-12
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKSSTL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   82 EMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 161          
BLAST of Transcription initiation factor TFIID subunit 12 vs. UniProt/SwissProt
Match: sp|Q8VE65|TAF12_MOUSE (Transcription initiation factor TFIID subunit 12 OS=Mus musculus OX=10090 GN=Taf12 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.095e-12
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKSSTL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   82 EMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 161          
BLAST of Transcription initiation factor TFIID subunit 12 vs. UniProt/SwissProt
Match: sp|Q91858|TAF12_XENLA (Transcription initiation factor TFIID subunit 12 OS=Xenopus laevis OX=8355 GN=taf12 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.320e-12
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKS+TL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LIKK  KK
Sbjct:   85 EMLLQIADDFIESVVSAACQLARHRKSNTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIKKTQKK 164          
BLAST of Transcription initiation factor TFIID subunit 12 vs. UniProt/SwissProt
Match: sp|P49905|TAF12_DROME (Transcription initiation factor TFIID subunit 12 OS=Drosophila melanogaster OX=7227 GN=Taf12 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.258e-7
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = 2
Query:  824 LEEFLFHITEKAVE--------LAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            +EE L  I +  VE         AK RKS+ ++ +D Q  FE  +N+++PG+ +   +P K++  TE HK R++LI+K  KK
Sbjct:  114 VEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKK 195          
BLAST of Transcription initiation factor TFIID subunit 12 vs. TrEMBL
Match: A0A1S3DT60 (transcription initiation factor TFIID subunit 12 OS=Diaphorina citri OX=121845 GN=LOC103524181 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 7.457e-13
Identity = 38/83 (45.78%), Postives = 55/83 (66.27%), Query Frame = 2
Query:  806 EIFNSFLE---EFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E++++F E   +F+ +I  +A +LAK R SSTLD KD Q++   DWNI +PGY +   KP K+   TE HK R++LI+K  KK
Sbjct:   75 EVYDTFSEIANDFVDNIVHRACQLAKHRGSSTLDPKDLQFVLAKDWNISIPGYGTDELKPYKRPMATEAHKQRLALIRKHLKK 157          
BLAST of Transcription initiation factor TFIID subunit 12 vs. TrEMBL
Match: A0A4Y2MXA0 (Transcription initiation factor TFIID subunit 12 OS=Araneus ventricosus OX=182803 GN=Taf12_2 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 8.475e-13
Identity = 37/80 (46.25%), Postives = 51/80 (63.75%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     EEF+  + E +  LAK RKSS L+ KD Q   E DWN+++PG+ +   +P KKS +TE HK RM+LI+K  KK
Sbjct:  104 ELLLQLAEEFIDDVVETSCSLAKHRKSSALEVKDAQLALEKDWNMWIPGFGTEELRPYKKSFQTEAHKQRMALIRKTLKK 183          
BLAST of Transcription initiation factor TFIID subunit 12 vs. TrEMBL
Match: A0A2T7P6L4 (TFIID_20kDa domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11638 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 6.710e-12
Identity = 36/80 (45.00%), Postives = 52/80 (65.00%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+ ++   A +LAK RKSSTL+ KD Q   E +WN++VPG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   66 EVLLQIADDFIENVVTSACQLAKHRKSSTLEVKDVQLYLERNWNMWVPGFGSEELRPYKKAAVTEAHKQRMALIRKTLKK 145          
BLAST of Transcription initiation factor TFIID subunit 12 vs. TrEMBL
Match: C1BSS2 (Transcription initiation factor TFIID subunit 12 OS=Lepeophtheirus salmonis OX=72036 GN=TAF12 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.657e-11
Identity = 38/88 (43.18%), Postives = 54/88 (61.36%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVE--------LAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E  +  +EE L HI +  +E        LAK RK+ T++ +D Q+I E +WN++VPGY +   +P KKS  TE H+ RM+LIKK  KK
Sbjct:  100 EQLDEDVEELLLHIADDFIEQTVSATCALAKHRKAPTIEVRDVQFILERNWNMWVPGYGTEEVRPYKKSAMTEAHRSRMALIKKTLKK 187          
BLAST of Transcription initiation factor TFIID subunit 12 vs. TrEMBL
Match: A0A0K2UNP0 (Transcription initiation factor TFIID subunit 12 [Bombyx mori] OS=Lepeophtheirus salmonis OX=72036 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.689e-11
Identity = 38/88 (43.18%), Postives = 54/88 (61.36%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVE--------LAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E  +  +EE L HI +  +E        LAK RK+ T++ +D Q+I E +WN++VPGY +   +P KKS  TE H+ RM+LIKK  KK
Sbjct:  100 EQLDEDVEELLLHIADDFIEQTVSATCALAKHRKAPTIEVRDVQFILERNWNMWVPGYGTEEVRPYKKSAMTEAHRSRMALIKKTLKK 187          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Cavefish
Match: taf12 (TATA-box binding protein associated factor 12 [Source:NCBI gene;Acc:103039299])

HSP 1 Score: 66.2402 bits (160), Expect = 1.235e-12
Identity = 33/80 (41.25%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKS+TL+ KD Q   E  WN+++PG+ S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   83 EMLLQVADDFIESVVTAACQLARHRKSNTLEVKDVQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTTKK 162          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Yeast
Match: TAF12 (Subunit (61/68 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification, similar to histone H2A; overexpression of the human ortholog, TAF12, an oncogene involved in the formation of choroid plexus carcinomas, results in dosage chromosomal instability (dCIN) in a human cell line similar to the dCIN observed in yeast overexpressors [Source:SGD;Acc:S000002552])

HSP 1 Score: 47.7506 bits (112), Expect = 2.257e-6
Identity = 19/52 (36.54%), Postives = 31/52 (59.62%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQS 961
            E+     ++F+ ++T  +  LAK RKS  L+ +D Q   E +WNI +PGY +
Sbjct:  444 ELLLDLADDFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSA 495          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Nematostella
Match: EDO30658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T062])

HSP 1 Score: 59.6918 bits (143), Expect = 2.212e-11
Identity = 29/73 (39.73%), Postives = 49/73 (67.12%), Query Frame = 2
Query:  827 EEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            ++F+ ++   + ++AK RKS+TL+ KD Q   E  WN+++PG+ +   +P KK+  TE HK R++LI+K  KK
Sbjct:   34 DDFIENVVNSSAQIAKHRKSNTLEVKDVQLHLERCWNMWIPGFGADELRPYKKAASTEAHKQRLALIRKSLKK 106          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Medaka
Match: taf12 (TATA-box binding protein associated factor 12 [Source:NCBI gene;Acc:101164838])

HSP 1 Score: 68.1662 bits (165), Expect = 1.393e-13
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  806 EIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP-KKSTETEIHKLRMSLIKKQCKK 1042
            E+     ++F+  +   A +LA+ RKS+TL+ KD Q   E  WN+++PGY S   +P KK+  TE HK RM+LI+K  KK
Sbjct:   52 EMLLQIADDFIESVVTAACQLARHRKSNTLEVKDVQLHLERQWNMWIPGYGSDEIRPYKKACTTEAHKQRMALIRKTTKK 131          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Planmine SMEST
Match: SMESG000069808.1 (SMESG000069808.1)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = 2
Query:  122 AVPTFFIPNVPQSVTTIQPNQQILLGQQNNFMRMPISSVNQWTVNNVLTTGALTNNINHQVQGIQGPRILFSQSANNDHFIMHNRTDLNNQTTIGVNPRFIPAHSLVVTQQLPNQIKQFSVSPSIHIPIQSHNITGLTQIPRLTTTNINHKEILVNQVINTSLIDGTLIQTNNNEKNNVVHESQNSIVGSNIQNESKFHNTISPINHKRXXXXXXXXXXXXXXXXXXXEIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKPKKSTETEIHKLRMSLIKKQCKK 1042
            AVPTFFIPNVPQSVTTIQPNQQILLGQQNNFMRMPISSVNQWTVNNVLTTGALTNNINHQVQGIQGPRILFSQSANNDHFIMHNRTDLNNQTTIGVNPRFIPAHSLVVTQQLPNQIKQFSVSPSIHIPIQSHNITGLTQIPRLTTTNINHKEILVNQVINTSLIDGTLIQTNNNEKNNVVHESQNSIVGSNIQNESKFHNTISPINHKRLLELAQGLDPLLQLDDDVQEIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKPKKSTETEIHKLRMSLIKKQCKK
Sbjct:   16 AVPTFFIPNVPQSVTTIQPNQQILLGQQNNFMRMPISSVNQWTVNNVLTTGALTNNINHQVQGIQGPRILFSQSANNDHFIMHNRTDLNNQTTIGVNPRFIPAHSLVVTQQLPNQIKQFSVSPSIHIPIQSHNITGLTQIPRLTTTNINHKEILVNQVINTSLIDGTLIQTNNNEKNNVVHESQNSIVGSNIQNESKFHNTISPINHKRLLELAQGLDPLLQLDDDVQEIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKPKKSTETEIHKLRMSLIKKQCKK 322          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Planmine SMEST
Match: SMESG000069808.1 (SMESG000069808.1)

HSP 1 Score: 482.641 bits (1241), Expect = 9.489e-172
Identity = 270/275 (98.18%), Postives = 270/275 (98.18%), Query Frame = 2
Query:  122 AVPTFFIPNVPQSVTTIQPNQQILLGQQNNFMRMPISSVNQWTVNNVLTTGALTNNINHQVQGIQGPRILFSQSANNDHFIMHNRTDLNNQTTIGVNPRFIPAHSLVVTQQLPNQIKQFSVSPSIHIPIQSHNITGLTQIPRLTTTNINHKEILVNQVINTSLIDGTLIQTNNNEKNNVVHESQNSIVGSNIQNESKFHNTISPINHKRXXXXXXXXXXXXXXXXXXXEIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFV 946
            AVPTFFIPNVPQSVTTIQPNQQILLGQQNNFMRMPISSVNQWTVNNVLTTGALTNNINHQVQGIQGPRILFSQSANNDHFIMHNRTDLNNQTTIGVNPRFIPAHSLVVTQQLPNQIKQFSVSPSIHIPIQSHNITGLTQIPRLTTTNINHKEILVNQVINTSLIDGTLIQTNNNEKNNVVHESQNSIVGSNIQNESKFHNTISPINHKRLLELAQGLDPLLQLDDDVQEIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIF    NI V
Sbjct:   16 AVPTFFIPNVPQSVTTIQPNQQILLGQQNNFMRMPISSVNQWTVNNVLTTGALTNNINHQVQGIQGPRILFSQSANNDHFIMHNRTDLNNQTTIGVNPRFIPAHSLVVTQQLPNQIKQFSVSPSIHIPIQSHNITGLTQIPRLTTTNINHKEILVNQVINTSLIDGTLIQTNNNEKNNVVHESQNSIVGSNIQNESKFHNTISPINHKRLLELAQGLDPLLQLDDDVQEIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFGILNNIIV 290          
BLAST of Transcription initiation factor TFIID subunit 12 vs. Planmine SMEST
Match: SMESG000069806.1 (SMESG000069806.1)

HSP 1 Score: 109.383 bits (272), Expect = 5.983e-27
Identity = 88/241 (36.51%), Postives = 142/241 (58.92%), Query Frame = 2
Query:  350 NDHFIMHNRTDLN-NQTTIGVNPRFIPAHSLVVTQQLPNQIKQFSVSPSIHIPIQSHNITGLTQIPRLTTTNINHKEILVNQVINTSLIDGTLIQTNNNEKNNVVHESQNSIVGSNIQNESKFH---------NTISPINHKRXXXXXXXXXXXXXXXXXXXEIFNSFLEEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKPKKSTETEIHKLRMSLIKKQCKK 1042
            N+ +I+ NR  +  N +++G N RFIP+ ++V   QL NQI++FS            N+    QI +     +N +   V +VI+  + +  +I+  +N    V+  + +S+V +  Q + K           N+   +N  R+ ++ + +D  LQLDDD++ IF+ +L++FL ++TE A  LAKLR S+TL+ KDFQY+ E DWNI+VPGY S+ EKPK++ E EIH+ RM+ IKK  K+
Sbjct:   70 NESYIIQNRQPMIINTSSLGFNQRFIPSTNIVNQGQL-NQIQKFS------------NVQQQIQIQQPQPRPVNAQ---VQRVISNPVPENQVIEIKDNNPMPVISAT-SSVVINKQQMKIKEENSEEREEPVNSKDMVNSNRINQIVRQIDEHLQLDDDMKGIFSQYLDDFLQNVTENACNLAKLRNSNTLEMKDFQYVMEKDWNIYVPGYPSINEKPKQNQELEIHRTRMNFIKKSTKQ 293          
The following BLAST results are available for this feature:
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TAF122.216e-1342.50TATA-box binding protein associated factor 12 [Sou... [more]
TAF122.216e-1342.50TATA-box binding protein associated factor 12 [Sou... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Taf122.949e-836.59gene:FBgn0011290 transcript:FBtr0335213[more]
Taf122.949e-836.59gene:FBgn0011290 transcript:FBtr0290205[more]
Taf123.250e-836.59gene:FBgn0011290 transcript:FBtr0082442[more]
Taf123.250e-836.59gene:FBgn0011290 transcript:FBtr0082440[more]
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
taf122.577e-1342.50TAF12 RNA polymerase II, TATA box binding protein ... [more]
taf122.577e-1342.50TAF12 RNA polymerase II, TATA box binding protein ... [more]
taf122.577e-1342.50TAF12 RNA polymerase II, TATA box binding protein ... [more]
taf122.577e-1342.50TAF12 RNA polymerase II, TATA box binding protein ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mast11.332e-1242.50microtubule associated serine/threonine kinase 1 [... [more]
mast16.658e-938.36microtubule associated serine/threonine kinase 1 [... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Taf121.566e-1342.50TATA-box binding protein associated factor 12 [Sou... [more]
Taf124.908e-1342.50TATA-box binding protein associated factor 12 [Sou... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3T174|TAF12_BOVIN1.054e-1242.50Transcription initiation factor TFIID subunit 12 O... [more]
sp|Q16514|TAF12_HUMAN1.064e-1242.50Transcription initiation factor TFIID subunit 12 O... [more]
sp|Q8VE65|TAF12_MOUSE1.095e-1242.50Transcription initiation factor TFIID subunit 12 O... [more]
sp|Q91858|TAF12_XENLA4.320e-1242.50Transcription initiation factor TFIID subunit 12 O... [more]
sp|P49905|TAF12_DROME3.258e-736.59Transcription initiation factor TFIID subunit 12 O... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3DT607.457e-1345.78transcription initiation factor TFIID subunit 12 O... [more]
A0A4Y2MXA08.475e-1346.25Transcription initiation factor TFIID subunit 12 O... [more]
A0A2T7P6L46.710e-1245.00TFIID_20kDa domain-containing protein OS=Pomacea c... [more]
C1BSS21.657e-1143.18Transcription initiation factor TFIID subunit 12 O... [more]
A0A0K2UNP01.689e-1143.18Transcription initiation factor TFIID subunit 12 [... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taf121.235e-1241.25TATA-box binding protein associated factor 12 [Sou... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TAF122.257e-636.54Subunit (61/68 kDa) of TFIID and SAGA complexes; i... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO306582.212e-1139.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taf121.393e-1342.50TATA-box binding protein associated factor 12 [Sou... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000069808.10.000e+0100.00SMESG000069808.1[more]
SMESG000069808.19.489e-17298.18SMESG000069808.1[more]
SMESG000069806.15.983e-2736.51SMESG000069806.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007519 ID=SMED30007519|Name=Transcription initiation factor TFIID subunit 12|organism=Schmidtea mediterranea sexual|type=transcript|length=1219bp
TTCGAATTGTAATTTTAAAATTTATGTTTGATCGTAAATTTTTTTGGAGT
TGTACGATACTAACGTCATTTAATTTATGCAAGAACAAAATCAAATACAA
CAGCTGAATCAAAATGCTCAAGCAGTTCCTACTTTTTTCATTCCCAATGT
TCCGCAATCTGTTACTACTATTCAACCTAACCAACAGATTTTATTAGGCC
AACAAAACAATTTTATGCGTATGCCAATTTCATCCGTTAACCAATGGACA
GTTAATAACGTCTTGACCACTGGGGCCTTAACAAATAATATTAATCATCA
GGTTCAAGGTATACAGGGACCAAGAATTTTATTTTCCCAATCTGCAAATA
ATGATCATTTTATAATGCATAATAGAACAGACTTGAACAATCAAACAACT
ATCGGGGTTAACCCTCGATTTATTCCAGCACATTCTCTTGTTGTAACTCA
ACAACTGCCAAATCAGATTAAACAATTTTCCGTGTCACCGTCGATTCATA
TCCCCATTCAAAGTCACAATATCACCGGGTTAACTCAAATCCCTCGATTG
ACGACAACAAATATAAACCACAAAGAAATACTTGTTAATCAAGTTATAAA
CACCTCGTTAATCGACGGAACGCTCATTCAAACAAATAATAACGAAAAAA
ATAATGTTGTTCACGAGTCCCAAAATTCGATTGTTGGGAGTAATATACAA
AATGAATCAAAATTTCACAATACAATTTCACCGATAAATCACAAAAGATT
GCTGGAATTGGCTCAAGGTCTGGATCCTCTGTTACAGTTGGATGATGATG
TACAGGAAATATTCAATTCTTTTCTCGAAGAATTTTTATTCCATATCACT
GAAAAAGCTGTTGAGTTGGCAAAATTACGAAAATCGTCAACATTAGACAC
AAAAGATTTCCAATATATATTTGAGCACGATTGGAATATTTTTGTACCTG
GGTATCAGAGCCTTCTTGAAAAACCAAAGAAGAGCACGGAAACTGAAATC
CATAAACTGAGAATGTCCCTTATTAAGAAGCAATGTAAAAAATGAATACC
GTCGTTCCCTGTGATATAGTCTTCTTGTTACCCAGAATATGCTATTACTT
ATTTTTAACATAGCCTATCTTTGTATAGTTATTTGGCGTTTTAATCCAAA
GATTGATATGATTTTGATTGCGATTTTGTCAATTAGATAAATGTGATTTT
ATATTCATTGGGATAAAAG
back to top

protein sequence of SMED30007519-orf-1

>SMED30007519-orf-1 ID=SMED30007519-orf-1|Name=SMED30007519-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=323bp
MQEQNQIQQLNQNAQAVPTFFIPNVPQSVTTIQPNQQILLGQQNNFMRMP
ISSVNQWTVNNVLTTGALTNNINHQVQGIQGPRILFSQSANNDHFIMHNR
TDLNNQTTIGVNPRFIPAHSLVVTQQLPNQIKQFSVSPSIHIPIQSHNIT
GLTQIPRLTTTNINHKEILVNQVINTSLIDGTLIQTNNNEKNNVVHESQN
SIVGSNIQNESKFHNTISPINHKRLLELAQGLDPLLQLDDDVQEIFNSFL
EEFLFHITEKAVELAKLRKSSTLDTKDFQYIFEHDWNIFVPGYQSLLEKP
KKSTETEIHKLRMSLIKKQCKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003743translation initiation factor activity
GO:0046982protein heterodimerization activity
GO:0001102RNA polymerase II activating transcription factor binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003713transcription coactivator activity
GO:0005515protein binding
GO:0008134transcription factor binding
GO:0017025TBP-class protein binding
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
GO:0006352DNA-templated transcription, initiation
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006367transcription initiation from RNA polymerase II promoter
GO:0043966histone H3 acetylation
GO:0051091positive regulation of sequence-specific DNA binding transcription factor activity
GO:0051123RNA polymerase II transcriptional preinitiation complex assembly
Vocabulary: cellular component
TermDefinition
GO:0046695SLIK (SAGA-like) complex
GO:0005669transcription factor TFIID complex
GO:0000124SAGA complex
GO:0000125PCAF complex
GO:0005634nucleus
GO:0030914STAGA complex
GO:0033276transcription factor TFTC complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR037794TAF12
IPR003228TFIID_TAF12_dom
IPR009072Histone-fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 218..290
e-value: 4.1E-16
score: 60.9
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 220..289
IPR003228Transcription initiation factor TFIID subunit 12 domainPFAMPF03847TFIID_20kDacoord: 223..288
e-value: 5.8E-15
score: 55.5
IPR037794Transcription initiation factor TFIID subunit 12PANTHERPTHR12264FAMILY NOT NAMEDcoord: 2..321
NoneNo IPR availablePANTHERPTHR12264:SF21TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 12coord: 2..321
NoneNo IPR availablePRODOMPD012998coord: 244..295
e-value: 3.0E-5
score: 114.0