Transient receptor potential cation channel,subfamily m, member, putative

Overview
NameTransient receptor potential cation channel,subfamily m, member, putative
Smed IDSMED30007509
Length (bp)4034
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel,subfamily m, member, putative (SMED30007509) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel,subfamily m, member, putative (SMED30007509) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel,subfamily m, member, putative (SMED30007509) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel,subfamily m, member, putative (SMED30007509) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007509

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30007509SMESG000064631.1 SMESG000064622.1 dd_Smed_v4_10029_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007509SMESG000064631.1 SMESG000064622.1 dd_Smed_v4_10029_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30007509SMESG000064631.1 SMESG000064622.1 dd_Smed_v4_10029_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30007509SMESG000064631.1 SMESG000064622.1 dd_Smed_v4_10029_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Human
Match: TRPM6 (transient receptor potential cation channel subfamily M member 6 [Source:HGNC Symbol;Acc:HGNC:17995])

HSP 1 Score: 164.081 bits (414), Expect = 1.633e-50
Identity = 109/324 (33.64%), Postives = 167/324 (51.54%), Query Frame = 3
Query:  324 HNNAKCMCGEAKKNHK-IDKTPFSLCDPWKENESMEV------ISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG---YFRQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESF 1256
             N  +C CG    +H  ID +        KE+E   V        TD+FG I F  +D  +T    ++R SY+ KLD +L L+  +W + +  L ISV GG  +F M  K K IF QGL+KAA TT A IIT G+N G++  +GDA++   S+   K      I  +GI PWG ++N+  L       ++  + N + K    +LN  H+H+I  DDG     T  K G     R+ LE  +S ++     R G+PVV L+VEGG ++ +     VK+K  +VVCEGTG+A+D++    + +         ++ + + M+  +F
Sbjct:   47 QNLIRCYCGRLIGDHAGIDYSWTISAAKGKESEQWSVEKHTTKSPTDTFGTINF--QDGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKMELPKLVISVHGGIQNFTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSHSSHSLRK------IWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKL--TTLNSMHSHFILSDDG-----TVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVILSVWETVKDKDPVVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICMIQNTF 355          

HSP 2 Score: 58.151 bits (139), Expect = 1.633e-50
Identity = 43/116 (37.07%), Postives = 61/116 (52.59%), Query Frame = 2
Query: 1361 ITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN 1702
            IT+FD  S E  DLD AIL +L+K  +L         S QL+L + W+RVDI K  I   +     D     + D+++  +V F++L +E   N+  FLT   L+ELY T    TN
Sbjct:  379 ITIFDADSEEQQDLDLAILTALLKGTNL-------SASEQLNLAMAWDRVDIAKKHILIYEQHWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELYNTKQGPTN 487          

HSP 3 Score: 77.0258 bits (188), Expect = 2.725e-13
Identity = 95/398 (23.87%), Postives = 173/398 (43.47%), Query Frame = 2
Query: 1811 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLISKRTEFTKDFKT-------CQSESF------PDFNEDNCRTSIFLK---LRR-----------------------------FYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRW--------SKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKI 2827
            E+    +P+ +L +WAVLM++QK A FFW   +E+   A++A  +Y+   +  + S    D SE L+ +   F  LA+ L+E+    ++ +A  L+  +  NW   +CL+LA       F+S+   Q  +   W     +   ++   I+ II P  I      T +FK+        QS+ F       D N  + + S  +K   L R                             FY AP  KF  ++  +++F++ F+Y VL  M+  Q ++ E +  IY+    ++   EI  S   +   ++K W +  +WN               L   +AI G+++   V+ RW         + IY + +  ++ ++L   A ++  GP + M++K+
Sbjct:  600 ESTGFLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPPTI-----LTLEFKSKAEMSHVPQSQDFQFMWYYSDQNASSSKESASVKEYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYEFYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQP-QPSVQEWLVSIYIFTNAIEVVREICISEPGKFTQKVKVWIS-EYWN---------------LTETVAI-GLFSAGFVL-RWGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKM 973          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Human
Match: TRPM6 (transient receptor potential cation channel subfamily M member 6 [Source:HGNC Symbol;Acc:HGNC:17995])

HSP 1 Score: 163.696 bits (413), Expect = 1.730e-50
Identity = 109/324 (33.64%), Postives = 167/324 (51.54%), Query Frame = 3
Query:  324 HNNAKCMCGEAKKNHK-IDKTPFSLCDPWKENESMEV------ISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG---YFRQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESF 1256
             N  +C CG    +H  ID +        KE+E   V        TD+FG I F  +D  +T    ++R SY+ KLD +L L+  +W + +  L ISV GG  +F M  K K IF QGL+KAA TT A IIT G+N G++  +GDA++   S+   K      I  +GI PWG ++N+  L       ++  + N + K    +LN  H+H+I  DDG     T  K G     R+ LE  +S ++     R G+PVV L+VEGG ++ +     VK+K  +VVCEGTG+A+D++    + +         ++ + + M+  +F
Sbjct:   42 QNLIRCYCGRLIGDHAGIDYSWTISAAKGKESEQWSVEKHTTKSPTDTFGTINF--QDGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKMELPKLVISVHGGIQNFTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSHSSHSLRK------IWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKL--TTLNSMHSHFILSDDG-----TVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVILSVWETVKDKDPVVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICMIQNTF 350          

HSP 2 Score: 58.151 bits (139), Expect = 1.730e-50
Identity = 43/116 (37.07%), Postives = 61/116 (52.59%), Query Frame = 2
Query: 1361 ITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN 1702
            IT+FD  S E  DLD AIL +L+K  +L         S QL+L + W+RVDI K  I   +     D     + D+++  +V F++L +E   N+  FLT   L+ELY T    TN
Sbjct:  374 ITIFDADSEEQQDLDLAILTALLKGTNL-------SASEQLNLAMAWDRVDIAKKHILIYEQHWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELYNTKQGPTN 482          

HSP 3 Score: 77.0258 bits (188), Expect = 2.546e-13
Identity = 95/398 (23.87%), Postives = 173/398 (43.47%), Query Frame = 2
Query: 1811 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLISKRTEFTKDFKT-------CQSESF------PDFNEDNCRTSIFLK---LRR-----------------------------FYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRW--------SKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKI 2827
            E+    +P+ +L +WAVLM++QK A FFW   +E+   A++A  +Y+   +  + S    D SE L+ +   F  LA+ L+E+    ++ +A  L+  +  NW   +CL+LA       F+S+   Q  +   W     +   ++   I+ II P  I      T +FK+        QS+ F       D N  + + S  +K   L R                             FY AP  KF  ++  +++F++ F+Y VL  M+  Q ++ E +  IY+    ++   EI  S   +   ++K W +  +WN               L   +AI G+++   V+ RW         + IY + +  ++ ++L   A ++  GP + M++K+
Sbjct:  595 ESTGFLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPPTI-----LTLEFKSKAEMSHVPQSQDFQFMWYYSDQNASSSKESASVKEYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYEFYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQP-QPSVQEWLVSIYIFTNAIEVVREICISEPGKFTQKVKVWIS-EYWN---------------LTETVAI-GLFSAGFVL-RWGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKM 968          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Human
Match: TRPM6 (transient receptor potential cation channel subfamily M member 6 [Source:HGNC Symbol;Acc:HGNC:17995])

HSP 1 Score: 163.696 bits (413), Expect = 1.774e-50
Identity = 109/324 (33.64%), Postives = 167/324 (51.54%), Query Frame = 3
Query:  324 HNNAKCMCGEAKKNHK-IDKTPFSLCDPWKENESMEV------ISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG---YFRQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESF 1256
             N  +C CG    +H  ID +        KE+E   V        TD+FG I F  +D  +T    ++R SY+ KLD +L L+  +W + +  L ISV GG  +F M  K K IF QGL+KAA TT A IIT G+N G++  +GDA++   S+   K      I  +GI PWG ++N+  L       ++  + N + K    +LN  H+H+I  DDG     T  K G     R+ LE  +S ++     R G+PVV L+VEGG ++ +     VK+K  +VVCEGTG+A+D++    + +         ++ + + M+  +F
Sbjct:   42 QNLIRCYCGRLIGDHAGIDYSWTISAAKGKESEQWSVEKHTTKSPTDTFGTINF--QDGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKMELPKLVISVHGGIQNFTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSHSSHSLRK------IWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKL--TTLNSMHSHFILSDDG-----TVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVILSVWETVKDKDPVVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICMIQNTF 350          

HSP 2 Score: 58.151 bits (139), Expect = 1.774e-50
Identity = 43/116 (37.07%), Postives = 61/116 (52.59%), Query Frame = 2
Query: 1361 ITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN 1702
            IT+FD  S E  DLD AIL +L+K  +L         S QL+L + W+RVDI K  I   +     D     + D+++  +V F++L +E   N+  FLT   L+ELY T    TN
Sbjct:  374 ITIFDADSEEQQDLDLAILTALLKGTNL-------SASEQLNLAMAWDRVDIAKKHILIYEQHWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELYNTKQGPTN 482          

HSP 3 Score: 77.0258 bits (188), Expect = 2.568e-13
Identity = 103/422 (24.41%), Postives = 185/422 (43.84%), Query Frame = 2
Query: 1811 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLISKRTEFTKDFKT-------CQSESF------PDFNEDNCRTSIFLK---LRR-----------------------------FYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRW--------SKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQA 2899
            E+    +P+ +L +WAVLM++QK A FFW   +E+   A++A  +Y+   +  + S    D SE L+ +   F  LA+ L+E+    ++ +A  L+  +  NW   +CL+LA       F+S+   Q  +   W     +   ++   I+ II P  I      T +FK+        QS+ F       D N  + + S  +K   L R                             FY AP  KF  ++  +++F++ F+Y VL  M+  Q ++ E +  IY+    ++   EI  S   +   ++K W +  +WN               L   +AI G+++   V+ RW         + IY + +  ++ ++L   A ++  GP + M++K+   +     I+ I LLS+GV  +A
Sbjct:  595 ESTGFLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPPTI-----LTLEFKSKAEMSHVPQSQDFQFMWYYSDQNASSSKESASVKEYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYEFYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQP-QPSVQEWLVSIYIFTNAIEVVREICISEPGKFTQKVKVWIS-EYWN---------------LTETVAI-GLFSAGFVL-RWGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKMTANMFYIVIIMAIVLLSFGVARKA 992          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Human
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:HGNC Symbol;Acc:HGNC:7146])

HSP 1 Score: 155.606 bits (392), Expect = 3.548e-41
Identity = 104/304 (34.21%), Postives = 162/304 (53.29%), Query Frame = 3
Query:  336 KCMCGE-------------AKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKEK--VSIVVCEGTGKASDIIGEAFR 1184
            +C CG+               KN +  K   +  + W   +  +   TDS+G +EF G   +N  +  ++RVSY+ K D +L L+   W + +  L ISV GG  +F+M+ K K +F +GLIKAA+TT A I T G++ G+ S +GDA++   S      K    +  +GIAPWG V+N+  L       V+  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+P+V L+VEGG ++       ++E+  + +V+C+G+G+ASDI+  A +
Sbjct:    6 RCCCGQFTNQHIPPLPSATPSKNEEESKQVETQPEKWSVAKHTQSYPTDSYGVLEFQGGGYSNKAM--YIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVISHVGDALKDHSS------KSRGRVCAIGIAPWGIVENKEDLVGKDVTRVYQTMSNPLSKLS--VLNNSHTHFILADNG-----TLGKYGAEVKLRRLLEKHISLQKINTRLGQGVPLVGLVVEGGPNVVSIVLEYLQEEPPIPVVICDGSGRASDILSFAHK 294          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Human
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:HGNC Symbol;Acc:HGNC:7146])

HSP 1 Score: 157.918 bits (398), Expect = 4.569e-38
Identity = 104/304 (34.21%), Postives = 163/304 (53.62%), Query Frame = 3
Query:  336 KCMCGE-------------AKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKEK--VSIVVCEGTGKASDIIGEAFR 1184
            +C CG+               KN + +K   +  + W   +  +   TDS+G +EF G   +N  +  ++RVSY+ K D +L L+   W + +  L ISV GG  +F+M+ K K +F +GLIKAA+TT A I T G++ G+ S +GDA++   S      K    +  +GIAPWG V+N+  L       V+  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+P+V L+VEGG ++       ++E+  + +V+C+G+G+ASDI+  A +
Sbjct:   45 RCCCGQFTNQHIPPLPSATPSKNEEENKQVETQPEKWSVAKHTQSYPTDSYGVLEFQGGGYSNKAM--YIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVISHVGDALKDHSS------KSRGRVCAIGIAPWGIVENKEDLVGKDVTRVYQTMSNPLSKLS--VLNNSHTHFILADNG-----TLGKYGAEVKLRRLLEKHISLQKINTRLGQGVPLVGLVVEGGPNVVSIVLEYLQEEPPIPVVICDGSGRASDILSFAHK 333          

HSP 2 Score: 120.939 bits (302), Expect = 9.097e-27
Identity = 115/415 (27.71%), Postives = 208/415 (50.12%), Query Frame = 2
Query: 1826 KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFPFLI---------------SKRTEFTKDFKTCQSESFPDF--------NEDNCRTSIFL--KLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            ++PF EL +WAVLM++QK A F W + +ES+  ALVA ++YK     S       D S+ L+     F  LA++L+++ +  D+++A  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +        I+ I+ P  I               SK  E  K+ +   +++  D         NE   + SI +  K+  FY AP  KF  ++ +++ +++ F+YV+L  M     ++ E + + Y+V + L+K  EI  S   ++  +IK W    +WN  D++ I   ++  +LR Q   N  Y        + + IY + +  +Y+++L +   +K LGP + M+ K++ ++L F  I+L+ L+S+GV  QA  +P+   SW    NI   PY+ ++G
Sbjct:  648 QYPFHELMVWAVLMKRQKMAVFLWQRGEESMAKALVACKLYKAMAHESSESDLVDDISQDLDNNSKDFGQLALELLDQSYKHDEQIAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILLPPTILFLEFRTYDDFSYQTSKENEDGKEKEEENTDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWP-SLQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQ-EYWNITDLVAISTFMIGAILRLQ---NQPY------MGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYG 1051          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Celegans
Match: gtl-2 (Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:Q20766])

HSP 1 Score: 132.109 bits (331), Expect = 2.137e-51
Identity = 103/368 (27.99%), Postives = 176/368 (47.83%), Query Frame = 3
Query:  138 SFINDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLC---------DPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG---YFRQALENKISQKQGDRVGIPVVLLIVEGG-------HDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFR 1184
            SF +D  S   R++  K  D+     I  +E     L   ++++ F   EC +F++L +    +  +C CG     H    T FS             W    + +  +TD+FG I F G    +     +VR+SY+ +  D++ L+   W +    L I+V GG  +F++ ++   +F +G++KAA TT A IIT GL+ G+   +  A+   ++ +  +M+    I  +GIAPWG +K +  L   +   V+Y+V +         LN  H++++  D+G     T  + G   + RQ LEN I+    +   +PVV  ++EGG       HD        +K  +  +VC+G+G+A+DII  A R
Sbjct:   55 SFRSDHLS---RKSTHKFLDNPNLFAIELTEK----LSPPWIENTFEKRECIRFAALPK----DPERCGCGRPLSAHTPASTFFSTLPVHLLEKEQQTWTIANNTQTSTTDAFGTIVFQGG--AHAHKAQYVRLSYDSEPLDVMYLMEKVWGLEAPRLVITVHGGMSNFELEERLGRLFRKGMLKAAQTTGAWIITSGLDSGVVRHVAKALD--EAGISARMRSQ--IVTIGIAPWGVIKRKERL-IRQNEHVYYDVHSLSVNANVGILNDRHSYFLLADNG-----TVGRFGADLHLRQNLENHIATFGCNGRKVPVVCTLLEGGISSINAIHDYVT-----MKPDIPAIVCDGSGRAADIISFAAR 394          

HSP 2 Score: 92.0485 bits (227), Expect = 2.137e-51
Identity = 90/412 (21.84%), Postives = 168/412 (40.78%), Query Frame = 2
Query: 1271 RKLIEQDISELHQVDEAIKCIEDIIKNELL-ITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLEN---------------VSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDV----------------------------------KELLSKMIGFYEYPCSEND-SIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENL------AVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTW------RAGFNINFFSCILCIIFPFLISKRTEFTKDFKTCQSES 2317
            R LI+    E  Q +   K  E +I+++LL I  +  +  ED+DF IL +++++ +L  D              +WNRVD+ K  +FS     S+D     + D++   +V F+E  LEN               + N+ D  +A+ ++   E            + +IG+   K + +                                   KEL  K          E D S  +PF +L +WAVL  +   A+  W   ++++   L+A R+YK   + +    D    +E  K  F+N       A++L+++C+  D +    L+  +  +WG  +CL LA  +    F+++  CQ  +   W      R+G N+   + ++C      ++ + + +K  +    E+
Sbjct:  411 RNLIKMVFPETDQEEMFRKITECVIRDDLLRIFRYGQEEEEDVDFVILSTVLQKQNLPPDEQLALTL-------SWNRVDLAKSCLFSNGRKWSSDVLEKAMNDALYWDRVDFVECLLENGVSMKNFLSINRLENLYNMDDINSAHSVRNWMENFDSMDPHTYLTIPMIGQVVEKLMGNAFQLYYTSRSFKGKYDRYKRINQSSYFHRKRKIVQKELFKKKSDDQINDNEEEDFSFAYPFNDLLIWAVLTSRHGMAECMWVHGEDAMAKCLLAIRLYKATAKIA---EDEYLDVEEAKRLFDNAVKCREDAIELLDQCYRADHDRTLRLLRMELPHWGNNNCLSLAVLANTKTFLAHPCCQILLAELWHGSLKVRSGSNVRVLTALICPPAILFMAYKPKHSKTARLLSEET 812          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 135.961 bits (341), Expect = 1.956e-40
Identity = 109/412 (26.46%), Postives = 192/412 (46.60%), Query Frame = 3
Query:  144 INDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHK------------------IDK-----------------TPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVK--EKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK 1259
            +N++ SA+   A+  +  +   + +RF+E++       +V+  F   EC +F +    L     KC CG  +  H+                  +++                 T     + W   +    ++T++FG++EF G    +     +VRV+++ +   I+ L  + W I+   L I+V GGT +F ++ K   +F +GL+KAA TT A IIT G + G+   +  A++ +QS         N I C+GIAPWG +K R      + +TV Y  S+   K +   LN  H++++  D+G   +   + +   R+ LE  ISQKQ   G    +PVV +++EGG          V    +V +VVC+G+G+A+D++  A          H+ +  DG  +LP+  +
Sbjct:  186 LNEDVSATANSAQL-VLPTPLFNQMRFTESNMSLNRHNWVRETFTRRECSRFIASSRDLH----KCGCGRTRDAHRNIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGG--PHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQS------AQRNKIVCIGIAPWGLLKKREDF-IGQDKTVPYYPSS--SKGRFTGLNNRHSYFLLVDNGTVGRYGAEVI--LRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFA----------HQNVTEDG--LLPDDIR 567          

HSP 2 Score: 51.2174 bits (121), Expect = 1.956e-40
Identity = 49/157 (31.21%), Postives = 78/157 (49.68%), Query Frame = 2
Query: 1358 LITVFDI--KSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGFYEYPCS 1810
            L+T+F +  +   D+D AIL +L+K  +L         + QL+L L WNRVDI +  +F+             + +++I  +V F+ L LE   N+Q FLT + L ELY T     N     +R + R   +G    L D+  ++ K++G   Y CS
Sbjct:  601 LLTIFRLGEQGEHDVDHAILTALLKGQNLS-------AADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVR-VRQGYRFKLPDIGLVIEKLMG-NSYQCS 748          

HSP 3 Score: 73.559 bits (179), Expect = 1.087e-12
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 2
Query: 1826 KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFEN---LAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFS---CILCIIFPFLI 2266
            ++P+ EL +WAVL ++Q  A   W   +E++  ALVA R+YK     +  D    E  E  K Y E    L+++L++ C+ +D      L+  +  NW   +CL LA    +  F+++  CQ  +   W  G  +   S    +L +I P  I
Sbjct:  889 RYPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFI 1041          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 135.576 bits (340), Expect = 2.125e-40
Identity = 109/412 (26.46%), Postives = 192/412 (46.60%), Query Frame = 3
Query:  144 INDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHK------------------IDK-----------------TPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVK--EKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK 1259
            +N++ SA+   A+  +  +   + +RF+E++       +V+  F   EC +F +    L     KC CG  +  H+                  +++                 T     + W   +    ++T++FG++EF G    +     +VRV+++ +   I+ L  + W I+   L I+V GGT +F ++ K   +F +GL+KAA TT A IIT G + G+   +  A++ +QS         N I C+GIAPWG +K R      + +TV Y  S+   K +   LN  H++++  D+G   +   + +   R+ LE  ISQKQ   G    +PVV +++EGG          V    +V +VVC+G+G+A+D++  A          H+ +  DG  +LP+  +
Sbjct:  146 LNEDVSATANSAQL-VLPTPLFNQMRFTESNMSLNRHNWVRETFTRRECSRFIASSRDLH----KCGCGRTRDAHRNIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGG--PHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQS------AQRNKIVCIGIAPWGLLKKREDF-IGQDKTVPYYPSS--SKGRFTGLNNRHSYFLLVDNGTVGRYGAEVI--LRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFA----------HQNVTEDG--LLPDDIR 527          

HSP 2 Score: 51.6026 bits (122), Expect = 2.125e-40
Identity = 49/157 (31.21%), Postives = 78/157 (49.68%), Query Frame = 2
Query: 1358 LITVFDI--KSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGFYEYPCS 1810
            L+T+F +  +   D+D AIL +L+K  +L         + QL+L L WNRVDI +  +F+             + +++I  +V F+ L LE   N+Q FLT + L ELY T     N     +R + R   +G    L D+  ++ K++G   Y CS
Sbjct:  561 LLTIFRLGEQGEHDVDHAILTALLKGQNLS-------AADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVR-VRQGYRFKLPDIGLVIEKLMG-NSYQCS 708          

HSP 3 Score: 73.9442 bits (180), Expect = 9.459e-13
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 2
Query: 1826 KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFEN---LAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFS---CILCIIFPFLI 2266
            ++P+ EL +WAVL ++Q  A   W   +E++  ALVA R+YK     +  D    E  E  K Y E    L+++L++ C+ +D      L+  +  NW   +CL LA    +  F+++  CQ  +   W  G  +   S    +L +I P  I
Sbjct:  849 RYPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFI 1001          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 135.576 bits (340), Expect = 2.405e-40
Identity = 109/412 (26.46%), Postives = 192/412 (46.60%), Query Frame = 3
Query:  144 INDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHK------------------IDK-----------------TPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVK--EKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK 1259
            +N++ SA+   A+  +  +   + +RF+E++       +V+  F   EC +F +    L     KC CG  +  H+                  +++                 T     + W   +    ++T++FG++EF G    +     +VRV+++ +   I+ L  + W I+   L I+V GGT +F ++ K   +F +GL+KAA TT A IIT G + G+   +  A++ +QS         N I C+GIAPWG +K R      + +TV Y  S+   K +   LN  H++++  D+G   +   + +   R+ LE  ISQKQ   G    +PVV +++EGG          V    +V +VVC+G+G+A+D++  A          H+ +  DG  +LP+  +
Sbjct:  247 LNEDVSATANSAQL-VLPTPLFNQMRFTESNMSLNRHNWVRETFTRRECSRFIASSRDLH----KCGCGRTRDAHRNIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGG--PHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQS------AQRNKIVCIGIAPWGLLKKREDF-IGQDKTVPYYPSS--SKGRFTGLNNRHSYFLLVDNGTVGRYGAEVI--LRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFA----------HQNVTEDG--LLPDDIR 628          

HSP 2 Score: 51.2174 bits (121), Expect = 2.405e-40
Identity = 49/157 (31.21%), Postives = 78/157 (49.68%), Query Frame = 2
Query: 1358 LITVFDI--KSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGFYEYPCS 1810
            L+T+F +  +   D+D AIL +L+K  +L         + QL+L L WNRVDI +  +F+             + +++I  +V F+ L LE   N+Q FLT + L ELY T     N     +R + R   +G    L D+  ++ K++G   Y CS
Sbjct:  662 LLTIFRLGEQGEHDVDHAILTALLKGQNLS-------AADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVR-VRQGYRFKLPDIGLVIEKLMG-NSYQCS 809          

HSP 3 Score: 73.559 bits (179), Expect = 9.793e-13
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 2
Query: 1826 KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFEN---LAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFS---CILCIIFPFLI 2266
            ++P+ EL +WAVL ++Q  A   W   +E++  ALVA R+YK     +  D    E  E  K Y E    L+++L++ C+ +D      L+  +  NW   +CL LA    +  F+++  CQ  +   W  G  +   S    +L +I P  I
Sbjct:  950 RYPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFI 1102          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 116.316 bits (290), Expect = 1.229e-34
Identity = 79/245 (32.24%), Postives = 127/245 (51.84%), Query Frame = 3
Query:  540 LELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVK--EKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK 1259
            + L  + W I+   L I+V GGT +F ++ K   +F +GL+KAA TT A IIT G + G+   +  A++ +QS         N I C+GIAPWG +K R      + +TV Y  S+   K +   LN  H++++  D+G   +   + +   R+ LE  ISQKQ   G    +PVV +++EGG          V    +V +VVC+G+G+A+D++  A          H+ +  DG  +LP+  +
Sbjct:    1 MSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQS------AQRNKIVCIGIAPWGLLKKREDF-IGQDKTVPYYPSS--SKGRFTGLNNRHSYFLLVDNGTVGRYGAEVI--LRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFA----------HQNVTEDG--LLPDDIR 222          

HSP 2 Score: 51.6026 bits (122), Expect = 1.229e-34
Identity = 49/157 (31.21%), Postives = 78/157 (49.68%), Query Frame = 2
Query: 1358 LITVFDI--KSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGFYEYPCS 1810
            L+T+F +  +   D+D AIL +L+K  +L         + QL+L L WNRVDI +  +F+             + +++I  +V F+ L LE   N+Q FLT + L ELY T     N     +R + R   +G    L D+  ++ K++G   Y CS
Sbjct:  256 LLTIFRLGEQGEHDVDHAILTALLKGQNLS-------AADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVR-VRQGYRFKLPDIGLVIEKLMG-NSYQCS 403          

HSP 3 Score: 74.3294 bits (181), Expect = 6.674e-13
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 2
Query: 1826 KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFEN---LAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFS---CILCIIFPFLI 2266
            ++P+ EL +WAVL ++Q  A   W   +E++  ALVA R+YK     +  D    E  E  K Y E    L+++L++ C+ +D      L+  +  NW   +CL LA    +  F+++  CQ  +   W  G  +   S    +L +I P  I
Sbjct:  544 RYPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFI 696          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339082)

HSP 1 Score: 132.494 bits (332), Expect = 5.504e-40
Identity = 170/670 (25.37%), Postives = 288/670 (42.99%), Query Frame = 2
Query: 1310 VDEAIKCIEDII---KNELLITVFDIKSH-----EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGF---------------------YEYPCSENDSIKH---------------------------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLR---DTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF----NINFFSCILCIIFPFLIS----KRTEFTKDFKTCQSESFPDFNEDN----------------CRTSIF-----------------LKLRR----FYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGN 2995
            +D++ K  ++++   +N+ LITVF I+       ++LD  IL +L K   L           QLSL LTWNRVDI + +IF       N      +  ++   ++ F++L LEN  +++ FLT   L+ELY T     N     LR +     KG    L+D+  +++K++G                      Y   C ++ + ++                           PF EL +WAVL ++Q+ A   W   +E+L  +LV+ ++YK     +     DT+  E L ++   FE+   KL++  +  D E A  L+  +  +W   SCL LA  +     +++   Q  +   W  G     N N F  IL +  PF I     K  E  +     + E   + N DN                  T+ F                 L+L++    FY AP TKF   S  ++ F+I FS+ VL  M++M     E   + Y+  +  +K  EI  S    I  +    W +N WN  D   I+  ++ +  R++     +           + IY +    +YL+IL +L  +K LGP + MM K++K ++ F  ++ + L+S+GV+ QA  YP +  +W  +  +   PY+ ++G +  G+
Sbjct:  344 LDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHL-------SPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSV-WAWNMWNPCDGAAIILFVIGLAFRFRENTMDI----------GRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD 993          

HSP 2 Score: 53.5286 bits (127), Expect = 5.504e-40
Identity = 44/177 (24.86%), Postives = 82/177 (46.33%), Query Frame = 1
Query: 3031 LRATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNS-KLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKS---IKSGISRMEIRSKSI--FKELENIQT-KLNKIQIKNVKKVQEGS 3540
            L A  + I  +++  S  +W +  +++++EY  KP+LP PF    + Y +L +C +K        +K  E+ + N  KL ++K                   DL +L  + E   + F  +   I  Q +   +K+   R+E  S+ I    + ENIQT  +  I+ + ++K++E S
Sbjct: 1033 LIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK--------AKGLEVQRDNGLKLFLEK------------------DDLERLYDFEEECVEGFFHEQEIILNQSTDERVKNTTERVETMSQKIEDINQKENIQTATVQNIEFR-LRKMEESS 1182          

HSP 3 Score: 137.117 bits (344), Expect = 6.128e-32
Identity = 95/318 (29.87%), Postives = 156/318 (49.06%), Query Frame = 3
Query:  252 RKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDK--TPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYV-KNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ---KQGDRVGIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIG 1172
            R ++++NF   EC KF    +    ++ KC CG+A+  H+        S  D W   +      TD++G IEF G    +     +VR+S++ + + +++L   +WN+ +  L I+V GG  +F ++ K K    +GL+KAA TT A I T G N G+T  +GDA+      L +  +    +  +GIAPWG V +N  +L   +    H   S    + +   LN  H +++  D+G     T+ K G     R+ LE  IS            PVV L++EGG +        V +   V +VVC+G+G+A+D++ 
Sbjct:   13 RSWIETNFQKRECIKFIPCPK----DDTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCH---SISSPRSKLAVLNNRHAYFLLVDNG-----TQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLA 310          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339081)

HSP 1 Score: 137.117 bits (344), Expect = 5.965e-32
Identity = 95/318 (29.87%), Postives = 156/318 (49.06%), Query Frame = 3
Query:  252 RKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDK--TPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYV-KNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ---KQGDRVGIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIG 1172
            R ++++NF   EC KF    +    ++ KC CG+A+  H+        S  D W   +      TD++G IEF G    +     +VR+S++ + + +++L   +WN+ +  L I+V GG  +F ++ K K    +GL+KAA TT A I T G N G+T  +GDA+      L +  +    +  +GIAPWG V +N  +L   +    H   S    + +   LN  H +++  D+G     T+ K G     R+ LE  IS            PVV L++EGG +        V +   V +VVC+G+G+A+D++ 
Sbjct:   20 RSWIETNFQKRECIKFIPCPK----DDTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCH---SISSPRSKLAVLNNRHAYFLLVDNG-----TQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLA 317          

HSP 2 Score: 102.064 bits (253), Expect = 3.223e-21
Identity = 107/415 (25.78%), Postives = 176/415 (42.41%), Query Frame = 2
Query: 1310 VDEAIKCIEDII---KNELLITVFDIKSH-----EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGF---------------------YEYPCSENDSIKH---------------------------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLR---DTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF----NINFFSCILCIIFPFLIS----KRTEFTKDFKTCQSESFPDFNEDN 2341
            +D++ K  ++++   +N+ LITVF I+       ++LD  IL +L K   L           QLSL LTWNRVDI + +IF       N      +  ++   ++ F++L LEN  +++ FLT   L+ELY T     N     LR +     KG    L+D+  +++K++G                      Y   C ++ + ++                           PF EL +WAVL ++Q+ A   W   +E+L  +LV+ ++YK     +     DT+  E L ++   FE+   KL++  +  D E A  L+  +  +W   SCL LA  +     +++   Q  +   W  G     N N F  IL +  PF I     K  E  +     + E   + N DN
Sbjct:  351 LDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHL-------SPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDN 757          

HSP 3 Score: 55.4546 bits (132), Expect = 4.949e-17
Identity = 76/283 (26.86%), Postives = 131/283 (46.29%), Query Frame = 2
Query: 2177 CQKSIEFTWRAGFNINFFS-CILCIIFPFLISKRTEFTK----DFKTCQSESF---PDFNEDNCRTSIFLKLR--RFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGN 2995
             ++SI   +R G   N     +L   +    +K  E  K    D  T Q   F    ++NE      + LK +   FY AP TKF   S  ++ F+I FS+ VL  M++M     E   + Y+  +  +K  EI  S    I  +   W  +N WN  D   I+  ++ +  R++     +           + IY +    +YL+IL +L  +K LGP + MM K++K ++ F  ++ + L+S+GV+ QA  YP +  +W  +  +   PY+ ++G +  G+
Sbjct:  774 AKRSISLRYRMGAGANNRDKALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVW-AWNMWNPCDGAAIILFVIGLAFRFRENTMDI----------GRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD 1044          

HSP 4 Score: 53.5286 bits (127), Expect = 4.949e-17
Identity = 44/177 (24.86%), Postives = 82/177 (46.33%), Query Frame = 1
Query: 3031 LRATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNS-KLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKS---IKSGISRMEIRSKSI--FKELENIQT-KLNKIQIKNVKKVQEGS 3540
            L A  + I  +++  S  +W +  +++++EY  KP+LP PF    + Y +L +C +K        +K  E+ + N  KL ++K                   DL +L  + E   + F  +   I  Q +   +K+   R+E  S+ I    + ENIQT  +  I+ + ++K++E S
Sbjct: 1084 LIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK--------AKGLEVQRDNGLKLFLEK------------------DDLERLYDFEEECVEGFFHEQEIILNQSTDERVKNTTERVETMSQKIEDINQKENIQTATVQNIEFR-LRKMEESS 1233          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339077)

HSP 1 Score: 137.117 bits (344), Expect = 6.058e-32
Identity = 95/318 (29.87%), Postives = 156/318 (49.06%), Query Frame = 3
Query:  252 RKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDK--TPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYV-KNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ---KQGDRVGIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIG 1172
            R ++++NF   EC KF    +    ++ KC CG+A+  H+        S  D W   +      TD++G IEF G    +     +VR+S++ + + +++L   +WN+ +  L I+V GG  +F ++ K K    +GL+KAA TT A I T G N G+T  +GDA+      L +  +    +  +GIAPWG V +N  +L   +    H   S    + +   LN  H +++  D+G     T+ K G     R+ LE  IS            PVV L++EGG +        V +   V +VVC+G+G+A+D++ 
Sbjct:  115 RSWIETNFQKRECIKFIPCPK----DDTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCH---SISSPRSKLAVLNNRHAYFLLVDNG-----TQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLA 412          

HSP 2 Score: 102.064 bits (253), Expect = 2.636e-21
Identity = 107/415 (25.78%), Postives = 176/415 (42.41%), Query Frame = 2
Query: 1310 VDEAIKCIEDII---KNELLITVFDIKSH-----EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGF---------------------YEYPCSENDSIKH---------------------------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLR---DTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF----NINFFSCILCIIFPFLIS----KRTEFTKDFKTCQSESFPDFNEDN 2341
            +D++ K  ++++   +N+ LITVF I+       ++LD  IL +L K   L           QLSL LTWNRVDI + +IF       N      +  ++   ++ F++L LEN  +++ FLT   L+ELY T     N     LR +     KG    L+D+  +++K++G                      Y   C ++ + ++                           PF EL +WAVL ++Q+ A   W   +E+L  +LV+ ++YK     +     DT+  E L ++   FE+   KL++  +  D E A  L+  +  +W   SCL LA  +     +++   Q  +   W  G     N N F  IL +  PF I     K  E  +     + E   + N DN
Sbjct:  446 LDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHL-------SPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDN 852          

HSP 3 Score: 53.5286 bits (127), Expect = 1.688e-16
Identity = 63/226 (27.88%), Postives = 112/226 (49.56%), Query Frame = 2
Query: 2324 DFNEDNCRTSIFLKLR--RFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGN 2995
            ++NE      + LK +   FY AP TKF   S  ++ F+I FS+ VL  M++M     E   + Y+  +  +K  EI  S    I  +   W  +N WN  D   I+  ++ +  R++     +           + IY +    +YL+IL +L  +K LGP + MM K++K ++ F  ++ + L+S+GV+ QA  YP +  +W  +  +   PY+ ++G +  G+
Sbjct:  901 EYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVW-AWNMWNPCDGAAIILFVIGLAFRFRENTMDI----------GRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD 1114          

HSP 4 Score: 53.5286 bits (127), Expect = 1.688e-16
Identity = 44/177 (24.86%), Postives = 82/177 (46.33%), Query Frame = 1
Query: 3031 LRATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNS-KLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKS---IKSGISRMEIRSKSI--FKELENIQT-KLNKIQIKNVKKVQEGS 3540
            L A  + I  +++  S  +W +  +++++EY  KP+LP PF    + Y +L +C +K        +K  E+ + N  KL ++K                   DL +L  + E   + F  +   I  Q +   +K+   R+E  S+ I    + ENIQT  +  I+ + ++K++E S
Sbjct: 1154 LIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK--------AKGLEVQRDNGLKLFLEK------------------DDLERLYDFEEECVEGFFHEQEIILNQSTDERVKNTTERVETMSQKIEDINQKENIQTATVQNIEFR-LRKMEESS 1303          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339078)

HSP 1 Score: 137.117 bits (344), Expect = 6.337e-32
Identity = 95/318 (29.87%), Postives = 156/318 (49.06%), Query Frame = 3
Query:  252 RKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDK--TPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYV-KNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ---KQGDRVGIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIG 1172
            R ++++NF   EC KF    +    ++ KC CG+A+  H+        S  D W   +      TD++G IEF G    +     +VR+S++ + + +++L   +WN+ +  L I+V GG  +F ++ K K    +GL+KAA TT A I T G N G+T  +GDA+      L +  +    +  +GIAPWG V +N  +L   +    H   S    + +   LN  H +++  D+G     T+ K G     R+ LE  IS            PVV L++EGG +        V +   V +VVC+G+G+A+D++ 
Sbjct:   13 RSWIETNFQKRECIKFIPCPK----DDTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCH---SISSPRSKLAVLNNRHAYFLLVDNG-----TQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLA 310          

HSP 2 Score: 102.449 bits (254), Expect = 2.126e-21
Identity = 107/415 (25.78%), Postives = 176/415 (42.41%), Query Frame = 2
Query: 1310 VDEAIKCIEDII---KNELLITVFDIKSH-----EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGF---------------------YEYPCSENDSIKH---------------------------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLR---DTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF----NINFFSCILCIIFPFLIS----KRTEFTKDFKTCQSESFPDFNEDN 2341
            +D++ K  ++++   +N+ LITVF I+       ++LD  IL +L K   L           QLSL LTWNRVDI + +IF       N      +  ++   ++ F++L LEN  +++ FLT   L+ELY T     N     LR +     KG    L+D+  +++K++G                      Y   C ++ + ++                           PF EL +WAVL ++Q+ A   W   +E+L  +LV+ ++YK     +     DT+  E L ++   FE+   KL++  +  D E A  L+  +  +W   SCL LA  +     +++   Q  +   W  G     N N F  IL +  PF I     K  E  +     + E   + N DN
Sbjct:  344 LDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHL-------SPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDN 750          

HSP 3 Score: 53.5286 bits (127), Expect = 1.603e-6
Identity = 44/177 (24.86%), Postives = 82/177 (46.33%), Query Frame = 1
Query: 3031 LRATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNS-KLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKS---IKSGISRMEIRSKSI--FKELENIQT-KLNKIQIKNVKKVQEGS 3540
            L A  + I  +++  S  +W +  +++++EY  KP+LP PF    + Y +L +C +K        +K  E+ + N  KL ++K                   DL +L  + E   + F  +   I  Q +   +K+   R+E  S+ I    + ENIQT  +  I+ + ++K++E S
Sbjct: 1127 LIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK--------AKGLEVQRDNGLKLFLEK------------------DDLERLYDFEEECVEGFFHEQEIILNQSTDERVKNTTERVETMSQKIEDINQKENIQTATVQNIEFR-LRKMEESS 1276          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339074)

HSP 1 Score: 137.117 bits (344), Expect = 6.471e-32
Identity = 95/318 (29.87%), Postives = 156/318 (49.06%), Query Frame = 3
Query:  252 RKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDK--TPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYV-KNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ---KQGDRVGIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIG 1172
            R ++++NF   EC KF    +    ++ KC CG+A+  H+        S  D W   +      TD++G IEF G    +     +VR+S++ + + +++L   +WN+ +  L I+V GG  +F ++ K K    +GL+KAA TT A I T G N G+T  +GDA+      L +  +    +  +GIAPWG V +N  +L   +    H   S    + +   LN  H +++  D+G     T+ K G     R+ LE  IS            PVV L++EGG +        V +   V +VVC+G+G+A+D++ 
Sbjct:   31 RSWIETNFQKRECIKFIPCPK----DDTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCH---SISSPRSKLAVLNNRHAYFLLVDNG-----TQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLA 328          

HSP 2 Score: 102.449 bits (254), Expect = 2.218e-21
Identity = 107/415 (25.78%), Postives = 176/415 (42.41%), Query Frame = 2
Query: 1310 VDEAIKCIEDII---KNELLITVFDIKSH-----EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGF---------------------YEYPCSENDSIKH---------------------------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLR---DTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF----NINFFSCILCIIFPFLIS----KRTEFTKDFKTCQSESFPDFNEDN 2341
            +D++ K  ++++   +N+ LITVF I+       ++LD  IL +L K   L           QLSL LTWNRVDI + +IF       N      +  ++   ++ F++L LEN  +++ FLT   L+ELY T     N     LR +     KG    L+D+  +++K++G                      Y   C ++ + ++                           PF EL +WAVL ++Q+ A   W   +E+L  +LV+ ++YK     +     DT+  E L ++   FE+   KL++  +  D E A  L+  +  +W   SCL LA  +     +++   Q  +   W  G     N N F  IL +  PF I     K  E  +     + E   + N DN
Sbjct:  362 LDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHL-------SPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDN 768          

HSP 3 Score: 53.9138 bits (128), Expect = 1.458e-16
Identity = 63/226 (27.88%), Postives = 112/226 (49.56%), Query Frame = 2
Query: 2324 DFNEDNCRTSIFLKLR--RFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGN 2995
            ++NE      + LK +   FY AP TKF   S  ++ F+I FS+ VL  M++M     E   + Y+  +  +K  EI  S    I  +   W  +N WN  D   I+  ++ +  R++     +           + IY +    +YL+IL +L  +K LGP + MM K++K ++ F  ++ + L+S+GV+ QA  YP +  +W  +  +   PY+ ++G +  G+
Sbjct:  817 EYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVW-AWNMWNPCDGAAIILFVIGLAFRFRENTMDI----------GRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD 1030          

HSP 4 Score: 53.5286 bits (127), Expect = 1.458e-16
Identity = 44/177 (24.86%), Postives = 82/177 (46.33%), Query Frame = 1
Query: 3031 LRATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNS-KLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKS---IKSGISRMEIRSKSI--FKELENIQT-KLNKIQIKNVKKVQEGS 3540
            L A  + I  +++  S  +W +  +++++EY  KP+LP PF    + Y +L +C +K        +K  E+ + N  KL ++K                   DL +L  + E   + F  +   I  Q +   +K+   R+E  S+ I    + ENIQT  +  I+ + ++K++E S
Sbjct: 1070 LIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK--------AKGLEVQRDNGLKLFLEK------------------DDLERLYDFEEECVEGFFHEQEIILNQSTDERVKNTTERVETMSQKIEDINQKENIQTATVQNIEFR-LRKMEESS 1219          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Zebrafish
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 133.65 bits (335), Expect = 5.924e-62
Identity = 96/339 (28.32%), Postives = 158/339 (46.61%), Query Frame = 3
Query:  183 FKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNH--KIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ-KQGDR---VGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIG 1172
              ++ +  G ++  S + ++     ++K N    EC  +     + D     C CG  K  H  +  K    + + W ++  +    TD+FG I F G      K   +VRVS +   +++ +L+  +W +    L ISV GG  +F ++   K+ F +GLIK A TT A I+T G + G+   +G A+   + Y          I  +G+APWG + NR+ L   +GR   Y   +E  + +   L+ NHTH++  DDG     T+   G     R  LE  IS+   G+R   V IPVV ++++GG          +      VV EG+G+ +D+I 
Sbjct:   14 LAVSTAKGGRYLSLSPSFQRCSLASWIKENIKKKECCFY-----VEDGREGICKCGYPKVQHCDEAIKPEDYMGEQWDKHRHVRETPTDAFGDISFGG---LGQKTGKYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVAQTTGAWILTGGTHAGVMKHVGMAV---RDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVDDG-----TQGHYGVEIELRARLEKLISKLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIA 336          

HSP 2 Score: 126.331 bits (316), Expect = 5.924e-62
Identity = 161/680 (23.68%), Postives = 313/680 (46.03%), Query Frame = 2
Query: 1262 VLKRKLIEQ--DISELHQVDEAIKCIEDIIKNELLITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLT-ANILKELYETCPKSTNFRKTFLRLIGRPFSKG-----------LNDVKELLSKMIGFY---------------------------EYPCSEN----DSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIY-KYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN--FFSCILCIIF-PFL------------ISKRTEFTKDFKTCQSESFPDFNED------------------NCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD-FSWIALSNILDYPYYTMFG--VLNLGNTVY-FTWC--NASTNYEP 3040
            +LKR  +++  + +EL Q+ E  K I+DI++   L+TVF I   +  D+D AIL +L+K       + ++    QL L + WNRVDI + +IF+ +   ++ +    +  +++  K +F+ L LEN   +++FL     L ELY   P     RK   R+ G    +G           L+ V E +  ++G +                           + PCS      D++  P ++LFLWAV+   ++ A+  W +C + +  AL A++I  K  Q +   D++ +  +    N++E  A+ +  ECH  D + A  L+ + + +WG  +CL LA ++ D  F+++   Q  +   W    +++   +  +LC+IF P +            I ++ E T+  K      F   ++                   NC +    +L  F  +PQ KF  +  ++  F+  F+ V++   +    +  E++  ++L  ++ ++  +++       + R    +  + WN +D++ IV  I  ++ R Q +    Y  KV++          I+  F L+++ + +  + LGPKI ++ +++ +L  F  ++ I++++YGV  Q       +  +WI    + + PY T+FG    N+ NT++  + C  NAS   +P
Sbjct:  354 LLKRFFMQEYKNFTEL-QIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADTVWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGKIKRHLRGFSQKSELKPLNCSS----RLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQ-TSPSWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQASDTVFYIGKVIL------CIDFII--FCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWVVAYGVAKQGILIENEERLNWIIRGAVYE-PYITIFGNFPTNIDNTLFDISSCSVNASDPLKP 1018          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Zebrafish
Match: trpm4b.2 (transient receptor potential cation channel, subfamily M, member 4b, transient receptor potential cation channel, subfamily M, member 4b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-061214-2])

HSP 1 Score: 109.383 bits (272), Expect = 7.884e-46
Identity = 84/301 (27.91%), Postives = 150/301 (49.83%), Query Frame = 3
Query:  327 NNAKCMCGEAKKNHKI----DKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTD--FVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG--YFRQALENKIS-QKQGD-RVGIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQ 1193
            N   C CG A+ +H      D    ++   W   +      TD++G+++F      N++  D  F+R+S       + +L+   W +    L +SV+GG    +++    +I  QGL+K A +T A IIT GL +GI+  IG+A++ + + +   +  N  +  +GIAPWG V+NR  L  ++G     +   +V      +L+ NH  ++  DDG     T +K G   FR  LE+ IS Q+ G+  + IPV+ +++ G   +  F+E S  +K     +V  G+G  ++++ +    +Q
Sbjct:   40 NGGLCQCGAARDHHPSVALGDNFSTAVVSQWFSTQHSSEQPTDAYGELDF-----NNSRKRDSYFLRLSSTTDPAKVFDLMKEHWKLQQPNLVVSVVGGEGRSEVKSWVLDILRQGLVKTAQSTGAWIITGGLRQGISRCIGEAVKDNATAV-SSITLNKVLP-IGIAPWGLVENRQHLVNSEG-----SFPAKVTTQDSCNLDNNHKAFLLVDDG----TTGRKGGELAFRARLEDYISRQRPGNASIDIPVLNMLIAGDTSMLEFLEMS--LKNSTPCLVLAGSGGLANLVSDIVENVQ 322          

HSP 2 Score: 96.6709 bits (239), Expect = 7.884e-46
Identity = 90/359 (25.07%), Postives = 165/359 (45.96%), Query Frame = 2
Query: 1307 QVDEAIKCIEDIIKNELLITVFDIKSH--EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELY----ETCPKST----NFRKTFLRLIGRPFSKGLNDVKELLSKMIG-----FYEY----------------------PCSENDS-IKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF--NINFFSCILCIIFPFL 2263
            + D+ +  +  I +N+ +I++++ +    ED D  +L  L++        N N  + +L L +TWNRVDI K ++F+G I    +E    + D++   K +F+ L ++N  NI  +LT N L+ LY    +TC   T    +  +   + I + +   L +V +LL+ + G     FY+                        C+  D   KHP+  LF+WAVL  +++ A FFW  C ES+  AL   ++     +  + +T+   +++     FE +A  +   C+      +  L+ +K++ WG  +CL++A  +    F S+   Q  +   W         F+  +L +I P L
Sbjct:  358 KTDKLVDKVLSIYQNKDIISIYNAEQEGAEDFDIVMLKVLVQASKRNVSENTNSYADELRLAVTWNRVDIAKSELFNGHIDWKYEELKDSMTDALENNKPQFVRLLIDNGLNISTYLTYNRLEILYNSISDTCLAKTLLLHHLNERIHQSIKQIYKISLYEVSQLLTDLFGEVCLPFYKAELKLEATTKRKALKNACDVLNGSCTYRDEKCKHPWLCLFIWAVLQNRREMAIFFWEMCGESVLTALAGCKLLLELSKQEI-ETEAKLSMKELALKFEQMAHDVFGTCYQTKASHSYKLLIRKSKLWGDATCLKMAIAADARIFFSHDGVQSLLSQIWWGDIERGTAFWRLLLVMICPPL 715          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Zebrafish
Match: hrc (histidine rich calcium binding protein [Source:ZFIN;Acc:ZDB-GENE-041008-189])

HSP 1 Score: 110.538 bits (275), Expect = 1.615e-44
Identity = 83/298 (27.85%), Postives = 149/298 (50.00%), Query Frame = 3
Query:  333 AKCMCGEAKKNHKI----DKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGR-TVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG--YFRQALENKIS-QKQGD-RVGIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQ 1193
             +C CG  + +H+     D    ++   W  ++      TD++G +EF G      + + F+R+S       + +L+   W +    L +SV+GG     ++   +++  QGL+KAA +T A IIT GL +GI+  +G+A++ + + +   +  N  +  +GIAPWG V+NR  L   +G     Y V N        SL+ NH  ++  DDG     + +K G   FR  LE+ IS Q+ G+  + IPV+ +++ G   +  F+E S  +K     +V  G+G  ++++ +    +Q
Sbjct:   44 GRCQCGAMRDDHRSMALGDNFSTAVVSQWLSSQHTSEQPTDAYGDLEFDG---IGRRHSYFLRLSSTTDPARVFDLMKEHWKLQQPNLVVSVVGGEGRSVVKSWVRDVLRQGLVKAAQSTGAWIITGGLRQGISRCVGEAVKDNAAAV-SSITLNKVLP-IGIAPWGLVENRQQLVNLEGSFPARYMVRN--ISPDSCSLDNNHKAFLLVDDG----TSGRKGGELAFRACLEDYISRQRPGNASIDIPVLNMLIAGDTSMLEFLEMS--LKNSTPCLVLAGSGGLANLVSDIVENVQ 328          

HSP 2 Score: 91.2781 bits (225), Expect = 1.615e-44
Identity = 90/378 (23.81%), Postives = 170/378 (44.97%), Query Frame = 2
Query: 1304 HQVDEAIKCIEDIIKNELLITVFDIKSH--EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIG--------RPFSKGLNDVKELLSKMIGFYEYP----------------------------CSENDSI-KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF--NINFFSCILCIIFPFLISKRTEFTKDFKTCQSE 2314
            +  D+ +  +  I +N+ +I++++ K    ED +  +L  L++        N N  + +L L +TWNRVDI K ++F+G+I    +E    + D++   K +F+ L +++  NI  +LT   L++LY +   +   +   L  +         + +S  L +V +LL+ ++G   +P                            C   D + KHP+  LF+WAVL  + + A F W  CDES+  AL   ++     +  + +T+   +++     FE +A  +   C+      +  L+ +K++ WG  +CLE+A  +    F S+   Q  +   W          +  +L II P +    + F +  KT Q+E
Sbjct:  363 NDTDKLVDKVLSIYQNKDIISIYNAKQEGAEDFEIVMLKVLVQASKRNVSENTNSYADELRLAVTWNRVDIAKSELFNGNIDWKYEELVDSMTDALENNKPQFVRLLIDSGLNILSYLTYGRLEKLYNSISDTCLAKTLLLHHLDERMHESNVQIYSISLYEVSQLLTDLLGEVCHPFYWTELKLEASSTRRKSMKKACRILMGSCKYRDEMCKHPWFCLFIWAVLQNRSEMAIFCWEMCDESVLTALAGCKLLLELSKQEI-ETEAKLSMKELALKFERMAHDVFGTCYLSKASHSYKLLIRKSKLWGDATCLEMAIAADAQIFFSHDGVQSLLSQIWWGDIERGTPLWRILLVIICPPVC--YSNFIEYRKTDQAE 737          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Zebrafish
Match: trpm1a (transient receptor potential cation channel, subfamily M, member 1a [Source:ZFIN;Acc:ZDB-GENE-070112-1372])

HSP 1 Score: 157.147 bits (396), Expect = 6.867e-42
Identity = 110/307 (35.83%), Postives = 169/307 (55.05%), Query Frame = 3
Query:  432 ISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTV---HYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKTF*NENSLSRIFLSYIKLMK 1319
            + TDS+G IEF G    N  +  ++RVSY+ K D++L L+   W + + TL ISV GG  +F ++ K K +F +GLIKAA+TT A I T G++ G+   +GDA++   S      K    +  +GIAPWG V+N+   E   GR V   +  +SN + K     LN +H+H+I  D+G     T  K G     R+ LE  IS QK   R+  G+P+V LI+EGG ++   +  S R    V +VVC+G+G+ASDII  A +  ++    +  +R   +  + ++F    N N   +I+L  ++ MK
Sbjct:    1 MPTDSYGIIEFQGGGHINKAM--YIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVSTGVIRHVGDALKDHSS------KSRGKVCAIGIAPWGIVENK---EDLIGRDVTRPYQTMSNPLSKLS--VLNNSHSHFILADNG-----THGKYGAEVRLRRQLEKHISLQKINTRLGQGVPLVCLILEGGPNVISIVLESLREDPPVPVVVCDGSGRASDIISFAHKYSEQDGLVNDSVRDQLLVTIQKTFNY--NRNQAQQIYLMVMECMK 287          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Zebrafish
Match: trpm1a (transient receptor potential cation channel, subfamily M, member 1a [Source:ZFIN;Acc:ZDB-GENE-070112-1372])

HSP 1 Score: 156.762 bits (395), Expect = 1.352e-41
Identity = 110/307 (35.83%), Postives = 169/307 (55.05%), Query Frame = 3
Query:  432 ISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTV---HYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKTF*NENSLSRIFLSYIKLMK 1319
            + TDS+G IEF G    N  +  ++RVSY+ K D++L L+   W + + TL ISV GG  +F ++ K K +F +GLIKAA+TT A I T G++ G+   +GDA++   S      K    +  +GIAPWG V+N+   E   GR V   +  +SN + K     LN +H+H+I  D+G     T  K G     R+ LE  IS QK   R+  G+P+V LI+EGG ++   +  S R    V +VVC+G+G+ASDII  A +  ++    +  +R   +  + ++F    N N   +I+L  ++ MK
Sbjct:    1 MPTDSYGIIEFQGGGHINKAM--YIRVSYDTKPDNLLHLMVKDWQLELPTLLISVHGGLQNFDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVSTGVIRHVGDALKDHSS------KSRGKVCAIGIAPWGIVENK---EDLIGRDVTRPYQTMSNPLSKLS--VLNNSHSHFILADNG-----THGKYGAEVRLRRQLEKHISLQKINTRLGQGVPLVCLILEGGPNVISIVLESLREDPPVPVVVCDGSGRASDIISFAHKYSEQDGLVNDSVRDQLLVTIQKTFNY--NRNQAQQIYLMVMECMK 287          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 156.762 bits (395), Expect = 1.021e-75
Identity = 104/269 (38.66%), Postives = 153/269 (56.88%), Query Frame = 3
Query:  405 WKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHY-NVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFR 1184
            W  ++  ++  TD+FG +EF G   +N  +  ++RVSY+ K D +L L+  +W + +  L ISV GG  +F+M+ K K +F +GLIKAA+TT A I T G++ G+   +GDA++   S      K    I  +GIAPWG V+N+  L   K  T  Y  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV LIVEGG ++   +    R +  V +VVC+G+G+ASDI+  A +
Sbjct:   20 WSISKHTQLSPTDAFGILEFQGGGHSNKAM--YIRVSYDSKPDSLLHLMVKEWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVIRHVGDALKDHSS------KSRGRICAIGIAPWGIVENKEDL-IGKDVTKPYQTMSNPLSKLS--VLNSSHTHFILADNG-----TLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVALIVEGGPNVITIVLECLREEPPVPVVVCDGSGRASDIMSFAHK 272          

HSP 2 Score: 149.828 bits (377), Expect = 1.021e-75
Identity = 165/641 (25.74%), Postives = 298/641 (46.49%), Query Frame = 2
Query: 1304 HQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYET--CPKST------NFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPC--------------------------------------------SENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDT---DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFP---FLISKRTEFTKDFKTCQ------------------SESFPDFNEDNCRTSIFL--KLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            +Q  + +  + + +K + LITVF + S   +D++ AIL +L+K  +            QLSL L WNRVDI + +IF              + D+++  +V F++L +EN  ++Q FLT   L+ELY T   P +T      + +K     +   +   L D+  +L  ++G   Y C                                             E    K+PF EL +WAVL+++QK A F W + +E++  ALVA ++YK     S       D S+ L+     F  LA++L+++ +  D++VA  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +        I+ I+FP     +  R++    F T +                  S    + N +  + SI +  K+  FY AP  KF  ++ +++++++ F+YV+L  M+R   ++ E + + Y+V + L+K  EI  S   ++  ++K W    +WN  D++ I   ++  +LR Q   N  Y        + + IY + +  +Y+++L +   +K LGP + M+ K++ ++L F  I+L+ L+S+GV  QA  +P  + SW    NI   PY+ ++G
Sbjct:  301 NQAHQLLVVLMECMKKKELITVFRMGSEGQQDIEMAILTALLKGTN-------ASAPDQLSLALAWNRVDIARSQIFVFGHHWPVSSLEQAMMDALVLDRVDFVKLLIENGVSMQRFLTIPRLEELYNTRLGPPNTLHYIVRDVKKVGFGNLPPDYHVSLIDIGLVLEYLMGG-AYRCHYTRKTFRTLYNNLFGPKRDDEPPTKGKKKKKKKEEEIDMDVDDPEVSRFKYPFHELMVWAVLLKRQKMALFLWQRGEETMAKALVACKLYKSMAHESSESELVDDISQDLDNNSKDFGQLALELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILFPPTILFLEFRSQDDLSFHTSKEYEEGKEKEDENMVRNTTSRKGDEENGNRKQKSIPIGTKIYEFYNAPIVKFWFYTISYLAYLMLFNYVILVKMERWP-SVQEWVVISYIVTLALEKVREILMSEPGKLSQKVKVWLQ-EYWNITDLVAISVFLIGAILRLQ---NQPY------MGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYG 922          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 158.688 bits (400), Expect = 2.568e-69
Identity = 168/624 (26.92%), Postives = 292/624 (46.79%), Query Frame = 2
Query: 1304 HQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNF------------------------RKTFLRLIGRPFSKGLNDVKELLSKMIGFY--EYPC-------------------SENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDT---DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFPFLI-------------SKRTEFTKDFKTCQSESFPDFNEDNCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            +Q  + +  + + +K + LITVF + S   +D++ AIL +L+K  +            QLSL L WNRVDI + +IF              + D+++  +V F++L +EN  ++Q FLT   L+ELY T     ++                        RKTF  L    F  G    K L  K++G    E P                     E    K+PF EL +WAVL+++QK A F W + +E++  ALVA ++YK     S       D S+ L+     F  LA++L+++ +  D++VA  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +        I+ I+FP  I                 E+ +D  T +     + N       I  K+  FY AP  KF  ++ +++++++ F+YV+L  M+R   ++ E + + Y+V + L+K  EI  S   ++  ++K W    +WN  D++ I   ++  +LR Q   N  Y        + + IY + +  +Y+++L +   +K LGP + M+ K++ ++L F  I+L+ L+S+GV  QA  +P  + SW    NI   PY+ ++G
Sbjct:  236 NQAHQLLVVLMECMKKKELITVFRMGSEGQQDIEMAILTALLKGTN-------ASAPDQLSLALAWNRVDIARSQIFVFGHHWPVSSLEQAMMDALVLDRVDFVKLLIENGVSMQRFLTIPRLEELYNTGNLPPDYHVSLIDIGLVLEYLMGGAYRCHYTRKTFRTLYNNLF--GPKRPKAL--KLLGMEDDEPPTKGKKKKKKKEEEIDMDVDDPEVSRFKYPFHELMVWAVLLKRQKMALFLWQRGEETMAKALVACKLYKSMAHESSESELVDDISQDLDNNSKDFGQLALELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILFPPTILFLEFRSQDDLSFHTSKEYEED-TTSRKGDEENGNRKQKSIPIGTKIYEFYNAPIVKFWFYTISYLAYLMLFNYVILVKMERWP-SVQEWVVISYIVTLALEKVREILMSEPGKLSQKVKVWLQ-EYWNITDLVAISVFLIGAILRLQ---NQPY------MGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYG 836          

HSP 2 Score: 126.716 bits (317), Expect = 2.568e-69
Identity = 87/221 (39.37%), Postives = 124/221 (56.11%), Query Frame = 3
Query:  549 LFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHY-NVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFR 1184
            +  +W + +  L ISV GG  +F+M+ K K +F +GLIKAA+TT A I T G++ G+   +GDA++   S      K    I  +GIAPWG V+N+  L   K  T  Y  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV LIVEGG ++   +    R +  V +VVC+G+G+ASDI+  A +
Sbjct:    1 MVKEWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVIRHVGDALKDHSS------KSRGRICAIGIAPWGIVENKEDL-IGKDVTKPYQTMSNPLSKLS--VLNSSHTHFILADNG-----TLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVALIVEGGPNVITIVLECLREEPPVPVVVCDGSGRASDIMSFAHK 207          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Xenopus
Match: ENSXETT00000055613.1 (transient receptor potential cation channel subfamily M member 7-like [Source:NCBI gene;Acc:100497855])

HSP 1 Score: 144.05 bits (362), Expect = 3.867e-68
Identity = 157/614 (25.57%), Postives = 286/614 (46.58%), Query Frame = 2
Query: 1358 LITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLI--------------------------------GRPFSKGLNDVKELLSKMIGFY--EYPCSENDSIK----------HPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK-YHQRTSLRDT--DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFPFLI-----------SKRTEFTKDFK---------TCQSESFPDFNEDN--CRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            LITV  I    H+++D  +L +L+K  ++           +L L L W+RVDI K+ IF              + D++I  +V+F++L +EN  ++Q FLT   L ELY     +++   T L+LI                                 R   K    + + LS+  G +      S ND+++          +PF +L +WAVL ++QK A FFW   +ES+  ALVAT++Y+  +Q     D   D SE L+ +   F  LAV+L+++    +  +A  L+  + +NW   +CL+LA  S    F+S+   Q  +   W    N+    ++  I  I FP +I           S   +   D+K         TC  E     + +    R  I  +   FY AP  KF + +  +++F++ +++VVL  M+ +  ++ E + ++ ++   ++K  EIF S + ++  +++ W++ ++ N  D I I+  +V   LR+               R    IY L    +++++L +L+ +++ GP + M+ K++  +     I++I L++YG+  +A  YP  D SW    ++L +PY+ ++G
Sbjct:  368 LITVLHIGPDIHQEIDVDLLKALLKGNNI-------SPIDRLHLALAWDRVDIAKNHIFVRGQQWLVKPLEQVMMDALIMDRVEFVKLLIENGVSMQKFLTIPRLDELYNVVDTNSD---TLLQLILEIKKGNVPGKYKITMMDVGLVIEYLMGGVFRSRYTKKNFKAMYKALSQTSGTHGDSQKSSRNDALEADNQITRPFPYPFNDLLVWAVLTKRQKMALFFWQHGEESMAKALVATKLYRGMYQEAQQSDIIDDSSEKLKKYSKEFGELAVELLDQSFKQNDLMAMKLLTYELKNWSKSTCLKLAVSSRLRTFVSHTCTQMLLNDMWMGRLNMRKNAWYKVISGIFFPPIIPLFDYKTMAQMSHIPQSQDDYKMNLDDKEEITCSVEGIALVSNEGKPKRVPIARRFYAFYHAPIVKFWLSTLVYMAFLMLYAFVVLVKMESLP-SVQEWIVILSILTTGVEKIREIFMSEAGKLTQKLRVWFS-SYLNINDAIAIITFLVGFGLRFG-------------GRDFILIYCLNTIFWFIRLLDILSVNQEAGPYVLMVGKMVMSMFYVVVIMVIVLITYGIPRKAILYPHEDPSWTLAKDVLFHPYFMIYG 956          

HSP 2 Score: 137.117 bits (344), Expect = 3.867e-68
Identity = 100/353 (28.33%), Postives = 177/353 (50.14%), Query Frame = 3
Query:  333 AKCMCGEAKKNHKIDKT---PFSLC-----DPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG---YFRQALENKISQKQ-GDRVG--IPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKTF*NENSLSRIFLSYIKLMKPLNALKIL 1343
             +C CG   K H    +   P         + W  +      STD+FG I+F  +  ++     F+R+S + K++DIL+L+  +W++    L ISV GG   F++  + K  F +G +KAA++T A I T G N G+ + IGDAI+   +    ++ HN  IS +G+APWG ++ R  L        +  + + + K     LN  H+H++  DDG     T  + G     R+ LENK S +Q   + G  +P++ LI+EGG    +     +++   V +VVCEGTG+A+D++    +  +        + S+ ++++ ++F    N+N    +F + +  M+    + +L
Sbjct:   37 VRCCCGRLIKQHAYYASGAGPSGAAHVQESEHWTVDRHTVKSSTDAFGTIDF--QCGSHGYKAKFIRLSDDSKVEDILQLMIKEWHMKRPNLVISVHGGMQKFELHPRFKEAFGKGFVKAAVSTGAWIFTGGTNNGVAAHIGDAIKEYAT----RLTHN--ISIIGVAPWGIIEGRQDLIGNNVMAPYQTLLSPLSKLH--VLNNLHSHFLLVDDG-----TAGRTGGEINLRRELENKTSLQQFNAKTGRHVPMMALILEGGPKTILTVLEYLQQSPPVPVVVCEGTGRAADLLAYVHKHTESSGLLPDGMESNVISIIKKTFTL--NKNEALHLFQTLMCCMQMKELITVL 372          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Xenopus
Match: ENSXETT00000055615.1 (transient receptor potential cation channel subfamily M member 7-like [Source:NCBI gene;Acc:100497855])

HSP 1 Score: 137.117 bits (344), Expect = 5.942e-63
Identity = 100/353 (28.33%), Postives = 178/353 (50.42%), Query Frame = 3
Query:  333 AKCMCGEAKKNHKIDKT---PFSLC-----DPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG---YFRQALENKISQKQGD-RVG--IPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKTF*NENSLSRIFLSYIKLMKPLNALKIL 1343
             +C CG   K H    +   P         + W  +      STD+FG I+F  +  ++     F+R+S + K++DIL+L+  +W++    L ISV GG   F++  + K  F +G +KAA++T A I T G N G+ + IGDAI+   +    ++ HN  IS +G+APWG ++ R  L        +  + + + K     LN  H+H++  DDG     T  + G     R+ LENK S +Q + + G  +P++ LI+EGG    +     +++   V +VVCEGTG+A+D++    +  +        + S+ ++++ ++F    N+N    +F + +  M+    + +L
Sbjct:   37 VRCCCGRLIKQHAYYASGAGPSGAAHVQESEHWTVDRHTVKSSTDAFGTIDF--QCGSHGYKAKFIRLSDDSKVEDILQLMIKEWHMKRPNLVISVHGGMQKFELHPRFKEAFGKGFVKAAVSTGAWIFTGGTNNGVAAHIGDAIKEYAT----RLTHN--ISIIGVAPWGIIEGRQDLIGNNVMAPYQTLLSPLSKLH--VLNNLHSHFLLVDDG-----TAGRTGGEINLRRELENKTSLQQFNAKTGRHVPMMALILEGGPKTILTVLEYLQQSPPVPVVVCEGTGRAADLLAYVHKHTESSGLLPDGMESNVISIIKKTFTL--NKNEALHLFQTLMCCMQMKELITVL 372          

HSP 2 Score: 126.716 bits (317), Expect = 5.942e-63
Identity = 153/649 (23.57%), Postives = 289/649 (44.53%), Query Frame = 2
Query: 1358 LITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELF---------------LENVSNIQDFLTANILKELYE----TCPKS--------------------------TNFRKTFLRLIGRPFSKGLNDVKELLSKMI-------------GFYEYPCSENDSIK----------HPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK-YHQRTSLRDT--DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFPFLI-----------SKRTEFTKDFK---------TCQSESFPDFNEDNC----------RTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRY---QLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            LITV  I    H+++D  +L +L+K  ++           +L L L W+RVDI K+ IF              + D++I  +V+F++L                L+ + N+ D  +  +L+ + E      P                             NF+   +R      SK   + K L  ++                Y+   S ND+++          +PF +L +WAVL ++QK A FFW   +ES+  ALVAT++Y+  +Q     D   D SE L+ +   F  LAV+L+++    +  +A  L+  + +NW   +CL+LA  S    F+S+   Q  +   W    N+    ++  I  I FP +I           S   +   D+K         TC  E       ++           R  I  +   FY AP  KF + +  +++F++ +++VVL  M+ +  ++ E + ++ ++   ++K  EIF S + ++  +++ W++ ++ N  D I I+  +V   LR+      ++  Y +   +F   + IY L    +++++L +L+ +++ GP + M+ K++  +     I++I L++YG+  +A  YP  D SW    ++L +PY+ ++G
Sbjct:  368 LITVLHIGPDIHQEIDVDLLKALLKGNNI-------SPIDRLHLALAWDRVDIAKNHIFVRGQQWLVKPLEQVMMDALIMDRVEFVKLLIENGVSMQKFLTIPRLDELYNVVDTNSDTLLQLILEIKKGNVPGKYKITMMDVGLVIEYLMGGVFRSRYTKKNFKAISIRSPAGGTSKHPQNEKNLGKEVTKDKTRHTHFIQTAQPYKAKSSRNDALEADNQITRPFPYPFNDLLVWAVLTKRQKMALFFWQHGEESMAKALVATKLYRGMYQEAQQSDIIDDSSEKLKKYSKEFGELAVELLDQSFKQNDLMAMKLLTYELKNWSKSTCLKLAVSSRLRTFVSHTCTQMLLNDMWMGRLNMRKNAWYKVISGIFFPPIIPLFDYKTMAQMSHIPQSQDDYKMNLDDKEEITCSVEGIALVKNEHSTGMKNEGKPKRVPIARRFYAFYHAPIVKFWLSTLVYMAFLMLYAFVVLVKMESLP-SVQEWIVILSILTTGVEKIREIFMSEAGKLTQKLRVWFS-SYLNINDAIAIITFLVGFGLRFGGRDFMLDSDYHEDDYIFIAGRLIYCLNTIFWFIRLLDILSVNQEAGPYVLMVGKMVMSMFYVVVIMVIVLITYGIPRKAILYPHEDPSWTLAKDVLFHPYFMIYG 1007          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 120.168 bits (300), Expect = 7.057e-56
Identity = 92/322 (28.57%), Postives = 145/322 (45.03%), Query Frame = 3
Query:  252 RKFVKSNFHSIECRKFSSLEEILDHNNAK-CMCGEAKKNH----KIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKIS-QKQG----DRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFRE 1187
            + ++   F    C  F  +E+  D +  K C CG    NH      D    ++   W   E      TD++G +EF G      K + F+R+S +     +  L+   W I    L +SV+GG  DFKM+   K+I  +GL+KAA +T A I+T G+  GI   +G+A+   + +          +  +GIAPWG V NR  L   KG        + V+     SL+ N++ ++  DDG   QM  +    FR  LE  IS QK G      + IPV+ +++ G   +        K  +  ++  G+G  +D + E   E
Sbjct:   10 QSWIPKLFKKKTCTTF--IEDTKDSSPTKLCQCGALMINHVSVAMEDNFGAAMVSTWNSAEHTTEEPTDAYGDVEFVG---AGRKHSKFIRLSNDTDPASVYSLITYNWKIPPPNLVVSVVGGDGDFKMKTWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAV---RDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDG-PTYSLDNNYSVFLLADDGTHGQMGGETS--FRFRLEEHISRQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNATKSPIPCLLVAGSGGVADCLAEILEE 320          

HSP 2 Score: 120.168 bits (300), Expect = 7.057e-56
Identity = 138/562 (24.56%), Postives = 257/562 (45.73%), Query Frame = 2
Query: 1271 RKLIEQDISELHQVDEAIKCIEDIIKNELLITVF-DIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXX---XXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETC-----------PKSTNFRKT---------FLRLIGRPFSKGLNDVKELLSKMIG-----FYEYPCS----ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTW--RAGFNINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFN--EDNCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQ---LTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKE 2836
            R LIE+ +      +   K +E I++N  L+TV+ D    ED +  IL +L+K     C  + +       +L L + WNR DI K ++F G+I     +    + D++I  K KF++LF++N  NI D+LT   L+ELY +             K    R +         F+   G+     L +V ++L  ++G     FY +  +    +      P+ +LF+WA+L  + + A +FW    E++  AL A +I K   R    + + S  +      FE LA+ +  EC+   +  A  L+ +++  WGG +CL+LA ++    F +    Q  +   W  +   N   ++ +L    P LI   T+    F + +    P+    ++  R     + ++F+ AP T F  +   + +F+  FSYV+L   K          E +   ++  M+ ++  + F   +  +  ++K +   + WN VD+I +   I+ ++ R       ++ +    F   +TI       F L+++ + A +K+LGPKI ++ K++K+
Sbjct:  328 RGLIEEKLKHYFPNENLTKMVERIVENRDLVTVYSDADGIEDFETVILKALVK----ACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATDLDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTHQIAVEKYQPRKSTSPWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKELSRME-SEAEESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTFFCPPLI--YTDLIT-FNSVEQNGAPEAEIIKEKQRPRWMQRWKQFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPDGPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQ-DSWNHVDIIALCLFIIGLICR-------MFNES---FEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKD 870          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Mouse
Match: Trpm1 (transient receptor potential cation channel, subfamily M, member 1 [Source:MGI Symbol;Acc:MGI:1330305])

HSP 1 Score: 160.229 bits (404), Expect = 2.458e-41
Identity = 117/357 (32.77%), Postives = 178/357 (49.86%), Query Frame = 3
Query:  186 KITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDP----------------WKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFR 1184
            K++ S +   I+ S +  +   + +++  F   EC     +    D N  +C CG+    H     P     P                W  ++  +   TDS+G +EF G   +N  +  ++RVSY+ K D +L L+   W + +  L ISV GG   F+M+ K K +F +GLIKAA+TT A I T G++ G+ S +GDA++   S      K    +  +GIAPWG V+N+  L       V+  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV L+VEGG ++       +KE   V +VVC+G+G+ASDI+  A +
Sbjct:    6 KMSSSFKRGSIKSSTSGSQKGQKAWIEKTFCKREC--IFVIPSTKDPN--RCCCGQLTNQHI---PPLPSGAPSTTGEDTKQADTQSGKWSVSKHTQSYPTDSYGILEFQGGGYSNKAM--YIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQSFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVVSHVGDALKDHSS------KSRGRLCAIGIAPWGMVENKEDLIGKDVTRVYQTMSNPLSKLS--VLNNSHTHFILADNG-----TLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVGLVVEGGPNVVSIVLEYLKEDPPVPVVVCDGSGRASDILSFAHK 340          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Mouse
Match: Trpm6 (transient receptor potential cation channel, subfamily M, member 6 [Source:MGI Symbol;Acc:MGI:2675603])

HSP 1 Score: 160.999 bits (406), Expect = 1.374e-39
Identity = 110/341 (32.26%), Postives = 179/341 (52.49%), Query Frame = 3
Query:  252 RKFVKSNFHSIECRKF--SSLEE-------ILDHNNAKCMCGEA-KKNHKIDKTPFSLC-------DPWKENESMEVISTDSFGKIEFF-GEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYF------RQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQ 1193
            + +++  F+  EC KF  SS +         + HN  +C CG   +++H +D+  ++L        + W   +      TD+FG I F  GE I ++K   ++R S++ K D +L L+  +WN+ +  L ISV GG  +FK+  K K  F QGL+KAA TT A IIT G+N G++  +GDA++   S    K      I  +GI PWG ++N+  L       ++  + N + K    +LN  H+H+I  DDG         VG +      R+ LE  +S ++     R G+PVV L++EGG ++ +     VK K  +VVCEGTG+A+D++   ++ ++
Sbjct:    5 KSWIEGVFYKRECNKFIPSSKDPHRCTPGCQICHNLVRCYCGRLIEEHHGLDRA-WNLSVTEGHGDEQWSVEKHTVKSPTDTFGTINFQDGEHIHHSK---YIRTSWDTKSDHLLHLMLKEWNMELPKLVISVHGGLQNFKISSKLKETFSQGLVKAAETTGAWIITEGINSGVSKHVGDALKAHSSKSLRK------IWTVGIPPWGVIENQRELVGKDVVCMYQTLGNPLSK--LTTLNCMHSHFILCDDG--------TVGMYGNEEKLRRNLEKHLSMQKIHTCSRQGVPVVGLVMEGGPNVILWVWETVKNKEPVVVCEGTGRAADLLAFTYKHLE 325          

HSP 2 Score: 70.8626 bits (172), Expect = 9.474e-12
Identity = 41/152 (26.97%), Postives = 78/152 (51.32%), Query Frame = 2
Query: 1829 HPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDT---DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI 2266
            +P+ +L +WAVLM++Q  A FFW   +E+   A++A+ +Y+   R +       D SE L+ +   F  LA+ ++E+    ++ +A  L+  + +NW   +CL+LA       F+S+   Q  +   W     +   ++   I+ I+ P +I
Sbjct:  612 YPYNDLLVWAVLMKRQNMAMFFWQHGEEATVKAVIASILYRAMAREAKESNMVDDTSEELKNYSEQFGQLALDVLEKAFKQNEPMAMKLLTYELKNWSNSTCLKLAVSGGLRPFVSHSCTQMLLTDMWMGRLKMRKNSWLKIIISILLPPMI 763          

HSP 3 Score: 59.3066 bits (142), Expect = 3.518e-8
Identity = 45/123 (36.59%), Postives = 65/123 (52.85%), Query Frame = 2
Query: 1361 ITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLR 1723
            IT+FD  S  H+DLD AIL +L+K   L        +S QL+L + W+R+DI K  I +             + D+++  +V F++L +EN  N+  FLT   L+ELY T    TN    FLR
Sbjct:  370 ITIFDADSEEHQDLDLAILTALLKGTSL-------SISEQLNLAMAWDRMDIAKKHILTYGQHWKPGALEQAMLDALVMDRVDFVKLLIENGVNLHRFLTIPRLEELYNTKQGPTN---KFLR 482          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Mouse
Match: Trpm6 (transient receptor potential cation channel, subfamily M, member 6 [Source:MGI Symbol;Acc:MGI:2675603])

HSP 1 Score: 160.999 bits (406), Expect = 4.226e-39
Identity = 110/341 (32.26%), Postives = 179/341 (52.49%), Query Frame = 3
Query:  252 RKFVKSNFHSIECRKF--SSLEE-------ILDHNNAKCMCGEA-KKNHKIDKTPFSLC-------DPWKENESMEVISTDSFGKIEFF-GEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYF------RQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQ 1193
            + +++  F+  EC KF  SS +         + HN  +C CG   +++H +D+  ++L        + W   +      TD+FG I F  GE I ++K   ++R S++ K D +L L+  +WN+ +  L ISV GG  +FK+  K K  F QGL+KAA TT A IIT G+N G++  +GDA++   S    K      I  +GI PWG ++N+  L       ++  + N + K    +LN  H+H+I  DDG         VG +      R+ LE  +S ++     R G+PVV L++EGG ++ +     VK K  +VVCEGTG+A+D++   ++ ++
Sbjct:    5 KSWIEGVFYKRECNKFIPSSKDPHRCTPGCQICHNLVRCYCGRLIEEHHGLDRA-WNLSVTEGHGDEQWSVEKHTVKSPTDTFGTINFQDGEHIHHSK---YIRTSWDTKSDHLLHLMLKEWNMELPKLVISVHGGLQNFKISSKLKETFSQGLVKAAETTGAWIITEGINSGVSKHVGDALKAHSSKSLRK------IWTVGIPPWGVIENQRELVGKDVVCMYQTLGNPLSKL--TTLNCMHSHFILCDDG--------TVGMYGNEEKLRRNLEKHLSMQKIHTCSRQGVPVVGLVMEGGPNVILWVWETVKNKEPVVVCEGTGRAADLLAFTYKHLE 325          

HSP 2 Score: 96.2857 bits (238), Expect = 2.196e-19
Identity = 109/462 (23.59%), Postives = 212/462 (45.89%), Query Frame = 2
Query: 1829 HPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDT---DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEF-----TKDFK------------TCQSESFPDFN-----EDNCRTSIFLKLR-------------RFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEP-PPVTFVKIFME 3073
            +P+ +L +WAVLM++Q  A FFW   +E+   A++A+ +Y+   R +       D SE L+ +   F  LA+ ++E+    ++ +A  L+  + +NW   +CL+LA       F+S+   Q  +   W     +   ++   I+ I+ P +I       + E      ++DF+            T +S    D++     ++     + L LR              FY AP  KF  ++  +++F++ F+Y VL  M+  Q ++HE + +IY+    ++K  EI  S   +   ++K W +  +WN ++ + I    V   LR+             +    + IY + +  ++ +++   A ++  GP + M++K+   +     I+ I LLS+GV  +A   P+   SW    +I+  PY+ M+G       VY +  +  +N    PP +F+  F++
Sbjct:  612 YPYNDLLVWAVLMKRQNMAMFFWQHGEEATVKAVIASILYRAMAREAKESNMVDDTSEELKNYSEQFGQLALDVLEKAFKQNEPMAMKLLTYELKNWSNSTCLKLAVSGGLRPFVSHSCTQMLLTDMWMGRLKMRKNSWLKIIISILLPPMILTLEFKSKAEMSHVPQSQDFQFTWNYSDQGLSNTKESACVKDYDLERGPDEKPDEPLHLDLRNVPQSLPWTRRVYEFYSAPFVKFWFYTMAYLAFLMLFTYTVLVEMQP-QPSVHEWLVIIYIFTNAIEKVREICISEPSKFKQKVKMWLS-EYWNLMETVAIGLFAVGFGLRW---------GHPPLQTAGRLIYCIDIIFWFSRLMDFFAVNQHAGPYVTMIAKMAANMFYIVIIMAIVLLSFGVARKAILSPKEPPSWRLARDIVFEPYWMMYG------EVYASDIDVCSNETSCPPGSFLTPFLQ 1056          

HSP 3 Score: 59.3066 bits (142), Expect = 3.925e-8
Identity = 45/123 (36.59%), Postives = 65/123 (52.85%), Query Frame = 2
Query: 1361 ITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLR 1723
            IT+FD  S  H+DLD AIL +L+K   L        +S QL+L + W+R+DI K  I +             + D+++  +V F++L +EN  N+  FLT   L+ELY T    TN    FLR
Sbjct:  370 ITIFDADSEEHQDLDLAILTALLKGTSL-------SISEQLNLAMAWDRMDIAKKHILTYGQHWKPGALEQAMLDALVMDRVDFVKLLIENGVNLHRFLTIPRLEELYNTKQGPTN---KFLR 482          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Mouse
Match: Trpm1 (transient receptor potential cation channel, subfamily M, member 1 [Source:MGI Symbol;Acc:MGI:1330305])

HSP 1 Score: 160.229 bits (404), Expect = 5.873e-39
Identity = 117/357 (32.77%), Postives = 178/357 (49.86%), Query Frame = 3
Query:  186 KITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDP----------------WKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFR 1184
            K++ S +   I+ S +  +   + +++  F   EC     +    D N  +C CG+    H     P     P                W  ++  +   TDS+G +EF G   +N  +  ++RVSY+ K D +L L+   W + +  L ISV GG   F+M+ K K +F +GLIKAA+TT A I T G++ G+ S +GDA++   S      K    +  +GIAPWG V+N+  L       V+  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV L+VEGG ++       +KE   V +VVC+G+G+ASDI+  A +
Sbjct:    6 KMSSSFKRGSIKSSTSGSQKGQKAWIEKTFCKREC--IFVIPSTKDPN--RCCCGQLTNQHI---PPLPSGAPSTTGEDTKQADTQSGKWSVSKHTQSYPTDSYGILEFQGGGYSNKAM--YIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQSFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVVSHVGDALKDHSS------KSRGRLCAIGIAPWGMVENKEDLIGKDVTRVYQTMSNPLSKLS--VLNNSHTHFILADNG-----TLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVGLVVEGGPNVVSIVLEYLKEDPPVPVVVCDGSGRASDILSFAHK 340          

HSP 2 Score: 115.931 bits (289), Expect = 2.348e-25
Identity = 115/415 (27.71%), Postives = 203/415 (48.92%), Query Frame = 2
Query: 1826 KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDT---DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFPFLI---------------SKRTEFTKDFKTCQSESFPDF--------NEDNCRTSIFL--KLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            ++PF EL +WAVLM++QK A F W + +E +  ALVA ++YK     S       D S+ L+     F  LAV+L+++ +  D++VA  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +        I+ I+ P  I               SK  E  K+ +    ++  D         NE   + SI +  K+  FY AP  KF  ++ +++ +++ F+YV+L  M     +  E + + Y+V + L+K  EI  S   ++  +IK W    +WN  D++ I   +V  +LR Q               + + IY + +  +Y+++L +   +K LGP + M+ K++ ++L F  I+L+ L+S+GV  QA  +P+   SW    NI   PY+ ++G
Sbjct:  654 QYPFHELMVWAVLMKRQKMAVFLWQRGEECMAKALVACKLYKAMAHESSESELVDDISQDLDNNSKDFGQLAVELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILIPPTILFLEFRTYDDFSYQTSKENEDGKEKEEENVDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWP-SPQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQ-EYWNITDLVAISMFMVGAILRLQ---------SQPYMGYGRVIYCVDIILWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYG 1057          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Mouse
Match: Trpm1 (transient receptor potential cation channel, subfamily M, member 1 [Source:MGI Symbol;Acc:MGI:1330305])

HSP 1 Score: 160.229 bits (404), Expect = 6.522e-39
Identity = 117/357 (32.77%), Postives = 178/357 (49.86%), Query Frame = 3
Query:  186 KITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDP----------------WKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFR 1184
            K++ S +   I+ S +  +   + +++  F   EC     +    D N  +C CG+    H     P     P                W  ++  +   TDS+G +EF G   +N  +  ++RVSY+ K D +L L+   W + +  L ISV GG   F+M+ K K +F +GLIKAA+TT A I T G++ G+ S +GDA++   S      K    +  +GIAPWG V+N+  L       V+  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV L+VEGG ++       +KE   V +VVC+G+G+ASDI+  A +
Sbjct:    6 KMSSSFKRGSIKSSTSGSQKGQKAWIEKTFCKREC--IFVIPSTKDPN--RCCCGQLTNQHI---PPLPSGAPSTTGEDTKQADTQSGKWSVSKHTQSYPTDSYGILEFQGGGYSNKAM--YIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQSFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVVSHVGDALKDHSS------KSRGRLCAIGIAPWGMVENKEDLIGKDVTRVYQTMSNPLSKLS--VLNNSHTHFILADNG-----TLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVGLVVEGGPNVVSIVLEYLKEDPPVPVVVCDGSGRASDILSFAHK 340          

HSP 2 Score: 115.931 bits (289), Expect = 2.433e-25
Identity = 115/415 (27.71%), Postives = 203/415 (48.92%), Query Frame = 2
Query: 1826 KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDT---DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFPFLI---------------SKRTEFTKDFKTCQSESFPDF--------NEDNCRTSIFL--KLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            ++PF EL +WAVLM++QK A F W + +E +  ALVA ++YK     S       D S+ L+     F  LAV+L+++ +  D++VA  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +        I+ I+ P  I               SK  E  K+ +    ++  D         NE   + SI +  K+  FY AP  KF  ++ +++ +++ F+YV+L  M     +  E + + Y+V + L+K  EI  S   ++  +IK W    +WN  D++ I   +V  +LR Q               + + IY + +  +Y+++L +   +K LGP + M+ K++ ++L F  I+L+ L+S+GV  QA  +P+   SW    NI   PY+ ++G
Sbjct:  654 QYPFHELMVWAVLMKRQKMAVFLWQRGEECMAKALVACKLYKAMAHESSESELVDDISQDLDNNSKDFGQLAVELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILIPPTILFLEFRTYDDFSYQTSKENEDGKEKEEENVDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWP-SPQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQ-EYWNITDLVAISMFMVGAILRLQ---------SQPYMGYGRVIYCVDIILWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYG 1057          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. UniProt/SwissProt
Match: sp|A0A0R4IMY7|TRPM2_DANRE (Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 3.659e-61
Identity = 96/339 (28.32%), Postives = 158/339 (46.61%), Query Frame = 3
Query:  183 FKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNH--KIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ-KQGDR---VGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIG 1172
              ++ +  G ++  S + ++     ++K N    EC  +     + D     C CG  K  H  +  K    + + W ++  +    TD+FG I F G      K   +VRVS +   +++ +L+  +W +    L ISV GG  +F ++   K+ F +GLIK A TT A I+T G + G+   +G A+   + Y          I  +G+APWG + NR+ L   +GR   Y   +E  + +   L+ NHTH++  DDG     T+   G     R  LE  IS+   G+R   V IPVV ++++GG          +      VV EG+G+ +D+I 
Sbjct:   14 LAVSTAKGGRYLSLSPSFQRCSLASWIKENIKKKECCFY-----VEDGREGICKCGYPKVQHCDEAIKPEDYMGEQWDKHRHVRETPTDAFGDISFGG---LGQKTGKYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVAQTTGAWILTGGTHAGVMKHVGMAV---RDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVDDG-----TQGHYGVEIELRARLEKLISKLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIA 336          

HSP 2 Score: 126.331 bits (316), Expect = 3.659e-61
Identity = 161/680 (23.68%), Postives = 313/680 (46.03%), Query Frame = 2
Query: 1262 VLKRKLIEQ--DISELHQVDEAIKCIEDIIKNELLITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLT-ANILKELYETCPKSTNFRKTFLRLIGRPFSKG-----------LNDVKELLSKMIGFY---------------------------EYPCSEN----DSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIY-KYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN--FFSCILCIIF-PFL------------ISKRTEFTKDFKTCQSESFPDFNED------------------NCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD-FSWIALSNILDYPYYTMFG--VLNLGNTVY-FTWC--NASTNYEP 3040
            +LKR  +++  + +EL Q+ E  K I+DI++   L+TVF I   +  D+D AIL +L+K       + ++    QL L + WNRVDI + +IF+ +   ++ +    +  +++  K +F+ L LEN   +++FL     L ELY   P     RK   R+ G    +G           L+ V E +  ++G +                           + PCS      D++  P ++LFLWAV+   ++ A+  W +C + +  AL A++I  K  Q +   D++ +  +    N++E  A+ +  ECH  D + A  L+ + + +WG  +CL LA ++ D  F+++   Q  +   W    +++   +  +LC+IF P +            I ++ E T+  K      F   ++                   NC +    +L  F  +PQ KF  +  ++  F+  F+ V++   +    +  E++  ++L  ++ ++  +++       + R    +  + WN +D++ IV  I  ++ R Q +    Y  KV++          I+  F L+++ + +  + LGPKI ++ +++ +L  F  ++ I++++YGV  Q       +  +WI    + + PY T+FG    N+ NT++  + C  NAS   +P
Sbjct:  354 LLKRFFMQEYKNFTEL-QIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADTVWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGKIKRHLRGFSQKSELKPLNCSS----RLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQ-TSPSWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQASDTVFYIGKVIL------CIDFII--FCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWVVAYGVAKQGILIENEERLNWIIRGAVYE-PYITIFGNFPTNIDNTLFDISSCSVNASDPLKP 1018          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. UniProt/SwissProt
Match: sp|Q9BX84|TRPM6_HUMAN (Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2)

HSP 1 Score: 164.081 bits (414), Expect = 7.267e-50
Identity = 109/324 (33.64%), Postives = 167/324 (51.54%), Query Frame = 3
Query:  324 HNNAKCMCGEAKKNHK-IDKTPFSLCDPWKENESMEV------ISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG---YFRQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESF 1256
             N  +C CG    +H  ID +        KE+E   V        TD+FG I F  +D  +T    ++R SY+ KLD +L L+  +W + +  L ISV GG  +F M  K K IF QGL+KAA TT A IIT G+N G++  +GDA++   S+   K      I  +GI PWG ++N+  L       ++  + N + K    +LN  H+H+I  DDG     T  K G     R+ LE  +S ++     R G+PVV L+VEGG ++ +     VK+K  +VVCEGTG+A+D++    + +         ++ + + M+  +F
Sbjct:   47 QNLIRCYCGRLIGDHAGIDYSWTISAAKGKESEQWSVEKHTTKSPTDTFGTINF--QDGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKMELPKLVISVHGGIQNFTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSHSSHSLRK------IWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKL--TTLNSMHSHFILSDDG-----TVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVILSVWETVKDKDPVVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICMIQNTF 355          

HSP 2 Score: 58.151 bits (139), Expect = 7.267e-50
Identity = 43/116 (37.07%), Postives = 61/116 (52.59%), Query Frame = 2
Query: 1361 ITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN 1702
            IT+FD  S E  DLD AIL +L+K  +L         S QL+L + W+RVDI K  I   +     D     + D+++  +V F++L +E   N+  FLT   L+ELY T    TN
Sbjct:  379 ITIFDADSEEQQDLDLAILTALLKGTNL-------SASEQLNLAMAWDRVDIAKKHILIYEQHWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELYNTKQGPTN 487          

HSP 3 Score: 77.0258 bits (188), Expect = 1.309e-12
Identity = 95/398 (23.87%), Postives = 173/398 (43.47%), Query Frame = 2
Query: 1811 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLISKRTEFTKDFKT-------CQSESF------PDFNEDNCRTSIFLK---LRR-----------------------------FYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRW--------SKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKI 2827
            E+    +P+ +L +WAVLM++QK A FFW   +E+   A++A  +Y+   +  + S    D SE L+ +   F  LA+ L+E+    ++ +A  L+  +  NW   +CL+LA       F+S+   Q  +   W     +   ++   I+ II P  I      T +FK+        QS+ F       D N  + + S  +K   L R                             FY AP  KF  ++  +++F++ F+Y VL  M+  Q ++ E +  IY+    ++   EI  S   +   ++K W +  +WN               L   +AI G+++   V+ RW         + IY + +  ++ ++L   A ++  GP + M++K+
Sbjct:  600 ESTGFLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPPTI-----LTLEFKSKAEMSHVPQSQDFQFMWYYSDQNASSSKESASVKEYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYEFYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQP-QPSVQEWLVSIYIFTNAIEVVREICISEPGKFTQKVKVWIS-EYWN---------------LTETVAI-GLFSAGFVL-RWGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKM 973          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. UniProt/SwissProt
Match: sp|Q2WEA5|TRPM1_RAT (Transient receptor potential cation channel subfamily M member 1 OS=Rattus norvegicus OX=10116 GN=Trpm1 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 5.540e-42
Identity = 117/354 (33.05%), Postives = 180/354 (50.85%), Query Frame = 3
Query:  186 KITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNH---KIDKTPFSLCD----------PWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFR 1184
            K++ S +   I+ S +  +   + +++  F   EC     +    D N  +C CG+    H       TP S  +           W  ++  +   TDS+G +EF G   +N  +  ++RVSY+ K D +L L+   W + +  L ISV GG   F+M+ K K +F +GLIKAA+TT A I T G++ G+ S +GDA++   S      K    +  +GIAPWG V+N+  L       V+  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV L+VEGG ++       ++E   V +VVC+G+G+ASDI+  A +
Sbjct:    6 KMSSSFKRGSIKSSTSGSQKGQKAWIEKTFCKREC--IFVIPSTKDPN--RCCCGQLTNQHIPPLPSVTPSSTAEDTKQGDAQSGKWSVSKHTQSYPTDSYGILEFQGGGYSNKAM--YIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQSFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVVSHVGDALKDHSS------KSRGRLCAIGIAPWGMVENKEDLVGKDVTRVYQTMSNPLSKLS--VLNNSHTHFILADNG-----TLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVGLVVEGGPNVVSIVLEYLREDPPVPVVVCDGSGRASDILSFAHK 340          

HSP 2 Score: 34.6538 bits (78), Expect = 5.540e-42
Identity = 29/80 (36.25%), Postives = 45/80 (56.25%), Query Frame = 2
Query: 1295 SELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIF 1528
            S+ HQ+      I + +K + L+TVF + S   +D++ AIL +L+K  ++           QLSL L WNRVDI + +IF
Sbjct:  369 SQSHQL---FAIIMECMKKKELVTVFRMGSEGQQDVEMAILTALLKGTNV-------SAPDQLSLALAWNRVDIARSQIF 438          

HSP 3 Score: 118.242 bits (295), Expect = 3.494e-25
Identity = 117/415 (28.19%), Postives = 205/415 (49.40%), Query Frame = 2
Query: 1826 KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDT---DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFPFLI---------------SKRTEFTKDFKTCQSESFPDF--------NEDNCRTSIFL--KLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            ++PF EL +WAVLM++QK A F W + +E +  ALVA ++YK     S       D S+ L+     F  LAV+L+++ +  D++VA  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +        I+ I+ P  I               SK  E  K+ +    ++  D         NE   + SI +  K+  FY AP  KF  ++ +++ +++ F+YV+L  M     +  E + + Y+V + L+K  EI  S   ++  +IK W    +WN  D++ I   +V  +LR Q   N  Y        + + IY + +  +Y+++L +   +K LGP + M+ K++ ++L F  I+L+ L+S+GV  QA  +P+   SW    NI   PY+ ++G
Sbjct:  654 QYPFHELMVWAVLMKRQKMAVFLWQRGEECMAKALVACKLYKAMAHESSESELVDDISQDLDNNSKDFGQLAVELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILIPPTILFLEFRSYDDFSYQTSKENEDGKEKEEENVDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWP-SPQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQ-EYWNITDLVAISMFMVGAILRLQ---NQPY------MGYGRVIYCVDIILWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYG 1057          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. UniProt/SwissProt
Match: sp|Q93971|TRPG_CAEEL (Transient receptor potential channel OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=4)

HSP 1 Score: 135.576 bits (340), Expect = 2.530e-39
Identity = 109/412 (26.46%), Postives = 192/412 (46.60%), Query Frame = 3
Query:  144 INDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHK------------------IDK-----------------TPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVK--EKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK 1259
            +N++ SA+   A+  +  +   + +RF+E++       +V+  F   EC +F +    L     KC CG  +  H+                  +++                 T     + W   +    ++T++FG++EF G    +     +VRV+++ +   I+ L  + W I+   L I+V GGT +F ++ K   +F +GL+KAA TT A IIT G + G+   +  A++ +QS         N I C+GIAPWG +K R      + +TV Y  S+   K +   LN  H++++  D+G   +   + +   R+ LE  ISQKQ   G    +PVV +++EGG          V    +V +VVC+G+G+A+D++  A          H+ +  DG  +LP+  +
Sbjct:  247 LNEDVSATANSAQL-VLPTPLFNQMRFTESNMSLNRHNWVRETFTRRECSRFIASSRDLH----KCGCGRTRDAHRNIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGG--PHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQS------AQRNKIVCIGIAPWGLLKKREDF-IGQDKTVPYYPSS--SKGRFTGLNNRHSYFLLVDNGTVGRYGAEVI--LRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFA----------HQNVTEDG--LLPDDIR 628          

HSP 2 Score: 51.2174 bits (121), Expect = 2.530e-39
Identity = 49/157 (31.21%), Postives = 78/157 (49.68%), Query Frame = 2
Query: 1358 LITVFDI--KSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGFYEYPCS 1810
            L+T+F +  +   D+D AIL +L+K  +L         + QL+L L WNRVDI +  +F+             + +++I  +V F+ L LE   N+Q FLT + L ELY T     N     +R + R   +G    L D+  ++ K++G   Y CS
Sbjct:  662 LLTIFRLGEQGEHDVDHAILTALLKGQNLS-------AADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVR-VRQGYRFKLPDIGLVIEKLMG-NSYQCS 809          

HSP 3 Score: 73.559 bits (179), Expect = 1.246e-11
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 2
Query: 1826 KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFEN---LAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFS---CILCIIFPFLI 2266
            ++P+ EL +WAVL ++Q  A   W   +E++  ALVA R+YK     +  D    E  E  K Y E    L+++L++ C+ +D      L+  +  NW   +CL LA    +  F+++  CQ  +   W  G  +   S    +L +I P  I
Sbjct:  950 RYPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFI 1102          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. UniProt/SwissProt
Match: sp|Q8CIR4|TRPM6_MOUSE (Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 2.956e-38
Identity = 110/341 (32.26%), Postives = 179/341 (52.49%), Query Frame = 3
Query:  252 RKFVKSNFHSIECRKF--SSLEE-------ILDHNNAKCMCGEA-KKNHKIDKTPFSLC-------DPWKENESMEVISTDSFGKIEFF-GEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYF------RQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQ 1193
            + +++  F+  EC KF  SS +         + HN  +C CG   +++H +D+  ++L        + W   +      TD+FG I F  GE I ++K   ++R S++ K D +L L+  +WN+ +  L ISV GG  +FK+  K K  F QGL+KAA TT A IIT G+N G++  +GDA++   S    K      I  +GI PWG ++N+  L       ++  + N + K    +LN  H+H+I  DDG         VG +      R+ LE  +S ++     R G+PVV L++EGG ++ +     VK K  +VVCEGTG+A+D++   ++ ++
Sbjct:    5 KSWIEGVFYKRECNKFIPSSKDPHRCTPGCQICHNLVRCYCGRLIEEHHGLDRA-WNLSVTEGHGDEQWSVEKHTVKSPTDTFGTINFQDGEHIHHSK---YIRTSWDTKSDHLLHLMLKEWNMELPKLVISVHGGLQNFKISSKLKETFSQGLVKAAETTGAWIITEGINSGVSKHVGDALKAHSSKSLRK------IWTVGIPPWGVIENQRELVGKDVVCMYQTLGNPLSKL--TTLNCMHSHFILCDDG--------TVGMYGNEEKLRRNLEKHLSMQKIHTCSRQGVPVVGLVMEGGPNVILWVWETVKNKEPVVVCEGTGRAADLLAFTYKHLE 325          

HSP 2 Score: 80.1073 bits (196), Expect = 1.388e-13
Identity = 86/379 (22.69%), Postives = 173/379 (45.65%), Query Frame = 2
Query: 1829 HPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDT---DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI----------------SKRTEFTKDF------KTCQSESFPDFN-----EDNCRTSIFLKLR-------------RFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKI 2827
            +P+ +L +WAVLM++Q  A FFW   +E+   A++A+ +Y+   R +       D SE L+ +   F  LA+ ++E+    ++ +A  L+  + +NW   +CL+LA       F+S+   Q  +   W     +   ++   I+ I+ P +I                S+  +FT ++       T +S    D++     ++     + L LR              FY AP  KF  ++  +++F++ F+Y VL  M+  Q ++HE + +IY+    ++K  EI  S   +   ++K W +  +WN ++ + I    V   LR+             +    + IY + +  ++ +++   A ++  GP + M++K+
Sbjct:  612 YPYNDLLVWAVLMKRQNMAMFFWQHGEEATVKAVIASILYRAMAREAKESNMVDDTSEELKNYSEQFGQLALDVLEKAFKQNEPMAMKLLTYELKNWSNSTCLKLAVSGGLRPFVSHSCTQMLLTDMWMGRLKMRKNSWLKIIISILLPPMILTLEFKSKAEMSHVPQSQDFQFTWNYSDQGLSNTKESACVKDYDLERGPDEKPDEPLHLDLRNVPQSLPWTRRVYEFYSAPFVKFWFYTMAYLAFLMLFTYTVLVEMQP-QPSVHEWLVIIYIFTNAIEKVREICISEPSKFKQKVKMWLS-EYWNLMETVAIGLFAVGFGLRW---------GHPPLQTAGRLIYCIDIIFWFSRLMDFFAVNQHAGPYVTMIAKM 979          

HSP 3 Score: 59.3066 bits (142), Expect = 2.912e-7
Identity = 45/123 (36.59%), Postives = 65/123 (52.85%), Query Frame = 2
Query: 1361 ITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLR 1723
            IT+FD  S  H+DLD AIL +L+K   L        +S QL+L + W+R+DI K  I +             + D+++  +V F++L +EN  N+  FLT   L+ELY T    TN    FLR
Sbjct:  370 ITIFDADSEEHQDLDLAILTALLKGTSL-------SISEQLNLAMAWDRMDIAKKHILTYGQHWKPGALEQAMLDALVMDRVDFVKLLIENGVNLHRFLTIPRLEELYNTKQGPTN---KFLR 482          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. TrEMBL
Match: A0A267FX17 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017231g3 PE=4 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.125e-130
Identity = 194/578 (33.56%), Postives = 318/578 (55.02%), Query Frame = 2
Query: 1307 QVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELY-ETCPKSTNFRKTFLRLIG------RPFSKGLNDVKELLSKMIGFYEYPCSEND--------SIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRT-SLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF-----NINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            +VDE +  + +I++ E LITVFD+   +DLD AIL +L+K MD       +    QL L +TWNR DI  +KIF+ +     +    F   +I   K++F+ LFL+N   +++FLT   L+ LY E+   S+       +L+        P+   L D++ LL K++G +  P  + D          + PF +LF WAVL+ KQ  AKF W + DES+ LAL A+++Y    R  S  +  R   L+ +K+ FE+LAV ++EEC  +D   A  LIEKK E +G  +CLELA+ +   KF+S    Q SI   W  G      N+  F   LC++ PFL+    EF       + E     +E      +  K+R +Y AP TKF  ++  ++ FI  +S+ +L+ MK   ++  E + + ++ +M++++  E+F S++D +  +++ WW F+ WN++D+  ++ A++ + LR   A + + T         +T Y L    FYL++ RL   +  LGPK+ M+ K++KELL + +I+++ LL+YGV +QA  YP RDF+     +I+ YPY+ ++G
Sbjct:  432 KVDENMSMLLEIVQKEKLITVFDMNRSDDLDLAILSALLKVMDA---KRLDDYKQQLQLSMTWNRPDIAAEKIFTEEHQWGTENLDKFALSAISQEKIEFLRLFLKNGLIMREFLTVGRLRSLYRESLAASSQASLQVRKLLAARTRCRNPWEPTLADIRVLLRKLVGKFHAPSMDKDVGTGGDDEQFERPFNQLFFWAVLLCKQDTAKFLWERTDESVPLALAASKVYNEMARALSSHEDGRKRMLQAYKDEFEDLAVHVVEECQMVDPSKAELLIEKKVEAFGDFNCLELAASANCKKFVSCNSSQNSITSRWLNGLMHGTSNLRIF---LCVVLPFLLP--FEF-----LVRVEPSVRLDEGGRCAQLAHKVRIYYTAPVTKFFANAIWYVIFIFLYSWFILFEMKAASISWLEWVIIAWICVMVVEEIREMFSSKADTVQEKLRDWWGFSAWNRLDLFTMLLALIGIFLRIPEATDAITTG-------VRTCYILAGVLFYLRVFRLYYANSYLGPKLVMIQKMVKELLFYMSILIVALLTYGVAAQALLYPTRDFTTSIFVDIVYYPYWQIYG 989          

HSP 2 Score: 233.802 bits (595), Expect = 1.125e-130
Identity = 135/353 (38.24%), Postives = 199/353 (56.37%), Query Frame = 3
Query:  168 IRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNI---NVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNIL----EFAKGRT---VHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQR 1196
            I  ARF    S R    +  E  +++L R+F+ +NF   EC  F +       +  KC CGE ++ H     P    + W E   M    T+++G+I    E   N     F RV   D +D +LEL+   W +      +LCISVIGG  +FK+  ++K +F  GLI+AA TTNA IIT GLN GIT V+G+A++  ++  ++K   ++ + C+G+APWGYV NR+ L    +   G     V Y +SN + K QP+SLN NHTHY+  DDG R +    K G  +  L+ +I+QK+    GI VVLLIVEGG DIF E    ++  + +V C+ TG+A+DII  A++++Q+
Sbjct:   55 IGTARFSRARSQRKREEQLVEQ-QRSL-RQFILANFQRKECCLFEA------KDGKKCACGEVREKHD-GLLPAGPEEKWNEATHMRRSVTNAYGRITLKNEGFDNRDPIHFARVCDEDSMDKMLELMKTHWQLADPQKPSLCISVIGGAKNFKLEGRKKEVFHHGLIRAAQTTNAWIITSGLNLGITRVVGNALEEGRASHWEKSSRSSKLRCIGVAPWGYVLNRDHLINKRDPKTGELSLDVEYKISNVISKGQPVSLNANHTHYLLVDDGKRNRYGGSKSGVIKAKLQEQINQKE----GISVVLLIVEGGLDIFEETQSMIQSNIPVVTCDNTGRAADIIAFAYKKVQK 394          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. TrEMBL
Match: A0A267E1J7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017231g2 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 1.596e-130
Identity = 194/578 (33.56%), Postives = 317/578 (54.84%), Query Frame = 2
Query: 1307 QVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELY-ETCPKSTNFRKTFLRLIG------RPFSKGLNDVKELLSKMIGFYEYPCSEND--------SIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRT-SLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF-----NINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            +VDE +  + +I++ E LITVFD+   +DLD AIL +L+K MD       +    QL L +TWNR DI  +KIF+ +     +    F   +I   K++F+ LFL+N   +++FLT   L+ LY E+   S+       +L+        P+   L D++ LL K++G +  P  + D          + PF +LF WAVL+ KQ  AKF W + DES+ LAL A+++Y    R  S  +  R   L+ +K+ FE LAV ++EEC  +D   A  LIEKK E +G  +CLELA+ +   KF+S    Q SI   W  G      N+  F   LC++ PFL+    EF       + E     +E      +  K+R +Y AP TKF  ++  ++ FI  +S+ +L+ MK   ++  E + + ++ +M++++  E+F S++D +  +++ WW F+ WN++D+  ++ A++ + LR   A + + T         +T Y L    FYL++ RL   +  LGPK+ M+ K++KELL + +I+++ LL+YGV +QA  YP RDF+     +I+ YPY+ ++G
Sbjct:  432 KVDENMSMLLEIVQKEKLITVFDMNRSDDLDLAILSALLKVMDA---KRLDDYKQQLQLSMTWNRPDIAAEKIFTEEHQWGTENLDKFALSAISQEKIEFLRLFLKNGLIMREFLTVGRLRSLYRESLAASSQASLQVRKLLAARTRCRNPWEPTLADIRVLLRKLVGKFHAPSMDKDVGTGGDDEQFERPFNQLFFWAVLLCKQDTAKFLWERTDESVPLALAASKVYNEMARALSSHEDGRKRMLQAYKDEFEELAVHVVEECQMVDPSKAELLIEKKVEAFGDFNCLELAASANCKKFVSCNSSQNSITSRWLNGLMHGTSNLRIF---LCVVLPFLLP--FEF-----LVRVEPSVRLDEGGRCAQLAHKVRIYYTAPVTKFFANAIWYVIFIFLYSWFILFEMKAASISWLEWVIIAWICVMVVEEIREMFSSKADTVQEKLRDWWGFSAWNRLDLFTMLLALIGIFLRIPEATDAITTG-------VRTCYILAGVLFYLRVFRLYYANSYLGPKLVMIQKMVKELLFYMSILIVALLTYGVAAQALLYPTRDFTTSIFVDIVYYPYWQIYG 989          

HSP 2 Score: 233.802 bits (595), Expect = 1.596e-130
Identity = 135/353 (38.24%), Postives = 199/353 (56.37%), Query Frame = 3
Query:  168 IRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNI---NVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNIL----EFAKGRT---VHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQR 1196
            I  ARF    S R    +  E  +++L R+F+ +NF   EC  F +       +  KC CGE ++ H     P    + W E   M    T+++G+I    E   N     F RV   D +D +LEL+   W +      +LCISVIGG  +FK+  ++K +F  GLI+AA TTNA IIT GLN GIT V+G+A++  ++  ++K   ++ + C+G+APWGYV NR+ L    +   G     V Y +SN + K QP+SLN NHTHY+  DDG R +    K G  +  L+ +I+QK+    GI VVLLIVEGG DIF E    ++  + +V C+ TG+A+DII  A++++Q+
Sbjct:   55 IGTARFSRARSQRKREEQLVEQ-QRSL-RQFILANFQRKECCLFEA------KDGKKCACGEVREKHD-GLLPAGPEEKWNEATHMRRSVTNAYGRITLKNEGFDNRDPIHFARVCDEDSMDKMLELMKTHWQLADPQKPSLCISVIGGAKNFKLEGRKKEVFHHGLIRAAQTTNAWIITSGLNLGITRVVGNALEEGRASHWEKSSRSSKLRCIGVAPWGYVLNRDHLINKRDPKTGELSLDVEYKISNVISKGQPVSLNANHTHYLLVDDGKRNRYGGSKSGVIKAKLQEQINQKE----GISVVLLIVEGGLDIFEETQSMIQSNIPVVTCDNTGRAADIIAFAYKKVQK 394          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. TrEMBL
Match: A0A267FD75 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017231g1 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 1.981e-130
Identity = 194/578 (33.56%), Postives = 317/578 (54.84%), Query Frame = 2
Query: 1307 QVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELY-ETCPKSTNFRKTFLRLIG------RPFSKGLNDVKELLSKMIGFYEYPCSEND--------SIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRT-SLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF-----NINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            +VDE +  + +I++ E LITVFD+   +DLD AIL +L+K MD       +    QL L +TWNR DI  +KIF+ +     +    F   +I   K++F+ LFL+N   +++FLT   L+ LY E+   S+       +L+        P+   L D++ LL K++G +  P  + D          + PF +LF WAVL+ KQ  AKF W + DES+ LAL A+++Y    R  S  +  R   L+ +K+ FE LAV ++EEC  +D   A  LIEKK E +G  +CLELA+ +   KF+S    Q SI   W  G      N+  F   LC++ PFL+    EF       + E     +E      +  K+R +Y AP TKF  ++  ++ FI  +S+ +L+ MK   ++  E + + ++ +M++++  E+F S++D +  +++ WW F+ WN++D+  ++ A++ + LR   A + + T         +T Y L    FYL++ RL   +  LGPK+ M+ K++KELL + +I+++ LL+YGV +QA  YP RDF+     +I+ YPY+ ++G
Sbjct:  432 KVDENMSMLLEIVQKEKLITVFDMNRSDDLDLAILSALLKVMDA---KRLDDYKQQLQLSMTWNRPDIAAEKIFTEEHQWGTENLDKFALSAISQEKIEFLRLFLKNGLIMREFLTVGRLRSLYRESLAASSQASLQVRKLLAARTRCRNPWEPTLADIRVLLRKLVGKFHAPSMDKDVGTGGDDEQFERPFNQLFFWAVLLCKQDTAKFLWERTDESVPLALAASKVYNEMARALSSHEDGRKRMLQAYKDEFEELAVHVVEECQMVDPSKAELLIEKKVEAFGDFNCLELAASANCKKFVSCNSSQNSITSRWLNGLMHGTSNLRIF---LCVVLPFLLP--FEF-----LVRVEPSVRLDEGGRCAQLAHKVRIYYTAPVTKFFANAIWYVIFIFLYSWFILFEMKAASISWLEWVIIAWICVMVVEEIREMFSSKADTVQEKLRDWWGFSAWNRLDLFTMLLALIGIFLRIPEATDAITTG-------VRTCYILAGVLFYLRVFRLYYANSYLGPKLVMIQKMVKELLFYMSILIVALLTYGVAAQALLYPTRDFTTSIFVDIVYYPYWQIYG 989          

HSP 2 Score: 233.417 bits (594), Expect = 1.981e-130
Identity = 134/353 (37.96%), Postives = 198/353 (56.09%), Query Frame = 3
Query:  168 IRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNI---NVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAK-------GRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQR 1196
            I  ARF    S R    +  E  +++L R+F+ +NF   EC  F +       +  KC CGE ++ H     P    + W E   M    T+++G+I    E   N     F RV   D +D +LEL+   W +      +LCISVIGG  +FK+  ++K +F  GLI+AA TTNA IIT GLN GIT V+G+A++  ++  ++K   ++ + C+G+APWGYV NR+ L   +          V Y +SN + K QP+SLN NHTHY+  DDG R +    K G  +  L+ +I+QK+    GI VVLLIVEGG DIF E    ++  + +V C+ TG+A+DII  A++++Q+
Sbjct:   55 IGTARFSRARSQRKREEQLVEQ-QRSL-RQFILANFQRKECCLFEA------KDGKKCACGEVREKHD-GLLPAGPEEKWNEATHMRRSVTNAYGRITLKNEGFDNRDPIHFARVCDEDSMDKMLELMKTHWQLADPQKPSLCISVIGGAKNFKLEGRKKEVFHHGLIRAAQTTNAWIITSGLNLGITRVVGNALEEGRASHWEKSSRSSKLRCIGVAPWGYVLNRDHLINKRDPKIGELSLDVEYKISNVISKGQPVSLNANHTHYLLVDDGKRNRYGGSKSGVIKAKLQEQINQKE----GISVVLLIVEGGLDIFEETQSMIQSNIPVVTCDNTGRAADIIAFAYKKVQK 394          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. TrEMBL
Match: A0A5K4FE95 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.966e-128
Identity = 144/336 (42.86%), Postives = 202/336 (60.12%), Query Frame = 3
Query:  213 HIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNA--KCMCGEAKKNHKIDKTPFSLCD--PWKENESMEVI-STDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNI---NVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKG----RTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKIS-QKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAF 1181
            H+R  +  EK +   FV  +F   EC KF +  +         +C CGE +  H       S  D   W E+E ++V+  +++FG+IEF  E  +N K T+FVR+S  DKL+D++ L+ N W +      +LCISVIGG  +F +   +K +F  GL++AA TT A I+T GLN GI  V+GDA+Q  QSY  DK   +  + C+GIAPWGYV NRN L           + Y VS  +E  QP+SLN+NHTHYIF D+G RL+    +   FR  LE +I+  ++    GIPVVL+IVEGGHD+FI+A   +KE+V +V+C GTG+A+DI+  AF
Sbjct:   18 HVR--DTKEKKI--SFVLKHFTFKECIKFVADPQYATETKPSDRCFCGEYRIYHYFHGQNRSETDNKEWSESECLKVVGPSNAFGQIEFITESTSNHKPTEFVRISDEDKLEDVMLLMKNYWKMMEPEKPSLCISVIGGAKNFVLEGHKKEVFYSGLVQAAQTTRAWIVTSGLNLGIIRVVGDALQ-EQSYSTDKRMLSQQLRCIGIAPWGYVLNRNTLVATNYEDHFHPIPYTVSTVIETGQPVSLNQNHTHYIFVDEGKRLRYGGCESARFRARLEKQIALPEEAGGFGIPVVLVIVEGGHDVFIDARNSIKERVPVVICSGTGRAADILDMAF 348          

HSP 2 Score: 239.965 bits (611), Expect = 3.966e-128
Identity = 199/658 (30.24%), Postives = 331/658 (50.30%), Query Frame = 2
Query: 1259 NVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRK-----------------TFLRL---------------IGRPFSKGLNDVKELLSKMIGFYEYPCSENDS-IKH----------------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRT-SLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLI---------SKR------------TEFTKDFKTCQSESFPDFNEDNCRTSIFL------KLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQR-DFSWIALSNILDYPYYTMFGVLNLGNT 2998
            ++L +KL  + +S  ++V+ A+K I+ I+K+  LIT FD+   +DLD AIL++LIK    L          QL L LTW+R DI + KIF     +  D     + ++++  K  F+ + L+N   ++ FLT   L  LY     S +  +                 T L L                  P+   L+ + +L+ +M+G Y     + D+ + H                PFQELFLWA+L ++ K A +FW + D++L LAL+A  +Y    +     DT+     E++   FENLA+ ++EEC+ ID E   YL+E ++  WGG +CL+LA++S   KF+S+  CQ S++F W  G   N     + +I PFL+          KR              FT++      E   D +  N + S  +      K++ FY AP+TKFC+++  ++ F+++FSY +L+   + ++TIHE   M Y + MI+D   +IF S       ++  WW    W + ++ +I+ A+++M LR  L    +Y         SKT Y L + + Y++I  L + H  LGPK+ M+  +++EL+ F  I+++  L+YG++     YP R +FSW  + ++L YPY+ ++G L+L  T
Sbjct:  366 SILSQKL--KIVSGKNKVEAALKMIQLIVKDTKLITTFDMNKSDDLDLAILFALIKTSSEL--------DKQLRLALTWDRCDIAEAKIFRQGKQVKPDILEPIMMEALLRNKTDFVRILLQNGVVMRQFLTFERLHRLYNESTHSNDLIRCLKNYKLLTSEHLTVSSTKLHLPVMISNEMTAERGQSFTSPYRIYLSTICKLIRRMLGRYTNKIYDMDTEVLHGRRADWSRVSKLTFVSPFQELFLWAILYQRHKMALYFWERSDDALTLALIACCLYTDMSKLLPTYDTEGKTKYESYVEEFENLAIGVLEECNAIDPEFTLYLVEGESSLWGGFNCLQLAAQSVRRKFISSQACQNSLDFAWCHGMRANMLVTSVILILPFLLYFDHILSWEDKRPHVSVNHHHQTVARFTENADVSDRE---DISHKNSKRSEPMQRNFTEKIKMFYTAPKTKFCLYTMVYVIFLLFFSYTLLFSTLQNEITIHEGFIMAYFIAMIIDIIRQIFLSPGVGP-KKVATWWDQYEWGRSELFVILLALLSMFLRIGLETTFIY---------SKTFYVLTLITCYIRIYGLYSYHPNLGPKLVMIRSMLEELISFIFILIVVFLAYGISLHVLLYPNRHEFSWSDVRDVLYYPYWNLYGELSLDYT 1000          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. TrEMBL
Match: A0A094ZK28 (Transient receptor potential cation channel subfamily M member 6 OS=Schistosoma haematobium OX=6185 GN=MS3_02513 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 6.820e-119
Identity = 192/645 (29.77%), Postives = 328/645 (50.85%), Query Frame = 2
Query: 1259 NVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNF-----------------RKTFLRL---------------IGRPFSKGLNDVKELLSKMIGFYEYPCSENDS-IKHPFQ-----ELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRT-SLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLI---------SKRTEFTKDFK----TCQSESFPD------FNEDNCRTSIFL------KLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQR-DFSWIALSNILDYPYYTMFGVLNLGNT 2998
            ++L +KL  + +S  ++++ A+K I+ I+++  LIT FD+   +DLD AIL++LIK    L          QL L LTW+R DI + KIF     +  +     + ++++  K  F+ + L+N   ++ FLT   L  LY    +S +                    T L L                  P    L+ + +LL + +G Y     + D+ + H  +     ELFLWA+L ++ K A +FW + ++SL LAL+A  +Y    +     DT+     ET+   FE+LA+ ++EEC+ ID E   YL+E ++  WGG +CL+LA++S   KF+S+  CQ S++F W  G   N       +I PFL+          KR   + ++     T  +++  D       +  + + S  +      K++ FY AP+TKFC+++  ++ F+++FSY +L+     Q+TIHE   M Y + MI+D   +IF S  D    +I  WW    W + ++ +I+ A+++M LR  L    +Y         SKT Y L + + Y+++  L + H  LGPK+ M+  +++EL+ F  I+++  L+YG++     YP R +FSW  + ++L YPY+ ++G L+L  T
Sbjct:  259 SILSQKL--KIVSGKNKIEAALKMIQFIVQDTKLITTFDMNKSDDLDLAILFALIKTSSEL--------DKQLRLALTWDRSDIAEAKIFRQGKQVKPEILEPIMMEALLRNKTDFVRILLQNGVVMRQFLTFERLHRLYNESTQSNDLIRCLKNYKLLTSEHLTVSSTKLHLPVMMNNEMTGETEQSFTPPSRIYLSTICKLLRRTLGRYTNKIYDMDTELLHGLRADWNRELFLWAILYQRHKMALYFWERSEDSLTLALIACCLYTDMIKLLPTYDTEGKTKYETYVEEFESLAIGVLEECNGIDPEFTLYLVEGESSLWGGFNCLQLAAQSVRRKFISSQACQNSLDFAWCHGMRANMLITSAILILPFLLYFDHILSWEDKRPHVSVNYNHRSVTRSTKNAGDVLDQESISHQHSKHSAPVQRNFKEKIKIFYTAPKTKFCLYTMVYVIFLLFFSYTLLFSTIPDQITIHEGFIMAYFIAMIIDIIRQIFLSPGDGP-KKIATWWDQYEWGRSELFVILLALLSMFLRIGLDTTFIY---------SKTFYVLTLITCYIRLYGLYSYHPNLGPKLVMIRSMLEELISFIFILIVVFLAYGISLHVLLYPYRHEFSWSDVRDVLYYPYWNLYGELSLDYT 883          

HSP 2 Score: 208.764 bits (530), Expect = 6.820e-119
Identity = 114/236 (48.31%), Postives = 153/236 (64.83%), Query Frame = 3
Query:  501 FVRVSYNDKLDDILELLFNKWNI---NVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVH-----YNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKIS-QKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAF 1181
            FVR+S  DKL+D++ L+ N W +      +LCISVIGG  +F +   +K    +GL++AA TT A I+T GLN GI  V+GDA+Q  QSY  DK   +  + C+GIAPWGYV NRN L  A     H     Y VS  +E  QP+SLN+NHTHYIF D+G RL+    +   FR  LE +I+  ++    GIPVVL+IVEGGHD+FI+A   +KE+V +V+C GTG+A+DI+  AF
Sbjct:   12 FVRISDEDKLEDVMILMKNYWKMMEPEKPSLCISVIGGAKNFVLEGHKK----EGLVQAAQTTRAWIVTSGLNLGIIRVVGDALQ-EQSYSTDKRMLSQQLRCIGIAPWGYVLNRNTL-VANNYEDHFHPIPYTVSTVIETGQPVSLNQNHTHYIFVDEGKRLRYGGCESARFRARLEKQIALPEEAGGFGIPVVLVIVEGGHDVFIDARNSIKERVPVVICSGTGRAADILDMAF 241          

HSP 3 Score: 51.6026 bits (122), Expect = 6.820e-119
Identity = 53/285 (18.60%), Postives = 128/285 (44.91%), Query Frame = 1
Query: 3061 DIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCY-------------NL-------------SNSKKFEIT-KHNSKLHIDKPMAFK-----HDTLNIFSNIKSDSDLN----------------KLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIRSKSIFKELENIQTKLNKI-----------QIKNVKKVQEGSFTNTNGEYQNITKQPKDSMALLLTSLNNNILVLQDEVNRIGQEVNIVSTENSPVVITDNNCMESNI 3738
            +I  +SI +WKY+M+ +++E+N KPI+P+P S    + +++ +C +  +               NL               +K F+ T + N +  +   ++F      H  + +  ++  +S  +                + ++ FE   ++ ++K + ++++K+I++GI +++ R + +F  L ++  K+  +           +IK+ +K  E    +TN   Q +T+  K      + S+N       D+++ + Q+  + +++ +PV   +    ES +
Sbjct:  899 EIEFHSIELWKYNMFFMVVEFNKKPIVPVPLSAVQALIELILYCTKMSKVSKKNVKSPRSSTSGNLKFIVKSETEDERDDGAKLFKFTERGNRRPSLGPTVSFSQLSPNHADIGLMESVIPESLQHNCKEQEAEDNDDEDDLRRVRVFEANCKRNILKKMKLDREKTIEAGIRQLKARLEEMFSSLMSVGEKVESVSRDIEFFSSASEIKSTEKSTE----STNINVQVVTEPQKLHTEAPVISIN-------DQISTVLQQHPVETSKLNPVEYPEVGSSESEM 1172          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Cavefish
Match: trpm5 (transient receptor potential cation channel subfamily M member 5 [Source:NCBI gene;Acc:103047602])

HSP 1 Score: 137.502 bits (345), Expect = 6.796e-52
Identity = 156/660 (23.64%), Postives = 294/660 (44.55%), Query Frame = 2
Query: 1271 RKLIEQDISELHQVD--EAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXX---XXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELY-ETCPKSTNF--------RKTFL----RLIGRPFSKG--------LNDVKELLSKMI-----GFYEYPCSE-----------------NDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIF---PFLISKRTEFTKDFKTCQS---------------------------ESFPDFNEDNCRTS----IFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQ---LTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVV-MFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD-FSWIALSNILDYPYYTMFGVLNL 2989
            ++L+ +  + LH  D    +K I+ I++N  L+TV D +   DLD  IL +L+K     C S          +L L + WNRVDI K +IF+GD+  S  +    + D+++  K  F+ LF++N  N+ +FLT   L+ELY     KS  F         K  L    R  G P+ +         L++V ++L   +     GFY+   +E                 +   ++P+++LFLWAVL  +QK A +FW    E++  AL   +I K        + + + +++  K  +E  A+ L  EC+   ++ A  L+ +K   W   + L LA+++    F ++   Q  +   W      +     L + F   P + +   +F+ +    +                            E+  D  + +C  +    +  + +RF+ AP T F  +   + +F++ F+YV+L   +       +I EI+   ++  ++L++  + F +  D    +    +  ++WNK             ++   L + GV    +   +   +T+ +L    F L+++ + A HK+LGPKI ++ +++K++  F   + ++L++YGV +QA  +P      W+    +L  PY  +FG + L
Sbjct:  319 QELLLETFTGLHSTDITSWVKVIQKILENGHLLTVHDPEQTADLDTVILKALVK----ACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIFNGDVEWSPQDLEEVMMDALVNDKPDFVRLFVDNGVNLGEFLTYGRLQELYCSVSEKSLLFDLLLKKHQEKQMLLASARTPGPPYMEPVDRRPRFTLHEVSKVLKDFLHDSCKGFYQKLPAERVGKGRLFHSQKDLPDLDQHCENPWRDLFLWAVLQNRQKMANYFWAMGPEAVAAALAGCKILKEMAHLE-SEAESARSMKEAK--YEQFALDLFSECYSNSEDRAYALLVRKTHCWSKSTVLNLATEADAKSFFAHDGVQALLTKIWWGAMTTDTSISKLVLSFFCPPLIWTNLIKFSDEILQSRGGGEQFAELDSLDTEKALLLSDDDPDDSEAAGDPADQSCSQAWSQFLLRRWKRFWSAPVTVFLGNVLMYFAFLVLFTYVLLLDFRPPPPDGPSIAEIILYFWVFTLVLEEIRQSFFTDEDMNILKKCKLYVEDNWNK-----------CDMVAISLFVVGVSCRMMENTYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVATQALLHPNDPRLDWV-FRRVLYRPYLHIFGQIPL 959          

HSP 2 Score: 88.5817 bits (218), Expect = 6.796e-52
Identity = 66/247 (26.72%), Postives = 117/247 (47.37%), Query Frame = 3
Query:  447 FGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQ-YSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVG-----IPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDII 1169
             G I+F G   T  K   F RVS       I +LL  +W ++   L ++++GG    +M+   ++   +GL++A  +T A I+T GL  GIT  +G A++ +S +    K++    +  +GIAPW  + N+ +L  AK        + ++      SL+ +H+H+I  ++    Q      G  R  L   IS ++    G     IPV+ L+V G   I     + ++     ++  G+G  +DI+
Sbjct:   68 LGDIDFIGSSRTRGK---FARVSSMTDPVLIYQLLTEQWGLSPPHLVVALVGGDELDQMKPWLRDTVRKGLVRATQSTGAWILTNGLQFGITKHLGQAVRDHSLASTSSKVR----VVAIGIAPWTMIHNKEMLLTAKPDQPAAYPTEDLPHGSVYSLDCHHSHFILVEEE---QHRSGATGDMRVKLLKHISLQRTGYGGPGSFEIPVLCLLVHGEPKILQRMYKTIQNATPWLLLAGSGGVADIL 304          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 146.362 bits (368), Expect = 7.338e-49
Identity = 106/336 (31.55%), Postives = 173/336 (51.49%), Query Frame = 3
Query:  348 GEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPIS----LNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKTF*NENSLSRIFLSYIKLMK 1319
            GEA+  H          + W      E   TD++G I F G   +++    +VR+S++ + + IL L+  +W + +  + ISV GG  +F +  + K +  +GLIKAA+TT A I+T G+N G+   +GDA++   S    K      I  +GIAPWG ++NRN L    GR V   V+       P+S    LN  H+H+I  D+G     T  K G     R+ LE  I+ Q+   R+  G+PVV LI EGG ++ +     ++E   V +VVCEGTG+A+DI+    ++ +        + +D +A + ++F    ++N    +F + ++ MK
Sbjct:   68 GEAQPPH----------EEWSVENHTEQSPTDAYGIINFQGG--SHSYRAKYVRLSHDSRPEAILRLMLKEWQMELPKIVISVHGGIQNFDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSRSARK------ICTIGIAPWGVIENRNDL---IGRDV---VAPYQTLLNPLSKLNVLNNLHSHFILVDNG-----TVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTEDDGGLPDGVETDIIATVKKTFNL--SQNDAVHLFQTLMECMK 372          

HSP 2 Score: 69.707 bits (169), Expect = 7.338e-49
Identity = 47/128 (36.72%), Postives = 71/128 (55.47%), Query Frame = 2
Query: 1325 KCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN 1702
            + + + +KN+ LITVF + S  H+D+D AIL +L+K  D            QL L L W+RVDI KD +F     L  D     + D+++  +V F++L +EN  ++  FLT + L+ELY T    TN
Sbjct:  365 QTLMECMKNKELITVFHVGSEDHQDIDVAILKALLKGTD-------ASAFDQLVLTLAWDRVDIAKDHVFVYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTN 485          

HSP 3 Score: 114.005 bits (284), Expect = 7.323e-25
Identity = 115/434 (26.50%), Postives = 203/434 (46.77%), Query Frame = 2
Query: 1811 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEFTKDFKTCQSESF-----------PD------FNEDNC-----------------RTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            E     +PF EL +WAVLM++QK + FFW   +ES+  ALVA ++ +   Y  + S    D SE L+ + N F  LAV L+E+    D+ ++  L+  + +NW   +CL+LA  S    F+++   Q  +   W    N+   +++  IL I+ P  I       + E     ++  +              PD      F E                    R  I  K   FY AP  KF  ++  ++ F++ +SYVVL  +     +  E   ++Y+    ++K  E+F S   +I  +IK W++ +++N+ D I IV   V   LR+             +F   + IY L +  +Y+++L +LA +++ GP + M+ K++  +     I+ + L++YGV  +A  YP  +  W  + +++  PY+ M+G
Sbjct:  611 ETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSILVPPAILALEYKSKAEMAHIPQSQDAHQMTMEDSEHNLQNPDDIQMDVFKETRINDHVEVKHETEVVTRSRRLPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKLPIFP-SPQEWAVILYIFTSAIEKIREMFMSEGGKISQKIKVWFS-DYFNRSDFIAIVMFAVGFGLRFGSG---------NVFIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYG 1033          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 146.362 bits (368), Expect = 8.104e-49
Identity = 106/336 (31.55%), Postives = 173/336 (51.49%), Query Frame = 3
Query:  348 GEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPIS----LNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKTF*NENSLSRIFLSYIKLMK 1319
            GEA+  H          + W      E   TD++G I F G   +++    +VR+S++ + + IL L+  +W + +  + ISV GG  +F +  + K +  +GLIKAA+TT A I+T G+N G+   +GDA++   S    K      I  +GIAPWG ++NRN L    GR V   V+       P+S    LN  H+H+I  D+G     T  K G     R+ LE  I+ Q+   R+  G+PVV LI EGG ++ +     ++E   V +VVCEGTG+A+DI+    ++ +        + +D +A + ++F    ++N    +F + ++ MK
Sbjct:   78 GEAQPPH----------EEWSVENHTEQSPTDAYGIINFQGG--SHSYRAKYVRLSHDSRPEAILRLMLKEWQMELPKIVISVHGGIQNFDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSRSARK------ICTIGIAPWGVIENRNDL---IGRDV---VAPYQTLLNPLSKLNVLNNLHSHFILVDNG-----TVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTEDDGGLPDGVETDIIATVKKTFNL--SQNDAVHLFQTLMECMK 382          

HSP 2 Score: 69.707 bits (169), Expect = 8.104e-49
Identity = 47/128 (36.72%), Postives = 71/128 (55.47%), Query Frame = 2
Query: 1325 KCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN 1702
            + + + +KN+ LITVF + S  H+D+D AIL +L+K  D            QL L L W+RVDI KD +F     L  D     + D+++  +V F++L +EN  ++  FLT + L+ELY T    TN
Sbjct:  375 QTLMECMKNKELITVFHVGSEDHQDIDVAILKALLKGTD-------ASAFDQLVLTLAWDRVDIAKDHVFVYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTN 495          

HSP 3 Score: 114.005 bits (284), Expect = 6.915e-25
Identity = 115/434 (26.50%), Postives = 203/434 (46.77%), Query Frame = 2
Query: 1811 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEFTKDFKTCQSESF-----------PD------FNEDNC-----------------RTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            E     +PF EL +WAVLM++QK + FFW   +ES+  ALVA ++ +   Y  + S    D SE L+ + N F  LAV L+E+    D+ ++  L+  + +NW   +CL+LA  S    F+++   Q  +   W    N+   +++  IL I+ P  I       + E     ++  +              PD      F E                    R  I  K   FY AP  KF  ++  ++ F++ +SYVVL  +     +  E   ++Y+    ++K  E+F S   +I  +IK W++ +++N+ D I IV   V   LR+             +F   + IY L +  +Y+++L +LA +++ GP + M+ K++  +     I+ + L++YGV  +A  YP  +  W  + +++  PY+ M+G
Sbjct:  621 ETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSILVPPAILALEYKSKAEMAHIPQSQDAHQMTMEDSEHNLQNPDDIQMDVFKETRINDHVEVKHETEVVTRSRRLPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKLPIFP-SPQEWAVILYIFTSAIEKIREMFMSEGGKISQKIKVWFS-DYFNRSDFIAIVMFAVGFGLRFGSG---------NVFIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYG 1043          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 146.362 bits (368), Expect = 8.172e-49
Identity = 106/336 (31.55%), Postives = 173/336 (51.49%), Query Frame = 3
Query:  348 GEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPIS----LNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKTF*NENSLSRIFLSYIKLMK 1319
            GEA+  H          + W      E   TD++G I F G   +++    +VR+S++ + + IL L+  +W + +  + ISV GG  +F +  + K +  +GLIKAA+TT A I+T G+N G+   +GDA++   S    K      I  +GIAPWG ++NRN L    GR V   V+       P+S    LN  H+H+I  D+G     T  K G     R+ LE  I+ Q+   R+  G+PVV LI EGG ++ +     ++E   V +VVCEGTG+A+DI+    ++ +        + +D +A + ++F    ++N    +F + ++ MK
Sbjct:   68 GEAQPPH----------EEWSVENHTEQSPTDAYGIINFQGG--SHSYRAKYVRLSHDSRPEAILRLMLKEWQMELPKIVISVHGGIQNFDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSRSARK------ICTIGIAPWGVIENRNDL---IGRDV---VAPYQTLLNPLSKLNVLNNLHSHFILVDNG-----TVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTEDDGGLPDGVETDIIATVKKTFNL--SQNDAVHLFQTLMECMK 372          

HSP 2 Score: 69.707 bits (169), Expect = 8.172e-49
Identity = 47/128 (36.72%), Postives = 71/128 (55.47%), Query Frame = 2
Query: 1325 KCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN 1702
            + + + +KN+ LITVF + S  H+D+D AIL +L+K  D            QL L L W+RVDI KD +F     L  D     + D+++  +V F++L +EN  ++  FLT + L+ELY T    TN
Sbjct:  365 QTLMECMKNKELITVFHVGSEDHQDIDVAILKALLKGTD-------ASAFDQLVLTLAWDRVDIAKDHVFVYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTN 485          

HSP 3 Score: 114.39 bits (285), Expect = 5.907e-25
Identity = 115/434 (26.50%), Postives = 203/434 (46.77%), Query Frame = 2
Query: 1811 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEFTKDFKTCQSESF-----------PD------FNEDNC-----------------RTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            E     +PF EL +WAVLM++QK + FFW   +ES+  ALVA ++ +   Y  + S    D SE L+ + N F  LAV L+E+    D+ ++  L+  + +NW   +CL+LA  S    F+++   Q  +   W    N+   +++  IL I+ P  I       + E     ++  +              PD      F E                    R  I  K   FY AP  KF  ++  ++ F++ +SYVVL  +     +  E   ++Y+    ++K  E+F S   +I  +IK W++ +++N+ D I IV   V   LR+             +F   + IY L +  +Y+++L +LA +++ GP + M+ K++  +     I+ + L++YGV  +A  YP  +  W  + +++  PY+ M+G
Sbjct:  611 ETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSILVPPAILALEYKSKAEMAHIPQSQDAHQMTMEDSEHNLQNPDDIQMDVFKETRINDHVEVKHETEVVTRSRRLPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKLPIFP-SPQEWAVILYIFTSAIEKIREMFMSEGGKISQKIKVWFS-DYFNRSDFIAIVMFAVGFGLRFGSG---------NVFIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYG 1033          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 146.362 bits (368), Expect = 8.239e-49
Identity = 106/336 (31.55%), Postives = 173/336 (51.49%), Query Frame = 3
Query:  348 GEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPIS----LNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKTF*NENSLSRIFLSYIKLMK 1319
            GEA+  H          + W      E   TD++G I F G   +++    +VR+S++ + + IL L+  +W + +  + ISV GG  +F +  + K +  +GLIKAA+TT A I+T G+N G+   +GDA++   S    K      I  +GIAPWG ++NRN L    GR V   V+       P+S    LN  H+H+I  D+G     T  K G     R+ LE  I+ Q+   R+  G+PVV LI EGG ++ +     ++E   V +VVCEGTG+A+DI+    ++ +        + +D +A + ++F    ++N    +F + ++ MK
Sbjct:   85 GEAQPPH----------EEWSVENHTEQSPTDAYGIINFQGG--SHSYRAKYVRLSHDSRPEAILRLMLKEWQMELPKIVISVHGGIQNFDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSRSARK------ICTIGIAPWGVIENRNDL---IGRDV---VAPYQTLLNPLSKLNVLNNLHSHFILVDNG-----TVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTEDDGGLPDGVETDIIATVKKTFNL--SQNDAVHLFQTLMECMK 389          

HSP 2 Score: 69.707 bits (169), Expect = 8.239e-49
Identity = 47/128 (36.72%), Postives = 71/128 (55.47%), Query Frame = 2
Query: 1325 KCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN 1702
            + + + +KN+ LITVF + S  H+D+D AIL +L+K  D            QL L L W+RVDI KD +F     L  D     + D+++  +V F++L +EN  ++  FLT + L+ELY T    TN
Sbjct:  382 QTLMECMKNKELITVFHVGSEDHQDIDVAILKALLKGTD-------ASAFDQLVLTLAWDRVDIAKDHVFVYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTN 502          

HSP 3 Score: 114.005 bits (284), Expect = 7.224e-25
Identity = 115/434 (26.50%), Postives = 203/434 (46.77%), Query Frame = 2
Query: 1811 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEFTKDFKTCQSESF-----------PD------FNEDNC-----------------RTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            E     +PF EL +WAVLM++QK + FFW   +ES+  ALVA ++ +   Y  + S    D SE L+ + N F  LAV L+E+    D+ ++  L+  + +NW   +CL+LA  S    F+++   Q  +   W    N+   +++  IL I+ P  I       + E     ++  +              PD      F E                    R  I  K   FY AP  KF  ++  ++ F++ +SYVVL  +     +  E   ++Y+    ++K  E+F S   +I  +IK W++ +++N+ D I IV   V   LR+             +F   + IY L +  +Y+++L +LA +++ GP + M+ K++  +     I+ + L++YGV  +A  YP  +  W  + +++  PY+ M+G
Sbjct:  628 ETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSILVPPAILALEYKSKAEMAHIPQSQDAHQMTMEDSEHNLQNPDDIQMDVFKETRINDHVEVKHETEVVTRSRRLPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKLPIFP-SPQEWAVILYIFTSAIEKIREMFMSEGGKISQKIKVWFS-DYFNRSDFIAIVMFAVGFGLRFGSG---------NVFIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYG 1050          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 152.14 bits (383), Expect = 1.727e-37
Identity = 182/716 (25.42%), Postives = 314/716 (43.85%), Query Frame = 2
Query: 1307 QVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFS-GDISLSNDEWAAFLK---DSIITGKVKFIELFLENVSNIQDFLTANILKELYETCP--KSTNFRKTFLRLIGRP--FSKGLNDVKELLSKMIG-------------------FYEYPCSENDS--------------------------IKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKY---HQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI----------------------------SKRTEFTKD------------------------FKTCQSESFPDFNEDNCRT-----------SIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEPPPVT---FVKIFME 3073
            Q    ++ + + ++ + LITVF   S  H D+D AIL +L+K  +          + QL+L L W+RVDI K+ +F  G   +   EWA + +   D+++  +V F++L +EN  ++  FLT   L+ELY T    + +N R    R    P  +   L DV  ++  ++G                   + ++  S +++                            +PF EL  WAVLM++Q+ A FFW   +ESL  ALVA ++Y+      + S  D  + + L   +  F  LA+ L+++    D+ +A  L+  +  NW   +CL+LA  S    F+++   Q  +   W    N+   ++F  IL I+ P  I                              R   T+D                         +T  + S  D  E   +            S+  ++  FY AP  KF  ++  +I F++ F+YVVL  ++++  ++ E   ++YL +  +++  EIF S   +   +IK W    +WN  D + I+   VA+ LR Q            +   +K +YSL V  +Y+++L + A ++ +GP I M+ K++ +  +   I+ I LLS+GV  QA  + + D SW    NI+  PY+ +FG       VY    + +T+ E PP T   F+  F++
Sbjct:  256 QAMHLLQTLLECMRRKELITVFHTGSEDHSDVDLAILTALLKGTNF-------SSADQLNLALAWDRVDIAKNHVFVYGQHWMVRLEWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTSDHHQMSNLRILLHRFSHLPPDYKITLIDVGLVIEFLMGGAFRSMYTRKRFRLLYHNLYGQHRASVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSREDELKWKRLWCARVKFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSILMPPSILMLEYKSKAEMSHIPQSEELHQMGQEEREHRAAATRDIPMQRCLSRRVFLRLLSFAIRILLLRTVGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLP-SVQEWFVILYLFMSAIERVREIFMSEPGKFGQKIKVWLD-GYWNINDSLGILLFFVAVALRSQSH----------LLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMWQQCMLMIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFG------EVYAPEIDNNTDDEYPPCTTGAFITPFLQ 946          

HSP 2 Score: 132.109 bits (331), Expect = 3.012e-31
Identity = 85/234 (36.32%), Postives = 132/234 (56.41%), Query Frame = 3
Query:  501 FVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTV--HYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ---KQGDRVGIPVVLLIVEGGHDIFIEASRRVKEK--VSIVVCEGTGKASDIIG 1172
            + RVSY+ + D +L+L+  +W + +  L ISV GG  +F++  K K +F +GLIKAA+TT A I T G+N G+ + +G+A++   S      + ++ I  +GIAPWG ++NR  L       V  +  +SN + K     LN  H+H+I  DDG     T  K G     R+ LE  I+    + G   G+PVV L+ EGG ++ +     + E+  V +VVCEGTG+A+DI+ 
Sbjct:    2 YARVSYDSRPDLLLQLMVKEWQMELPRLLISVHGGLQNFELHPKLKQVFSKGLIKAALTTGAWIFTGGVNTGVVNHVGNALKEHAS------RSSHKICTIGIAPWGVIENRGDLVGQDSHVVSPYQTLSNPLSKLN--LLNSLHSHFILVDDG-----TVGKYGAEAQLRRELEKHIATVACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILA 222          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 144.821 bits (364), Expect = 2.841e-35
Identity = 155/573 (27.05%), Postives = 261/573 (45.55%), Query Frame = 2
Query: 1490 TWNRVDIVKDKIFS-GD--ISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKS-TNFRKTFLRLIGRPFSKGLN------DVKELLSKMIGFYEYPCSENDSIK---------------------------HPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKY---HQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEF-----TKDFKTCQSESFPDFNEDNCRT-----------SIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKS----------RSD---RIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
             W+RVDI K+ +F  G   ++L    W   + D+++  +V F++L +EN  ++  FLT   L+ELY T     TN  K  L    R    GLN       +  LL  ++G         D+ +                           +PF EL  WAVLM++Q+ A FFW   +ESL  ALVA ++Y+      + S    D SE L+ +   F  LA+ L+++    D+ +A  L+  +  NW   +CL+LA  S    F+++   Q  +   W    N+   ++F  IL I+ P  I       + E      +++     + S  D  E   +            S+  ++  FY AP  KF  ++  +I F++ F+YVVL  ++++  ++ E   ++YL +  +++  E+             RSD     + +IK W    +WN  D + I+   VA+ LR Q            +   +K +YSL V  +Y+++L + A ++ +GP I M+ K++  +     I+ I LLS+GV  QA  + + D SW    NI+  PY+ +FG
Sbjct:  317 AWDRVDIAKNHVFVYGQHWMALMWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTVSGPLTNPPKRPLLANSRSPPVGLNCTLNPPVIGNLLLMILGGTCSAIQAVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSEAVEDSSEELKQYSTEFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSILMPPSILMLEYKSKAEMSHIPQSEELHQMGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLP-SVQEWFVILYLFMSAIERVREVSDGARETRKAAGLRSDSEASAHRKIKVWLD-GYWNINDSLGILLFFVAVALRSQSH----------LLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMANMFSIVIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFG 877          

HSP 2 Score: 130.183 bits (326), Expect = 9.641e-31
Identity = 85/239 (35.56%), Postives = 133/239 (55.65%), Query Frame = 3
Query:  501 FVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTV--HYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQKQ--------GDRVGIPVVLLIVEGGHDIFIEASRRVKEK--VSIVVCEGTGKASDIIG 1172
            + RVSY+ + D +L+L+  +W + +  L ISV GG  +F++  K K +F +GLIKAA+TT A I T G+N G+ + +G+A++   S      + ++ I  +GIAPWG ++NR  L       V  +  +SN + K     LN  H+H+I  DDG     T  K G     R+ LE  I+ ++        G   G+PVV L+ EGG ++ +     + E+  V +VVCEGTG+A+DI+ 
Sbjct:    1 YARVSYDSRPDLLLQLMVKEWQMELPRLLISVHGGLQNFELHPKLKQVFSKGLIKAALTTGAWIFTGGVNTGVVNHVGNALKEHAS------RSSHKICTIGIAPWGVIENRGDLVGQDSHVVSPYQTLSNPLSKLN--LLNSLHSHFILVDDG-----TVGKYGAEAQLRRELEKHIALQKIHTLACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILA 226          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Sea Lamprey
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 109.768 bits (273), Expect = 2.148e-24
Identity = 116/511 (22.70%), Postives = 227/511 (44.42%), Query Frame = 2
Query: 1490 TWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGR----------------PFS-KGLND---------VKELLS---------KMIGFYEY-PCSENDS---------------------IKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINF--FSCILCIIFPFLISKRT---EFTKDFKTCQSESFPDFNEDNCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKE 2836
             WNRVDI   +IF+ D      +    +  +++  + +FI LF+E+   ++++LT   L+ LY   P S +     LR I                  P + K +N          ++ELL          KM  F +  P S+N                          P ++LF+WAVL+ +++ A FFW +  + +  AL+A+++ K   +    D+DR+  +    + +E LA+ L++EC+  D+  A  L+ ++  +WGG +CL +A  + +  F S+   Q  +   W  G +++   +  ILCIIFP LI  R     +     TC                   + R F+ AP T F  +  ++  F+  F+YV++   +       E +   +++ +IL++  ++F         +    +  + WN++D++ ++   + ++ R  L  N +       F+  +++  +    F L+++ +   +K LGPKI ++ +++K+
Sbjct:  379 AWNRVDIATSEIFTDDRKWQTGDLEQVMDAALLENRPEFISLFVEHGLILREYLTWARLESLYNGAPAS-SLLHILLRRISEGEKSPADPHRRWISTLPMAPKRMNHFSLYHISLLIRELLGDSTSMLYGNKMSRFSKLSPSSKNTGSTKGGTSLEFKGQTYNEGQLYCPDPERDLFIWAVLLNRRELANFFWSQGKDCMAAALMASKLLKAMVQEE-DDSDRTSDMLAQADNYEQLAIGLLDECYKDDELRAQKLLIRQLHSWGGATCLSMAYHANNKSFFSHSGVQALLTQIWWGGMSVDLKTWRVILCIIFPLLIYTRIITFRWVLYAHTCTPT----------------RWRNFWTAPITVFWANVVSYFIFLWLFAYVIIMDFQYTP-DWPEYVLYAWVLSLILEELRQVFTDPEKAGQWKAAVRYIKDIWNRIDILALLLFTIGVICR--LIPNSINEST---FQAGRSVLCVDYMVFCLRLMHIFTVNKTLGPKIIIVKRMVKD 865          

HSP 2 Score: 87.8113 bits (216), Expect = 1.361e-17
Identity = 66/236 (27.97%), Postives = 108/236 (45.76%), Query Frame = 3
Query:  339 CMCGEAKKNHKIDKT--PFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITT---NALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQ 1031
            C C   +  H       P  L   W+  +      T++FG I+F G      +L  FVRV  + +   + +L+   W+++V  L ISV GG  +F ++ + + IF  GL K A +T    A IIT G   G+   +G+++   + +          I  +GIA WG + N+  L  A+G+       +E  + +   L+ NH+H+I  D+G   Q   + V   R  LE  IS + 
Sbjct:   34 CECRHPRSEHANTALLKPTLLGQKWEPAKHTANEPTNAFGDIQFTG---LGQRLGKFVRVGNDTEPSVLFKLMMEHWHLDVPNLLISVTGGAKNFHLKPQLRTIFRHGLNKTARSTGIQGAWIITGGSYAGVMKYVGESV---RDFALASGSKEGKIVAIGIATWGIIHNKEHLIDAQGKFPAEYPMDEAGQGRLSCLDNNHSHFILVDNGTHGQYGVEIV--LRARLEQYISTQH 261          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Nematostella
Match: EDO30135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1N0])

HSP 1 Score: 150.214 bits (378), Expect = 2.086e-36
Identity = 96/345 (27.83%), Postives = 166/345 (48.12%), Query Frame = 3
Query:  189 ITDSNRGSHI---RFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSL-CDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYV-KNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKI------SQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAF 1181
            + D    SH+   +F  N      + ++  NF   EC +F        H+ ++C CG  ++ H           + W          T+++G+I+F  E     K   ++R+S++   + ++ L+  +WN+ +  L ISV GG   F ++ + + +F +GLIKAA TT A IIT G N G+   +G+A++  Q         +  ++ +GIA WG V K  +++    G+            HQ   L+ NH+H+   DDG     T+ K G     R  +E  I      S+ +   +G+PVVLL++EGG +        +K+KV  VV +G+G+A+ ++G A+
Sbjct:    9 LYDGGDSSHVHLNKFGSNQLSQSKKSWIARNFSRRECIRFVPK----SHDVSRCKCGRPRERHSQQALESGQGSEEWNVASCTTKHPTNAYGEIDF--EGYGGQKRAPYLRMSHDTDANLVITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRRGLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMF----GSDTQVNVIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQGAMLDPNHSHFFLVDDG-----TEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAY 338          

HSP 2 Score: 118.627 bits (296), Expect = 8.705e-27
Identity = 89/361 (24.65%), Postives = 180/361 (49.86%), Query Frame = 2
Query: 1310 VDEAIKCIEDIIKNELLITVFDIKSH--EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSK--GLNDVKELLSKMIG--FYEYPCSEN-------------------------------DSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRA--GFNINFFSCILCIIFPFLI 2266
             D+    I+D++++E +I+V+ +     +D+D AIL +L+K       +N++   +QL+L L WNR+D+ K  IF+ +   + +  +A +  +++  K +F ELFL+N  ++++FL+ +IL +LY   P +T  +    + +G+   K   ++ V E++ +++G  F  Y   +                                D +  P+ ++FLWAVL  +++ A+  W    E +  AL+A+R+ K     +  D   TD S  L      FE  AV +++EC + ++ ++  L+ ++ +++  ++ LELA  +    F+++  CQ  +   W      N  ++  ++C+  P LI
Sbjct:  375 ADKTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLK-------ANRSSPVAQLNLALAWNRIDLAKSDIFTEEQQWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYAEVPGNTTIKPLLQKEMGKRQVKTIDMDVVGEVIEELMGDMFESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCLYLPVLI 728          

HSP 3 Score: 51.6026 bits (122), Expect = 2.434e-6
Identity = 29/97 (29.90%), Postives = 61/97 (62.89%), Query Frame = 2
Query: 2708 MFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQ-----RDFSWIALSNILDYPYYTMFGVL 2983
            +F  S+ I SL +  F ++ L++ + ++ LGPK+ M+ K++++L  F  I+ +F ++YG+   A  +P      R+ +W+ +++++ YPY+ M+G L
Sbjct:  942 IFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGEL 1038          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Nematostella
Match: EDO47658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT7])

HSP 1 Score: 134.035 bits (336), Expect = 1.530e-31
Identity = 85/270 (31.48%), Postives = 150/270 (55.56%), Query Frame = 3
Query:  405 WKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQ-YSQSYLYDKMKHNNF-ISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG---YFRQALENKISQKQGDRV--GIPVVLLIVEGGHDIF---IEASRRVKEKVSIVVCEGTGKASDIIGEAFR 1184
            W        + TD+FG++EF G          ++R++++   + +L LL  +W +++  L ISV GG  +F +  K K +  +GL+KAA TT A +IT G N G+   +G+A++ ++     +++K+    +  +GIA WG V ++ +L   K   V Y +++ ++  +   L+ NH+H+I  D+G     T  + G    FR +LEN I+ K+  +   G+PVVLL++EGG +     +E+  R    V +V+ EG+G+A+DI+  A R
Sbjct:    6 WVPTRHTVTLPTDAFGELEFQGAG--QPSRAKYIRLAHDTDPELVLRLLCGEWALDLPKLLISVTGGAKNFILSPKIKRVLREGLLKAAQTTGAWVITGGTNTGVMRHVGEAVKGHTVMSRGEQLKNTAHQVHLIGIASWGIVDHKEMLVNPKVEVVPYQMTSSMQS-RGACLDNNHSHFILVDNG-----TDGEYGGEISFRASLENLIASKKMAQKFHGVPVVLLVLEGGPNTIRTVLESVSRCP-AVPVVIAEGSGRAADILAFAHR 266          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Medaka
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:101156483])

HSP 1 Score: 150.599 bits (379), Expect = 3.923e-48
Identity = 96/299 (32.11%), Postives = 160/299 (53.51%), Query Frame = 3
Query:  384 PFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESF 1256
            P    + W   +  EV  TD++G I F G   +++    +VR+SY+ + + +L L+  +W++ +  + ISV GG  +F++  + K +  +GLIKAA+TT A I+T G+N G+   +GDA++   S    K      I  +GIAPWG ++NRN L        +  + N + K     LN  H+H++  DDG     T  K G     R+ LE  I+ Q+   R+  G+PVV LI EGG ++ +     ++E   V +VVCEGTG+A+DI+    ++ +        + +D +A + ++F
Sbjct:   74 PMPELEEWSVEKHTEVSPTDAYGVINFQGG--SHSYRAKYVRLSYDSRPESVLRLMLKEWHMELPKILISVHGGVQNFELHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHCSRSAKK------ICTIGIAPWGVIENRNDLIGKDIIAPYQTLLNPLSKLN--VLNNLHSHFLLVDDG-----TVGKYGAEVKLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQETPPVPVVVCEGTGRAADILAYVHKQTEEGGGLPDGVETDIIATIKKTF 357          

HSP 2 Score: 63.1586 bits (152), Expect = 3.923e-48
Identity = 47/133 (35.34%), Postives = 73/133 (54.89%), Query Frame = 2
Query: 1337 DIIKNELLITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLI 1729
            + +K++ LITVFDI S E  D+D AIL +L++  +       +    QL L L W+RVDI K+ +F     L        + D+++  +V F++L +EN  ++  FLT N L+ELY T  K +    T L L+
Sbjct:  373 ECMKSKELITVFDISSEEQQDIDVAILKALLQGTN-------SSPFDQLVLTLAWDRVDIAKNHVFVYGQQLLVSSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTINRLEELYNT--KQSPNNPTLLHLV 496          

HSP 3 Score: 115.931 bits (289), Expect = 1.893e-25
Identity = 117/435 (26.90%), Postives = 211/435 (48.51%), Query Frame = 2
Query: 1811 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEFTK------DFKTCQSES---FPDFNED--------------------------NCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            E     +PF EL +WAVLM++QK + FFW   +E++  ALVA ++ +   Y  + S    D S+ L+ + N F  LAV L+E+    D+ +A  L+  + +NW   +CL+LA  S    F+++   Q  +   W    N+   +++  IL I+ P  I       + E         D +    +S   F + +ED                          + +  +  K+  FY AP  KF  ++  ++ F++ ++YVVL  M +   T  E + ++Y+    ++K  E+F S + +I  +IK W++ +++N  D + IV   +   LR  LA           F   + +Y L +  +Y+++L +LA +++ GP + M++K++  +     I+L+ LLSYGV  +A  YP  + SW    +++  PY+ M+G
Sbjct:  616 ETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEENMAKALVACKLCRSMGYEAKKSDVVDDTSDKLKDYSNDFGTLAVDLLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSHLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILLLEYKSKAEMAHIPQSQDDHQMTMEDSEHNFQNLHEDIQMDVFKEARSHDHVETKHDMEMHVRSRKLPLTRKIYAFYHAPIVKFWSNTLFYLGFLMLYTYVVLVKMIQAPST-QEWVVIVYIFTSAIEKIREMFMSEAGKISQKIKVWFS-DYFNVSDFLAIVTFFIGCGLR--LAGGDA-------FLPGRIVYCLNIIFWYVRLLDILAVNQQAGPYVMMIAKMVANMFYIVVIMLVVLLSYGVPRKAILYPNEEPSWTLARDVVFQPYWMMYG 1039          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Medaka
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:101156483])

HSP 1 Score: 150.599 bits (379), Expect = 3.989e-48
Identity = 96/299 (32.11%), Postives = 160/299 (53.51%), Query Frame = 3
Query:  384 PFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESF 1256
            P    + W   +  EV  TD++G I F G   +++    +VR+SY+ + + +L L+  +W++ +  + ISV GG  +F++  + K +  +GLIKAA+TT A I+T G+N G+   +GDA++   S    K      I  +GIAPWG ++NRN L        +  + N + K     LN  H+H++  DDG     T  K G     R+ LE  I+ Q+   R+  G+PVV LI EGG ++ +     ++E   V +VVCEGTG+A+DI+    ++ +        + +D +A + ++F
Sbjct:   89 PMPELEEWSVEKHTEVSPTDAYGVINFQGG--SHSYRAKYVRLSYDSRPESVLRLMLKEWHMELPKILISVHGGVQNFELHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHCSRSAKK------ICTIGIAPWGVIENRNDLIGKDIIAPYQTLLNPLSKLN--VLNNLHSHFLLVDDG-----TVGKYGAEVKLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQETPPVPVVVCEGTGRAADILAYVHKQTEEGGGLPDGVETDIIATIKKTF 372          

HSP 2 Score: 63.1586 bits (152), Expect = 3.989e-48
Identity = 47/133 (35.34%), Postives = 73/133 (54.89%), Query Frame = 2
Query: 1337 DIIKNELLITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLI 1729
            + +K++ LITVFDI S E  D+D AIL +L++  +       +    QL L L W+RVDI K+ +F     L        + D+++  +V F++L +EN  ++  FLT N L+ELY T  K +    T L L+
Sbjct:  388 ECMKSKELITVFDISSEEQQDIDVAILKALLQGTN-------SSPFDQLVLTLAWDRVDIAKNHVFVYGQQLLVSSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTINRLEELYNT--KQSPNNPTLLHLV 511          

HSP 3 Score: 115.931 bits (289), Expect = 2.101e-25
Identity = 117/435 (26.90%), Postives = 211/435 (48.51%), Query Frame = 2
Query: 1811 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEFTK------DFKTCQSES---FPDFNED--------------------------NCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            E     +PF EL +WAVLM++QK + FFW   +E++  ALVA ++ +   Y  + S    D S+ L+ + N F  LAV L+E+    D+ +A  L+  + +NW   +CL+LA  S    F+++   Q  +   W    N+   +++  IL I+ P  I       + E         D +    +S   F + +ED                          + +  +  K+  FY AP  KF  ++  ++ F++ ++YVVL  M +   T  E + ++Y+    ++K  E+F S + +I  +IK W++ +++N  D + IV   +   LR  LA           F   + +Y L +  +Y+++L +LA +++ GP + M++K++  +     I+L+ LLSYGV  +A  YP  + SW    +++  PY+ M+G
Sbjct:  631 ETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEENMAKALVACKLCRSMGYEAKKSDVVDDTSDKLKDYSNDFGTLAVDLLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSHLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILLLEYKSKAEMAHIPQSQDDHQMTMEDSEHNFQNLHEDIQMDVFKEARSHDHVETKHDMEMHVRSRKLPLTRKIYAFYHAPIVKFWSNTLFYLGFLMLYTYVVLVKMIQAPST-QEWVVIVYIFTSAIEKIREMFMSEAGKISQKIKVWFS-DYFNVSDFLAIVTFFIGCGLR--LAGGDA-------FLPGRIVYCLNIIFWYVRLLDILAVNQQAGPYVMMIAKMVANMFYIVVIMLVVLLSYGVPRKAILYPNEEPSWTLARDVVFQPYWMMYG 1054          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Medaka
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:101156483])

HSP 1 Score: 150.214 bits (378), Expect = 4.555e-48
Identity = 96/299 (32.11%), Postives = 160/299 (53.51%), Query Frame = 3
Query:  384 PFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESF 1256
            P    + W   +  EV  TD++G I F G   +++    +VR+SY+ + + +L L+  +W++ +  + ISV GG  +F++  + K +  +GLIKAA+TT A I+T G+N G+   +GDA++   S    K      I  +GIAPWG ++NRN L        +  + N + K     LN  H+H++  DDG     T  K G     R+ LE  I+ Q+   R+  G+PVV LI EGG ++ +     ++E   V +VVCEGTG+A+DI+    ++ +        + +D +A + ++F
Sbjct:   81 PMPELEEWSVEKHTEVSPTDAYGVINFQGG--SHSYRAKYVRLSYDSRPESVLRLMLKEWHMELPKILISVHGGVQNFELHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHCSRSAKK------ICTIGIAPWGVIENRNDLIGKDIIAPYQTLLNPLSKLN--VLNNLHSHFLLVDDG-----TVGKYGAEVKLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQETPPVPVVVCEGTGRAADILAYVHKQTEEGGGLPDGVETDIIATIKKTF 364          

HSP 2 Score: 63.1586 bits (152), Expect = 4.555e-48
Identity = 47/133 (35.34%), Postives = 73/133 (54.89%), Query Frame = 2
Query: 1337 DIIKNELLITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLI 1729
            + +K++ LITVFDI S E  D+D AIL +L++  +       +    QL L L W+RVDI K+ +F     L        + D+++  +V F++L +EN  ++  FLT N L+ELY T  K +    T L L+
Sbjct:  380 ECMKSKELITVFDISSEEQQDIDVAILKALLQGTN-------SSPFDQLVLTLAWDRVDIAKNHVFVYGQQLLVSSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTINRLEELYNT--KQSPNNPTLLHLV 503          

HSP 3 Score: 116.701 bits (291), Expect = 1.010e-25
Identity = 117/435 (26.90%), Postives = 211/435 (48.51%), Query Frame = 2
Query: 1811 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEFTK------DFKTCQSES---FPDFNED--------------------------NCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG 2977
            E     +PF EL +WAVLM++QK + FFW   +E++  ALVA ++ +   Y  + S    D S+ L+ + N F  LAV L+E+    D+ +A  L+  + +NW   +CL+LA  S    F+++   Q  +   W    N+   +++  IL I+ P  I       + E         D +    +S   F + +ED                          + +  +  K+  FY AP  KF  ++  ++ F++ ++YVVL  M +   T  E + ++Y+    ++K  E+F S + +I  +IK W++ +++N  D + IV   +   LR  LA           F   + +Y L +  +Y+++L +LA +++ GP + M++K++  +     I+L+ LLSYGV  +A  YP  + SW    +++  PY+ M+G
Sbjct:  623 ETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEENMAKALVACKLCRSMGYEAKKSDVVDDTSDKLKDYSNDFGTLAVDLLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSHLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILLLEYKSKAEMAHIPQSQDDHQMTMEDSEHNFQNLHEDIQMDVFKEARSHDHVETKHDMEMHVRSRKLPLTRKIYAFYHAPIVKFWSNTLFYLGFLMLYTYVVLVKMIQAPST-QEWVVIVYIFTSAIEKIREMFMSEAGKISQKIKVWFS-DYFNVSDFLAIVTFFIGCGLR--LAGGDA-------FLPGRIVYCLNIIFWYVRLLDILAVNQQAGPYVMMIAKMVANMFYIVVIMLVVLLSYGVPRKAILYPNEEPSWTLARDVVFQPYWMMYG 1046          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Medaka
Match: ENSORLT00000021513.2 (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:101156498])

HSP 1 Score: 108.227 bits (269), Expect = 5.401e-45
Identity = 77/274 (28.10%), Postives = 134/274 (48.91%), Query Frame = 3
Query:  438 TDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGR-TVHYNVSNEVEKHQPIS---LNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVG-----IPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDG 1232
            TD+FG++EF G      + + F+R+S +     +  LL N W +    L +SV+GG     ++   ++I   GL+KAA+TT + I+T GL +G++  +G+A++   +   +  K  N +  +G+APWG V NR  L   KG     Y V     +H+ +    L+ N   ++  DDG   +  +  V  FR  LE+ IS ++    G     IPV+ +++ G   +       +++    +V  G+G A+D+I E    +  I        S+G
Sbjct:  150 TDAFGEVEFAG---AGCRHSLFLRLSCDTAAQIVYALLTNHWGLPAPNLVVSVVGGEGHQTIKPWVRDILRNGLVKAAVTTGSWILTGGLREGVSRCVGEAVRDFGAGALNSSK--NKVIAVGVAPWGMVNNRQQLVNPKGSFPARYYV-----QHKSLDSNYLDNNCKAFLLVDDGSVGR--RGGVEAFRADLEDYISHQRTGIWGSGGIEIPVLCMLIAGDACMLQRVKNSLEKSTPWLVLAGSGSAADLISEVLSSLSDIIHDPTSPSSEG 411          

HSP 2 Score: 94.7449 bits (234), Expect = 5.401e-45
Identity = 104/426 (24.41%), Postives = 176/426 (41.31%), Query Frame = 2
Query: 1271 RKLIEQDISEL----HQVDEAIKCIEDIIKNELLITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKEL----------YETCPKSTNFRKTFLR------------------LIGRPFSK---GLNDVKELLSKMIG-----FY------EYPCSENDSIKH------------------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSE-TLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF--NINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDN 2341
            R+++ Q + +      +V++ ++ +  I +    ITVF  +S +  D D  +L S++     +C+     +         WNRVDI K ++F+G I+ S  E    + D+++  K  F+ LF EN  NI D+LT   L++L          Y    K  N R+   R                  L+  P S+    L +V  LL  ++G     FY      +   S   ++K                   P+  LF+WAVL  + K A FFW    ES+  AL   +I +  + + L D   S+  ++     FE+LA  +   C+   + +A  L+ +K+  WG  +CL++A+ +    F S    Q  +   W      N   +  IL   FP L+  R    ++ +    E F   + D 
Sbjct:  422 RQMVRQKVRKYFPAETEVEKLVEHVLSIYQKRDFITVFRGESEDSDDFDTVLLRSILGASKRVCNKAIEWVEELKLAV-AWNRVDIAKAELFNGAIAWSYHELEESMTDALVNDKPHFVRLFCENGLNILDYLTYGRLEKLYNKLSDTTLAYSLLQKRLNERQDLNRSESLVNGAASASKASSECLMMSPASELQLSLFEVSRLLWDLLGDVCQPFYYGALDLDPKTSPRVALKQVHKLLLRDCEYRRQRCRSPWTALFIWAVLQNRPKMAVFFWEMAGESVMSALAGCKILR--ELSKLEDETESKLEMKKLAQKFEDLAHDVFGNCYQNSETLAFTLLIRKSPVWGKATCLQMATAADARLFFSQDGVQFLLSQIWWGDMERNTEVWKLILTFFFPPLLCTRLIQFREEEELNPEVFQGMDTDG 844          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Medaka
Match: ENSORLT00000029710.1 (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:101156498])

HSP 1 Score: 107.842 bits (268), Expect = 5.870e-45
Identity = 85/325 (26.15%), Postives = 144/325 (44.31%), Query Frame = 3
Query:  327 NNAKCMCGEAKKNHKIDKTPFSLCDP--------------WKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGR-TVHYNVSNEVEKHQPIS---LNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVG-----IPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDG 1232
            N   C CG   + H          DP              W   +      TD+FG++EF G      + + F+R+S +     +  LL N W +    L +SV+GG     ++   ++I   GL+KAA+TT + I+T GL +G++  +G+A++   +   +  K  N +  +G+APWG V NR  L   KG     Y V     +H+ +    L+ N   ++  DDG   +  +  V  FR  LE+ IS ++    G     IPV+ +++ G   +       +++    +V  G+G A+D+I E    +  I        S+G
Sbjct:   43 NGRVCQCGSTLEGH----------DPVAAANVSGAAAALQWDSLQHSSEQPTDAFGEVEFAG---AGCRHSLFLRLSCDTAAQIVYALLTNHWGLPAPNLVVSVVGGEGHQTIKPWVRDILRNGLVKAAVTTGSWILTGGLREGVSRCVGEAVRDFGAGALNSSK--NKVIAVGVAPWGMVNNRQQLVNPKGSFPARYYV-----QHKSLDSNYLDNNCKAFLLVDDGSVGR--RGGVEAFRADLEDYISHQRTGIWGSGGIEIPVLCMLIAGDACMLQRVKNSLEKSTPWLVLAGSGSAADLISEVLSSLSDIIHDPTSPSSEG 345          

HSP 2 Score: 95.1301 bits (235), Expect = 5.870e-45
Identity = 104/426 (24.41%), Postives = 176/426 (41.31%), Query Frame = 2
Query: 1271 RKLIEQDISEL----HQVDEAIKCIEDIIKNELLITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKEL----------YETCPKSTNFRKTFLR------------------LIGRPFSK---GLNDVKELLSKMIG-----FY------EYPCSENDSIKH------------------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSE-TLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF--NINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDN 2341
            R+++ Q + +      +V++ ++ +  I +    ITVF  +S +  D D  +L S++     +C+     +         WNRVDI K ++F+G I+ S  E    + D+++  K  F+ LF EN  NI D+LT   L++L          Y    K  N R+   R                  L+  P S+    L +V  LL  ++G     FY      +   S   ++K                   P+  LF+WAVL  + K A FFW    ES+  AL   +I +  + + L D   S+  ++     FE+LA  +   C+   + +A  L+ +K+  WG  +CL++A+ +    F S    Q  +   W      N   +  IL   FP L+  R    ++ +    E F   + D 
Sbjct:  356 RQMVRQKVRKYFPAETEVEKLVEHVLSIYQKRDFITVFRGESEDSDDFDTVLLRSILGASKRVCNKAIEWVEELKLAV-AWNRVDIAKAELFNGAIAWSYHELEESMTDALVNDKPHFVRLFCENGLNILDYLTYGRLEKLYNKLSDTTLAYSLLQKRLNERQDLNRSESLVNGAASASKASSECLMMSPASELQLSLFEVSRLLWDLLGDVCQPFYYGALDLDPKTSPRVALKQVHKLLLRDCEYRRQRCRSPWTALFIWAVLQNRPKMAVFFWEMAGESVMSALAGCKILR--ELSKLEDETESKLEMKKLAQKFEDLAHDVFGNCYQNSETLAFTLLIRKSPVWGKATCLQMATAADARLFFSQDGVQFLLSQIWWGDMERNTEVWKLILTFFFPPLLCTRLIQFREEEELNPEVFQGMDTDG 778          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Planmine SMEST
Match: SMESG000064622.1 (SMESG000064622.1)

HSP 1 Score: 1033.48 bits (2671), Expect = 0.000e+0
Identity = 575/598 (96.15%), Postives = 577/598 (96.49%), Query Frame = 2
Query: 1244 P*KF*NVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYE 3037
            P  F NVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDSNQNPLSSQLSLCLTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQ                +CILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSI  KLRRFYLAPQTKFCIHSFTFISFIIYFSYVVLYGMKRMQ+TIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKVDMIIIVFAIVAMVLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKELLIFSTIILIFLLSYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYE
Sbjct:  379 PESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDSNQNPLSSQLSLCLTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQ----------------NCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISSKLRRFYLAPQTKFCIHSFTFISFIIYFSYVVLYGMKRMQVTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKVDMIIIVFAIVAMVLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKELLIFSTIILIFLLSYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYE 960          

HSP 2 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 306/379 (80.74%), Postives = 335/379 (88.39%), Query Frame = 3
Query:  123 PLKKQSFINDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK 1259
            P  K++  N++++ +IRQAR KI +S R S++ F+ENDEK  YR ++ + F S+ECR FS   + +D  N+KC CGE KK+HK +K P+   + W E + ME++ T SFGKIEF GEDITN+KLTDFVRVSY DKLDDI++L+FNKW I  GTLCISVIGGTIDFKM  KEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNR ILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK
Sbjct:    5 PSSKRTTQNEDYTVTIRQARCKINESYRESNVHFAENDEKMQYRNYINAKFQSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRKILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK 383          

HSP 3 Score: 283.878 bits (725), Expect = 1.602e-78
Identity = 138/140 (98.57%), Postives = 138/140 (98.57%), Query Frame = 1
Query: 3031 LRATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIR 3450
            L ATSSYICQDIH NSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIR
Sbjct:  991 LIATSSYICQDIHRNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIR 1130          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Planmine SMEST
Match: SMESG000064632.1 (SMESG000064632.1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 383/594 (64.48%), Postives = 463/594 (77.95%), Query Frame = 2
Query: 1262 VLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCS-ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLISKRTEFTKDFKTC---QSESFPDFNEDNCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTN 3031
             LK KLIEQ+I ELHQVDE +KCIE+I+K E LIT+F IKSH+DLDFAIL+SLIKRMD LCD   NPLSSQLSLCL WNR+DIVKDKIF GDISLSN EW AF K+SI+ G++ FIELFLENVSN+ DFLT  IL +LY+T PKS NFRKTFL LIGR FSKGL++ KEL+ KMIG         ND   HPFQELFLW+VLMEK KCA+FFWGKCD++L LALVATRIYK  + TS+RDTDR  TL  WK  FENLAVKLIEECHDIDQE AAYLIEK+   + GI+CLELA+KS +LKFMSNIVCQ SI+FTWRAGF I+F+ CILCI+FPFLI  + ++TKD K     +++   D+ E         KL+RFY+APQTKF IHS TF SF++YFSYVVLYGM+RM L+ HE +FM YLV++I +  +E+F+SRS  I+ R+KYWW FN+ NK+D III+ AI AM LRY LA   +  D ++++R SKTIYSLIVG  Y++ LRLL  HKKLGPK+ MM++++K+L+I+  II+IFL SYGVTSQAGYY QRDFSW AL+N+  YPYYTM GV+     VY +WC+ + N
Sbjct:  369 ALKTKLIEQNICELHQVDEDVKCIEEIVKKEFLITLFYIKSHQDLDFAILHSLIKRMDFLCDPRYNPLSSQLSLCLIWNRIDIVKDKIFLGDISLSNAEWIAFFKESIMKGRIDFIELFLENVSNLHDFLTTEILDDLYKTYPKSNNFRKTFLILIGRSFSKGLSEAKELVFKMIGVNRKQLKMRNDYSLHPFQELFLWSVLMEKNKCARFFWGKCDDALCLALVATRIYKCLRGTSVRDTDRQVTLTLWKESFENLAVKLIEECHDIDQETAAYLIEKEIPIFEGITCLELANKSKNLKFMSNIVCQNSIDFTWRAGFTISFYECILCILFPFLILMQNKYTKDLKPLKLHRAQECQDYIEVRSMPYYKAKLKRFYMAPQTKFVIHSITFTSFLLYFSYVVLYGMRRMTLSTHETIFMSYLVILIFESIIEMFQSRSYSIFDRMKYWWKFNYCNKLDAIIILLAISAMALRYPLAYYPIDADIIIIYRCSKTIYSLIVGMLYIRFLRLLTRHKKLGPKMMMMTELVKQLMIYLIIIVIFLASYGVTSQAGYYLQRDFSWSALANLFQYPYYTMLGVIFSKYNVYLSWCDPAMN 962          

HSP 2 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 320/380 (84.21%), Postives = 341/380 (89.74%), Query Frame = 3
Query:  120 TPLKKQSFINDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK 1259
            TPLKKQSFINDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVK RNILE AKGRTVHYNVSNEVE++QP+SLNK+HTHYIF DDGYRLQM++KKV YFRQALENKISQK G+R  IPVVLLIVEGGH++ +E SR                AS+I+GE F+E+     + +  RS   ++  E+++
Sbjct:    4 TPLKKQSFINDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKKRNILESAKGRTVHYNVSNEVEQNQPVSLNKHHTHYIFVDDGYRLQMSRKKVAYFRQALENKISQKLGERAAIPVVLLIVEGGHEVLVEGSR----------------ASNILGEVFQEVSNSSWKRERTRSGDTSVFSENYR 367          

HSP 3 Score: 75.0998 bits (183), Expect = 3.043e-13
Identity = 35/80 (43.75%), Postives = 51/80 (63.75%), Query Frame = 1
Query: 3031 LRATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHI 3270
            L AT+  +C++IH +SI IWKY+ YSL+LEY  KPI+P+PFS  ++IY +L     +  CYNL N  +    +    LH+
Sbjct:  995 LVATNCELCENIHKDSIDIWKYNKYSLLLEYEKKPIIPLPFSMIIHIYNILTDRCGESECYNLKNKDEMMRYEQFPSLHM 1074          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Planmine SMEST
Match: SMESG000064632.1 (SMESG000064632.1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 383/594 (64.48%), Postives = 463/594 (77.95%), Query Frame = 2
Query: 1262 VLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCS-ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLISKRTEFTKDFKTC---QSESFPDFNEDNCRTSIFLKLRRFYLAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTN 3031
             LK KLIEQ+I ELHQVDE +KCIE+I+K E LIT+F IKSH+DLDFAIL+SLIKRMD LCD   NPLSSQLSLCL WNR+DIVKDKIF GDISLSN EW AF K+SI+ G++ FIELFLENVSN+ DFLT  IL +LY+T PKS NFRKTFL LIGR FSKGL++ KEL+ KMIG         ND   HPFQELFLW+VLMEK KCA+FFWGKCD++L LALVATRIYK  + TS+RDTDR  TL  WK  FENLAVKLIEECHDIDQE AAYLIEK+   + GI+CLELA+KS +LKFMSNIVCQ SI+FTWRAGF I+F+ CILCI+FPFLI  + ++TKD K     +++   D+ E         KL+RFY+APQTKF IHS TF SF++YFSYVVLYGM+RM L+ HE +FM YLV++I +  +E+F+SRS  I+ R+KYWW FN+ NK+D III+ AI AM LRY LA   +  D ++++R SKTIYSLIVG  Y++ LRLL  HKKLGPK+ MM++++K+L+I+  II+IFL SYGVTSQAGYY QRDFSW AL+N+  YPYYTM GV+     VY +WC+ + N
Sbjct:  369 ALKTKLIEQNICELHQVDEDVKCIEEIVKKEFLITLFYIKSHQDLDFAILHSLIKRMDFLCDPRYNPLSSQLSLCLIWNRIDIVKDKIFLGDISLSNAEWIAFFKESIMKGRIDFIELFLENVSNLHDFLTTEILDDLYKTYPKSNNFRKTFLILIGRSFSKGLSEAKELVFKMIGVNRKQLKMRNDYSLHPFQELFLWSVLMEKNKCARFFWGKCDDALCLALVATRIYKCLRGTSVRDTDRQVTLTLWKESFENLAVKLIEECHDIDQETAAYLIEKEIPIFEGITCLELANKSKNLKFMSNIVCQNSIDFTWRAGFTISFYECILCILFPFLILMQNKYTKDLKPLKLHRAQECQDYIEVRSMPYYKAKLKRFYMAPQTKFVIHSITFTSFLLYFSYVVLYGMRRMTLSTHETIFMSYLVILIFESIIEMFQSRSYSIFDRMKYWWKFNYCNKLDAIIILLAISAMALRYPLAYYPIDADIIIIYRCSKTIYSLIVGMLYIRFLRLLTRHKKLGPKMMMMTELVKQLMIYLIIIVIFLASYGVTSQAGYYLQRDFSWSALANLFQYPYYTMLGVIFSKYNVYLSWCDPAMN 962          

HSP 2 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 320/380 (84.21%), Postives = 341/380 (89.74%), Query Frame = 3
Query:  120 TPLKKQSFINDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK 1259
            TPLKKQSFINDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVK RNILE AKGRTVHYNVSNEVE++QP+SLNK+HTHYIF DDGYRLQM++KKV YFRQALENKISQK G+R  IPVVLLIVEGGH++ +E SR                AS+I+GE F+E+     + +  RS   ++  E+++
Sbjct:    4 TPLKKQSFINDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKKRNILESAKGRTVHYNVSNEVEQNQPVSLNKHHTHYIFVDDGYRLQMSRKKVAYFRQALENKISQKLGERAAIPVVLLIVEGGHEVLVEGSR----------------ASNILGEVFQEVSNSSWKRERTRSGDTSVFSENYR 367          

HSP 3 Score: 77.411 bits (189), Expect = 5.697e-14
Identity = 35/67 (52.24%), Postives = 48/67 (71.64%), Query Frame = 1
Query: 3031 LRATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSK 3231
            L AT+  +C++IH +SI IWKY+ YSL+LEY  KPI+P+PFS  ++IY +L     +  CYNL NSK
Sbjct:  995 LVATNCELCENIHKDSIDIWKYNKYSLLLEYEKKPIIPLPFSMIIHIYNILTDRCGESECYNLKNSK 1061          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Planmine SMEST
Match: SMESG000064637.1 (SMESG000064637.1)

HSP 1 Score: 417.542 bits (1072), Expect = 0.000e+0
Identity = 205/371 (55.26%), Postives = 272/371 (73.32%), Query Frame = 3
Query:  147 NDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK 1259
            N+ F+ ++ QARF++TD ++ S++ F+ NDEK   + F+K  FHSI+CR F    + L +   KC+CGE K  HK DK P++  + W  +   E + T+SFGKIEF GED+TNTKLT+FVR+S+ D LDD+++L+F+ WNI +GTLCISV+GGT +FKM+KKEK IF QGLIKA  TTNALI+T GLN GIT  +GDAIQ  Q  LYDK K NN + CLGIAPWG+VKN+ ILE AKG  + Y VSNE+   +P+SLNKNHTHY+F D+  R   +  K   FR+ALE K+SQ+  ++  IPVVLL++EG +D+F EAS+R+KE V IV+C GTG+ASD++GEAFREMQ+     K +R DGV MLPE ++
Sbjct:   15 NELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKY--PIKQLRPDGVPMLPEMYR 383          

HSP 2 Score: 410.994 bits (1055), Expect = 0.000e+0
Identity = 223/389 (57.33%), Postives = 281/389 (72.24%), Query Frame = 2
Query: 1244 P*KF*NVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCSENDS-IKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSIF---LKLRRFYLAPQTK 2398
            P  + N LK+KLI++++S   +V+EA+  IE+II  E LIT+FD+K   DL+ AILYSLIKRMD   DS  N LSSQLSLCL WNRVDI KDKIFSG +SLS + WA FLK+SII GK +F+ELFL+N + + DFLT   L++LYE CP+S N ++T    +GR FS GL DVK+LL+K+ G+YE  C+  D  I HPFQELF+W+VLME  +CA +FW K +ESL LALVAT+IYK     S  DT R ETL  WK+YFENLA+KL+EECHD DQE AAY+IEK+N  WGG +CLE+A K+ D KF+S +VCQ S++FTWRAGFNIN F CILCI  PFLI +R+ F   +   +S+   D +     T+     LKL +FYLAPQTK
Sbjct:  379 PEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRS-FDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTK 766          

HSP 3 Score: 123.635 bits (309), Expect = 5.566e-28
Identity = 70/149 (46.98%), Postives = 96/149 (64.43%), Query Frame = 2
Query: 2660 LRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNAST------------NYEPPPVTFVKIFM 3070
            LR+ L +     D V+++R SKTIYSLIVG FYL+ LRL++ HK LGPKI M+SK++ +L+ +  I+LI LL+YG+T Q  Y+PQRDFS   L NI+DYPY+ +FG + L   VY  WC+  T            NY  P +T + IF+
Sbjct:  784 LRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKMLYQLMFYIIIMLIILLAYGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQLVYLPWCDDKTTNYNISNECPELNYFVPVLTAIYIFI 932          

HSP 4 Score: 103.219 bits (256), Expect = 8.153e-22
Identity = 89/339 (26.25%), Postives = 156/339 (46.02%), Query Frame = 1
Query: 3031 LRATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNL-----SNSKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIRSKSIFKELENIQTK------------------------LNKIQIKNVKKVQEGSFTNTNGEYQNITKQPKDSMALLLTSLNNNILVLQDEVNRIGQEVNIVSTENSPVVITDNNCMESNISSSQRVIESISLNHNASNILFVMXXXXXXXXXXXXXXXXXXXAKELRNVHEKFDNFRNQTLNSLNNIELMMRKL 3960
            L A  +YI Q IH NSI IWK++M+SL++EY  KP+ P+PFS F +     AF +    C N       N K  +    +S++    P   K       + I  +S+++KL+KYFEN SQK V+K +  EK++ I+SG+SR+E R K++   +++I++K                        +++ +++N     E    NTN E               + SL +++   Q  V+      N+ S+   P +I D NC ++N S     +    L +  + ++ +                + E   E++N+ +K  +F++  + S   IE  ++ L
Sbjct:  941 LTAVFNYIFQRIHRNSIEIWKFTMFSLVMEYYTKPLFPLPFSIFAH-----AFDFFYSLCGNQCEKTEENEKNLDTLSRDSQITFSPPKKMKSFNFRKLA-IPLESEIDKLVKYFENNSQKCVVKELVEEKEQLIESGMSRLESRLKAMSTIIKSIESKFEDSENPGNHNSAEMGNCYYPTLDISEFEVQNPTTFIEEDIINTNKE---------------IVSLIHDLRTGQLSVSAPSSNANVRSSFLIPRIIVDENC-DNNFSDPNSDLGGNKLKNWVTELINI----------------DSETVLEVQNLQKKLCDFQDHVVESFTKIESFLQSL 1241          
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Planmine SMEST
Match: SMESG000064637.1 (SMESG000064637.1)

HSP 1 Score: 416.387 bits (1069), Expect = 0.000e+0
Identity = 205/371 (55.26%), Postives = 272/371 (73.32%), Query Frame = 3
Query:  147 NDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK 1259
            N+ F+ ++ QARF++TD ++ S++ F+ NDEK   + F+K  FHSI+CR F    + L +   KC+CGE K  HK DK P++  + W  +   E + T+SFGKIEF GED+TNTKLT+FVR+S+ D LDD+++L+F+ WNI +GTLCISV+GGT +FKM+KKEK IF QGLIKA  TTNALI+T GLN GIT  +GDAIQ  Q  LYDK K NN + CLGIAPWG+VKN+ ILE AKG  + Y VSNE+   +P+SLNKNHTHY+F D+  R   +  K   FR+ALE K+SQ+  ++  IPVVLL++EG +D+F EAS+R+KE V IV+C GTG+ASD++GEAFREMQ+     K +R DGV MLPE ++
Sbjct:   15 NELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKY--PIKQLRPDGVPMLPEMYR 383          

HSP 2 Score: 410.609 bits (1054), Expect = 0.000e+0
Identity = 223/389 (57.33%), Postives = 281/389 (72.24%), Query Frame = 2
Query: 1244 P*KF*NVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCSENDS-IKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSIF---LKLRRFYLAPQTK 2398
            P  + N LK+KLI++++S   +V+EA+  IE+II  E LIT+FD+K   DL+ AILYSLIKRMD   DS  N LSSQLSLCL WNRVDI KDKIFSG +SLS + WA FLK+SII GK +F+ELFL+N + + DFLT   L++LYE CP+S N ++T    +GR FS GL DVK+LL+K+ G+YE  C+  D  I HPFQELF+W+VLME  +CA +FW K +ESL LALVAT+IYK     S  DT R ETL  WK+YFENLA+KL+EECHD DQE AAY+IEK+N  WGG +CLE+A K+ D KF+S +VCQ S++FTWRAGFNIN F CILCI  PFLI +R+ F   +   +S+   D +     T+     LKL +FYLAPQTK
Sbjct:  379 PEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRS-FDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTK 766          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM61.633e-5033.64transient receptor potential cation channel subfam... [more]
TRPM61.730e-5033.64transient receptor potential cation channel subfam... [more]
TRPM61.774e-5033.64transient receptor potential cation channel subfam... [more]
TRPM13.548e-4134.21transient receptor potential cation channel subfam... [more]
TRPM14.569e-3834.21transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtl-22.137e-5127.99Gon-Two Like (TRP subfamily) [Source:UniProtKB/Tr... [more]
gon-21.956e-4026.46Transient receptor potential channel [Source:UniP... [more]
gon-22.125e-4026.46Transient receptor potential channel [Source:UniP... [more]
gon-22.405e-4026.46Transient receptor potential channel [Source:UniP... [more]
gon-21.229e-3432.24Transient receptor potential channel [Source:UniP... [more]
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm5.504e-4025.37gene:FBgn0265194 transcript:FBtr0339082[more]
Trpm5.965e-3229.87gene:FBgn0265194 transcript:FBtr0339081[more]
Trpm6.058e-3229.87gene:FBgn0265194 transcript:FBtr0339077[more]
Trpm6.337e-3229.87gene:FBgn0265194 transcript:FBtr0339078[more]
Trpm6.471e-3229.87gene:FBgn0265194 transcript:FBtr0339074[more]
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm25.924e-6228.32transient receptor potential cation channel, subfa... [more]
trpm4b.27.884e-4627.91transient receptor potential cation channel, subfa... [more]
hrc1.615e-4427.85histidine rich calcium binding protein [Source:ZFI... [more]
trpm1a6.867e-4235.83transient receptor potential cation channel, subfa... [more]
trpm1a1.352e-4135.83transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM11.021e-7538.66transient receptor potential cation channel subfam... [more]
TRPM12.568e-6926.92transient receptor potential cation channel subfam... [more]
ENSXETT00000055613.13.867e-6825.57transient receptor potential cation channel subfam... [more]
ENSXETT00000055615.15.942e-6328.33transient receptor potential cation channel subfam... [more]
shc27.057e-5628.57SHC (Src homology 2 domain containing) transformin... [more]
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm12.458e-4132.77transient receptor potential cation channel, subfa... [more]
Trpm61.374e-3932.26transient receptor potential cation channel, subfa... [more]
Trpm64.226e-3932.26transient receptor potential cation channel, subfa... [more]
Trpm15.873e-3932.77transient receptor potential cation channel, subfa... [more]
Trpm16.522e-3932.77transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0A0R4IMY7|TRPM2_DANRE3.659e-6128.32Transient receptor potential cation channel subfam... [more]
sp|Q9BX84|TRPM6_HUMAN7.267e-5033.64Transient receptor potential cation channel subfam... [more]
sp|Q2WEA5|TRPM1_RAT5.540e-4233.05Transient receptor potential cation channel subfam... [more]
sp|Q93971|TRPG_CAEEL2.530e-3926.46Transient receptor potential channel OS=Caenorhabd... [more]
sp|Q8CIR4|TRPM6_MOUSE2.956e-3832.26Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FX171.125e-13033.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E1J71.596e-13033.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FD751.981e-13033.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A5K4FE953.966e-12842.86Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A094ZK286.820e-11929.77Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm56.796e-5223.64transient receptor potential cation channel subfam... [more]
trpm77.338e-4931.55transient receptor potential cation channel subfam... [more]
trpm78.104e-4931.55transient receptor potential cation channel subfam... [more]
trpm78.172e-4931.55transient receptor potential cation channel subfam... [more]
trpm78.239e-4931.55transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trpm71.727e-3725.42transient receptor potential cation channel, subfa... [more]
trpm72.841e-3527.05transient receptor potential cation channel, subfa... [more]
trpm22.148e-2422.70transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO301352.086e-3627.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476581.530e-3131.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm73.923e-4832.11transient receptor potential cation channel subfam... [more]
trpm73.989e-4832.11transient receptor potential cation channel subfam... [more]
trpm74.555e-4832.11transient receptor potential cation channel subfam... [more]
ENSORLT00000021513.25.401e-4528.10transient receptor potential cation channel subfam... [more]
ENSORLT00000029710.15.870e-4526.15transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel,subfamily m, member, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064622.11.602e-7896.15SMESG000064622.1[more]
SMESG000064632.13.043e-1364.48SMESG000064632.1[more]
SMESG000064632.15.697e-1464.48SMESG000064632.1[more]
SMESG000064637.15.566e-2855.26SMESG000064637.1[more]
SMESG000064637.10.000e+055.26SMESG000064637.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007509 ID=SMED30007509|Name=Transient receptor potential cation channel,subfamily m, member, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=4034bp
AATTATTCAACAATTTAATTTATAAAACATAATTTTGAGAGACTTTATTT
TATTTAATACTTATTATTAGCTTATTTTTTAAAAAACATAAAAGATTTAA
AATTAAAATCATGAGAAAAACTCCACTAAAAAAACAAAGTTTTATTAATG
ATGAATTCAGTGCAAGTATAAGACAAGCCCGGTTCAAAATCACCGACAGC
AATCGAGGCAGCCACATTCGATTCAGTGAAAATGATGAGAAAGCTCTTTA
TAGAAAATTTGTCAAATCGAATTTCCATTCAATTGAATGTAGAAAATTTT
CGTCATTAGAAGAAATTTTGGATCACAATAATGCTAAGTGTATGTGCGGT
GAGGCGAAAAAAAATCATAAGATTGACAAAACTCCTTTCAGCCTTTGTGA
CCCTTGGAAGGAAAATGAAAGTATGGAAGTGATATCAACAGATTCATTTG
GAAAAATTGAATTTTTCGGCGAAGACATTACGAATACTAAACTCACAGAT
TTTGTTCGAGTGAGTTATAATGATAAACTTGATGATATACTCGAATTATT
GTTTAACAAATGGAACATTAATGTTGGAACTCTATGTATCTCGGTCATTG
GGGGGACAATTGATTTCAAAATGCGAAAAAAGGAGAAAAATATATTTTGT
CAGGGTTTAATTAAAGCTGCAATTACTACAAATGCCTTGATTATTACTCC
TGGGTTAAATAAAGGCATTACAAGTGTTATTGGGGATGCCATTCAATACA
GCCAGTCTTACCTCTATGATAAAATGAAGCACAACAATTTCATTTCTTGT
CTTGGAATTGCGCCTTGGGGTTATGTTAAAAATCGAAACATTTTGGAATT
TGCAAAGGGGAGAACTGTTCACTATAATGTTTCAAATGAAGTCGAAAAAC
ATCAACCGATTTCTCTTAATAAAAATCATACTCATTATATATTTTTTGAT
GATGGTTATCGGCTTCAAATGACTAAGAAAAAAGTGGGATATTTTCGACA
AGCTCTTGAAAATAAGATAAGTCAAAAACAAGGGGATAGAGTAGGCATAC
CAGTGGTGTTACTTATTGTAGAGGGAGGCCATGATATTTTTATAGAAGCT
AGCAGACGAGTGAAGGAAAAAGTTTCAATTGTTGTGTGTGAAGGAACAGG
TAAAGCTTCTGATATTATTGGTGAAGCTTTTCGTGAGATGCAAAGAATCT
GTTCTAGACATAAAATGATTCGATCTGACGGCGTTGCGATGCTCCCTGAA
AGTTTTAAAACGTTTTAAAACGAAAACTCATTGAGCAGGATATTTCTGAG
CTACATCAAGTTGATGAAGCCATTAAATGCATTGAAGATATTATCAAAAA
TGAATTACTTATTACGGTTTTTGATATAAAATCGCATGAAGATTTAGATT
TTGCAATTCTGTATTCTCTTATCAAACGGATGGACCTTTTGTGTGATTCT
AATCAAAATCCATTGTCTAGCCAATTATCTCTTTGTCTCACTTGGAATAG
AGTTGATATTGTGAAAGATAAAATTTTCTCAGGAGACATCTCCTTGTCAA
ATGATGAATGGGCGGCTTTTCTGAAAGATTCAATAATCACTGGAAAAGTG
AAATTTATTGAATTGTTTTTGGAAAACGTTTCCAATATCCAAGATTTTCT
AACCGCTAATATTTTGAAAGAGTTATATGAAACTTGCCCAAAATCTACAA
ATTTTCGGAAAACCTTTTTGCGATTAATTGGTCGGCCATTTTCAAAGGGA
TTAAATGATGTCAAAGAATTGCTTTCGAAAATGATTGGATTTTATGAATA
TCCTTGCTCTGAAAACGATAGTATAAAGCATCCATTTCAGGAATTATTTT
TATGGGCTGTTCTGATGGAAAAACAAAAGTGTGCCAAATTCTTTTGGGGA
AAATGTGACGAATCTCTATTTCTTGCATTAGTAGCAACAAGAATCTACAA
ATATCACCAGAGGACATCTCTCCGAGATACTGATAGAAGCGAGACTTTGG
AAACCTGGAAAAATTATTTCGAAAATCTAGCCGTGAAACTCATTGAAGAG
TGTCATGATATTGATCAAGAAGTTGCAGCTTATTTAATTGAGAAAAAGAA
TGAAAACTGGGGTGGGATTAGCTGCTTGGAGTTAGCCAGCAAATCGACAG
ATCTGAAATTTATGAGCAATATTGTATGTCAGAAGTCTATAGAATTCACA
TGGAGAGCGGGATTTAATATCAACTTTTTTAGTTGTATTCTTTGTATAAT
ATTTCCCTTTTTGATTTCCAAACGAACGGAGTTCACCAAAGACTTCAAAA
CTTGCCAATCTGAATCATTTCCAGATTTCAATGAAGACAACTGCCGCACT
TCGATTTTTTTGAAGTTGCGAAGGTTTTATCTAGCTCCTCAAACGAAGTT
CTGTATCCATAGTTTTACATTTATTTCATTTATCATTTATTTTTCCTACG
TTGTTTTATACGGAATGAAACGAATGCAGCTAACAATTCATGAAATAATG
TTTATGATTTATCTGGTTCTGATGATTTTGGATAAATTTGTCGAGATATT
CAAGTCAAGATCCGATAGAATTTATGGTCGCATAAAGTATTGGTGGACCT
TTAATCACTGGAATAAGGTTGATATGATTATTATAGTTTTTGCAATAGTG
GCGATGGTATTGCGATACCAACTGGCCATCAATGGTGTCTACACAGACAA
AGTTGTTATGTTTCGCTGGTCAAAAACCATATATAGTCTAATAGTCGGAT
CGTTTTACTTGAAAATTTTGCGGCTACTGGCATGTCACAAAAAATTGGGT
CCGAAAATTTTTATGATGTCAAAAATTATTAAAGAGCTTCTGATATTTTC
AACGATCATATTAATCTTTCTTTTGTCATATGGCGTTACAAGTCAGGCTG
GATATTATCCACAAAGAGATTTTTCATGGATTGCACTATCAAATATTTTA
GATTACCCTTACTATACGATGTTCGGGGTTTTAAATTTGGGGAACACTGT
CTATTTCACTTGGTGCAACGCCAGTACAAATTACGAGCCACCTCCAGTTA
CATTTGTCAAGATATTCATGGAAATTCAATTGTCATATGGAAATACAGCA
TGTATTCTTTGATTCTTGAATATAATGATAAACCGATTCTACCAATGCCA
TTTTCAACATTTGTTTACATATACCAAGTTCTTGCATTTTGTTACCAGAA
GGGTCGATGCTACAATCTCAGCAATAGTAAAAAATTCGAAATTACCAAAC
ACAATTCAAAATTGCACATTGACAAGCCAATGGCATTCAAGCACGATACA
CTGAACATATTTTCCAACATTAAAAGCGATTCTGATTTAAACAAACTTAT
CAAATATTTCGAAAATTATTCTCAGAAATTTGTAATCAAAAACATTGCAA
TTGAAAAACAAAAGTCAATCAAGTCCGGAATTTCTCGAATGGAAATTAGA
TCAAAATCAATTTTCAAAGAATTAGAAAATATTCAAACAAAATTGAATAA
AATCCAAATTAAAAATGTGAAAAAGGTTCAGGAAGGCTCATTTACAAATA
CAAATGGTGAATATCAGAATATAACTAAACAACCTAAAGACTCCATGGCA
TTGCTTTTGACAAGCCTCAACAACAACATTTTGGTGTTACAAGATGAAGT
CAACAGAATTGGACAAGAAGTGAACATTGTGTCCACAGAAAACTCACCAG
TTGTCATAACTGATAATAATTGCATGGAATCAAACATATCCAGCAGTCAA
AGAGTCATTGAAAGTATTTCTTTGAATCACAACGCATCGAATATTTTATT
TGTTATGAATGAGAATGAAAAAGAAAATATTATCAATGAATTCAAAAGGA
AAAATATTGAAAATGCCAAAGAATTGAGAAATGTCCATGAAAAATTTGAT
AACTTCAGAAATCAAACGCTAAACTCTCTAAATAATATTGAGTTGATGAT
GAGAAAACTATGAATTAGGATGACTAAAATAAATTAAATGACTGTTTTTT
GTTTTAAACAAATCTATTTGAAAATTTAATTTTG
back to top

protein sequence of SMED30007509-orf-1

>SMED30007509-orf-1 ID=SMED30007509-orf-1|Name=SMED30007509-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=561bp
MDLLCDSNQNPLSSQLSLCLTWNRVDIVKDKIFSGDISLSNDEWAAFLKD
SIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLI
GRPFSKGLNDVKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQK
CAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENL
AVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVC
QKSIEFTWRAGFNINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDF
NEDNCRTSIFLKLRRFYLAPQTKFCIHSFTFISFIIYFSYVVLYGMKRMQ
LTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKVDMI
IIVFAIVAMVLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLL
ACHKKLGPKIFMMSKIIKELLIFSTIILIFLLSYGVTSQAGYYPQRDFSW
IALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEPPPVTFVKIFMEIQ
LSYGNTACIL*
back to top

protein sequence of SMED30007509-orf-2

>SMED30007509-orf-2 ID=SMED30007509-orf-2|Name=SMED30007509-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=346bp
MDCTIKYFRLPLLYDVRGFKFGEHCLFHLVQRQYKLRATSSYICQDIHGN
SIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSN
SKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQ
KFVIKNIAIEKQKSIKSGISRMEIRSKSIFKELENIQTKLNKIQIKNVKK
VQEGSFTNTNGEYQNITKQPKDSMALLLTSLNNNILVLQDEVNRIGQEVN
IVSTENSPVVITDNNCMESNISSSQRVIESISLNHNASNILFVMNENEKE
NIINEFKRKNIENAKELRNVHEKFDNFRNQTLNSLNNIELMMRKL*
back to top

protein sequence of SMED30007509-orf-3

>SMED30007509-orf-3 ID=SMED30007509-orf-3|Name=SMED30007509-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=386bp
MRKTPLKKQSFINDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKF
VKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWK
ENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNK
WNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLN
KGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKG
RTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALE
NKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKAS
DIIGEAFREMQRICSRHKMIRSDGVAMLPESFKTF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR041491TRPM_SLOG
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041491TRPM, SLOG domainPFAMPF18139LSDAT_eukcoord: 1..252
e-value: 5.6E-57
score: 193.1
NoneNo IPR availablePANTHERPTHR13800TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL, SUBFAMILY M, MEMBER 6coord: 1..249