coiled-coil domain-containing protein 170

Overview
Namecoiled-coil domain-containing protein 170
Smed IDSMED30007500
Length (bp)2421
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of coiled-coil domain-containing protein 170 (SMED30007500) t-SNE clustered cells

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 170 (SMED30007500) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of coiled-coil domain-containing protein 170 (SMED30007500) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 170 (SMED30007500) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007500

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30007500h1SMcG0007823 SmedASXL_015929SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30007500h1SMcG0007823 Contig45791newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007500h1SMcG0007823 Contig45791uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30007500h1SMcG0007823 dd_Smed_v4_10140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007500h1SMcG0007823 dd_Smed_v4_10140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007500h1SMcG0007823 dd_Smed_v4_10140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007500h1SMcG0007823 dd_Smed_v4_10140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30007500h1SMcG0007823 dd_Smed_v4_10140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30007500h1SMcG0007823 dd_Smed_v4_10140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30007500h1SMcG0007823 dd_Smed_v6_10140_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30007500h1SMcG0007823 Contig45791newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30007500h1SMcG0007823 Contig45791uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30007500h1SMcG0007823 dd_Smed_v4_10140_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Human
Match: CCDC170 (coiled-coil domain containing 170 [Source:HGNC Symbol;Acc:HGNC:21177])

HSP 1 Score: 142.51 bits (358), Expect = 1.688e-34
Identity = 181/660 (27.42%), Postives = 335/660 (50.76%), Query Frame = 3
Query:  330 REEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVE-NKVYAK------ELEDQISDISAARDELQRQIQDIKLSITE----ATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQT-DEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYT 2273
            R E+AA  VK +  ++EL +   ++  KE   + +K      +E  AR    L +    V E  E   A  T + R  I   +   E  E ++ +VE N+   K      E + Q+S      +E   Q++D  L   E    A+ E++      I K++ L  EN+  K +I+ LEE +   + E +ASR+TI RL ++++ E+ K A+  E+   L +++     +K  +E ++  ++ +L + ++  +   Q+  +  K   E+  + K +Q      Q+    F   + ++L        +   TI E I   + S  +++  + +   + ++E +  L  +    +K   R    E+      +E L  +L + E +L+S  ++ D LN +K KY + L +L++ M ++++  ++GFDM  + + AR  QL +LE +   +++   H+L RK+K  KE++ SK+LH+ LL +K+A  E  +Q+   +  ERD   L+ + L K  ++LQ+E+   R    ELK  L + N+LK+  L   + ++ L    ++LE +++K  K L   KS     E E  E KE A   I  + +E++ +K SL + +++E Q+ + R V++++LGL++ +LA+PD+EII  LERL+ +H  +  T
Sbjct:   46 RSELAATLVKFECAQSELQDLRSKMLSKEVSCQELKAEMESYKENNARKSSLLTSLRDRVQELEEESAALSTSKIRTEITAHAAIKENQELKKKVVELNEKLQKCSKENEENKKQVSKNCRKHEEFLTQLRDC-LDPDERNDKASDEDL------ILKLRDLRKENEFVKGQIVILEETINVHEMEAKASRETIMRLASEVNREQKKAASCTEEKEKLNQDLLSAVEAKEALEREVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIRE-MDSREESRDRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAEN-----MLETLQGQLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMAAELGFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALVVERDNAHLTIRNLQKKVERLQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNMIEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDYEIIKCLERLVHSHQHHFVT 692          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Zebrafish
Match: ccdc170 (coiled-coil domain containing 170 [Source:ZFIN;Acc:ZDB-GENE-070112-162])

HSP 1 Score: 112.464 bits (280), Expect = 3.723e-25
Identity = 167/680 (24.56%), Postives = 317/680 (46.62%), Query Frame = 3
Query:  330 REEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGL----VENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEW---IIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNK-----------------RLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKE-------QELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAH--HSNIY 2270
            REE+AAL  K ++++ +LSE+   +  +E  + S+K      +E+ AR +  +G+  +      +   +  + R   +I I +L  E  E ++ +    VE+K Y  E      + + A+ + +  I  +   I+   + +   +  +++ V     + +  KN + +LEE +K  + E +ASR+T+ RL   +  E+T +A+   ++ +  +E+D                   L SLRK    L ++N+     +QE  A   + QQ      L  H+ N L   L    +  +N++          +  V++LL    D  + P     + + S  +D+   E    +   E + +L   VE L+                  R+++ E +L+++ +  DG+N DK +Y R + +L+ ++ ++++  ++GFDM  E +  RA QL + E     + +   +SL RK+KE K +  SKDL+++LL +K+   E  ++S   +  E+D   LS KKL K   +LQ E+  LR    ELK  L + N+L++  +   Q ++     + KLE  + K  + L+   S   ++E       Q+ + + +T  +AIA L                 E Q+++  TV++++LG+      IP++E++ RLE LI +   HS  +
Sbjct:   22 REELAALQAKHNSLQTQLSESQSRVVSQEETLRSLKDAVDRYKEKEARQESLIGSLRERNYNTEQEMISITSTRSIMDIRIQTLTKENQEIKEKIMQLEVESKQYVAECNKAKQEAAEAQRKCEEFISTLANKISVIATGKADPMDYIVSVVDACFKDRERLKNCVCALEESVKLYEVECKASRETVKRLATDVDREQTLSASRANELNSSRQELD-------------------LISLRKVS--LERENQSAKVSLQEAEAALASAQQ------LCRHYEN-LSQDLQNKLQISQNEAKASHRHHGAFMKKVETLL----DDHSLPGQHTEQDMLSALTDLCKRETSAQKSQMEMEVRLAEMVEQLSSIKEHQNTSEQKKQELLDRIQSLEDELINARVCKDGMNQDKQQYLRFVEQLSEMLKVDDVAAELGFDMRLEVILTRAQQLSRHEGTALLETKTQTYSLQRKLKEQKSRSESKDLYLELLRRKVQQLEEEKRSRSTLALEKDDAALSCKKLQKRVDRLQAELSTLRFSNTELKAQLSHTNQLQITVMEQKQTIEEQNKNLGKLEKKKVKTEQKLTSVTSELKSQELKARDEIQQAHRLLDTQSSAIADLT--------------HTEKQLLDFYTVVSQMLGVHCTG-CIPNYEVLRRLEVLIQSRQCHSTAH 654          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Xenopus
Match: c1qtnf4 (C1q and TNF related 4 [Source:Xenbase;Acc:XB-GENE-975450])

HSP 1 Score: 144.05 bits (362), Expect = 2.597e-35
Identity = 148/504 (29.37%), Postives = 265/504 (52.58%), Query Frame = 3
Query:  780 LIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAK-TNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRL-----TVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYT 2273
            L  +N   K  I SLE+ +   + E + SR+TI RLV+++S E+ K ++  +++ +L + ++     K  +E +I   + +L++ ++  E   Q+     K   E+  + K T  +     +L   F  ++ + LS +    K     I E I       + +K + + T  S L E +  L       E+L ++    ++   R       ++DL  RLK AE +L+S  ++ D L+ +K KY + L +L+  M ++ +  D+GFDM  EA+  RA QL KLE +   +++     L RK+K  KE + SK+LH++LL KK+A  E  +Q    +  ERD+  L+ ++L K   +LQ+E+         LK  L + N+LK+  +   + ++ L   V++LE  + K  K L   KS     E++  E KE +   +  + +EL+ +K +L +  ++E Q+++ R V++++LGL+++ LA+PD+EII RLE LI  HH +I +
Sbjct:   85 LYKDNTELKGSIASLEQTVNVHETESKGSRETIMRLVSEVSKEQKKASSFAKQLDSLQKNLESTSDDKESLEREIKILKDRLSASQRAWEASKQELGQVKKSSTELDLSLKSTRGEAKAAHSLHESFKETVAAALSHDSIAVKPKEEAILEKIRD-----MYHKAENRKTIISQLEERVFKLS------EQLQTQTELHQESMSRARKAEQYLDDLGGRLKLAEGELVSGDVMRDNLSHEKQKYMKFLEQLSEKMKIDRVATDVGFDMRLEAILGRADQLVKLETNAIIENKTRAQGLQRKLKAQKETIDSKELHMELLRKKIAQLEEEKQVRTALAVERDEANLTVRRLQKKVDRLQKELNVALDSNTGLKARLSDTNELKIKTIEQHKTIEELNKSVDQLEKEKGKTQKKLVSVKSELEFTERDAQEEKERSANLLEVVTSELKTLKKTLEEVVKREKQLVDFREVVSRMLGLNVNVLALPDYEIIKRLEGLIHNHHHHIVS 577          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Xenopus
Match: ENSXETT00000000426.1 (coiled-coil domain-containing protein 170-like [Source:NCBI gene;Acc:100488825])

HSP 1 Score: 92.4337 bits (228), Expect = 1.283e-18
Identity = 127/522 (24.33%), Postives = 252/522 (48.28%), Query Frame = 3
Query:  759 VINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKT-NQQTDEQQALINHFINSLISILSENYKT-PKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDI-----IDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMIS---EALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHN------QKLQEEVENLRAEVIELK-------GSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAH 2255
            ++ KV+ LI E+   K+K+ SLEE L  R  E +ASR+TI +LV+++   +   A  + ++ ++ RE D+  ++K   E +      ++    KE     Q+   K K++ E+  T +T + +     +L   FI  L ++LS  + T P+ +     E I   ++ +   + + K T +  L E +  L   +     +  E +     +EE       +++  + LK+ +  L S  +I DG N ++ K  + L ++A  +N   + +DI    ++   E L  RA ++ + +     D +   ++L +K+    EK+            K    E  ++ ++ + KE++++LL    L+  N      QKLQ++VE L+ ++ E+K         L++ + LK   +   + ++ L+  + KLE I++K +K +   K+     E E    KE     + ++  EL   K +L +  ++E Q++  R  I +++G +L+ LA+PD EI ++L+R++  H
Sbjct:  247 LLTKVEKLIKEHFVQKSKLSSLEEVLAGRQVEYKASRETIVQLVSEIDKHKKTVAGLEAQLKSIKRERDETLLAKQSAEQEKELLLGKIKDNHKEWSSFQQELVRKEKKLNELDRTLRTSDYEAKASHSLHQSFIIQLATVLSNGFITVPRTE-----EAIKERIQEICSREQEWKVT-TDELQEKVLKLTKQLDQQRDLYHEAVTKAYKAEE------ILQENQESLKHLKGKLTSEEMIKDGFNSERKKLKKFLLQMAEKLN---VVQDISSGSLTSQYEVLLNRAEEVTERDKGFLKDSKTLIYNLQKKITSQAEKI----------ELKSTKIEQLEKKIKQLEKEKEQQLL----LSAENSGSLTAQKLQKKVERLQGQLSEMKITTQTLTAQLVDMSDLKERNMQQKKTIEELSRALEKLEKIKEKAAKKVVSLKTELDYSEHEFRGDKERCQHMVEAVTNELHTAKRALEEVAKREKQLVYFREAITRMMGFNLNTLAVPDHEIFDQLKRVLRTH 739          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Mouse
Match: Ccdc170 (coiled-coil domain containing 170 [Source:MGI Symbol;Acc:MGI:2685067])

HSP 1 Score: 140.969 bits (354), Expect = 3.827e-34
Identity = 171/648 (26.39%), Postives = 330/648 (50.93%), Query Frame = 3
Query:  336 EVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVE--NKVY--AKELED---QISDISAARDELQRQIQDIKLSI----TEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQ-TDEQQALINHFINSLISILSENYKTPKNDSLTIFEWI--IGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLE 2237
            E+AA+ VK +  ++EL E   ++  KE   + +K      +E  AR    L +    + E  E   A    + R    + ++  E  E  + ++E   K+   +KE E+   Q S+     +E + Q+ D  LS+     EA+ E++      I K++ L  E    K ++ +LEE +   + E +A+R+TI RL A++S E+TK A+  E+   L +++      +T +E ++  Y+ +L + ++  +   Q+     KR QE+  + K +++ T   Q+  + F   L ++L   + T ++    I E I  +G  +   +++  + +   + ++E +  L ++    +K   R    E       +E L  +L + E +LLS  ++ D L  +K KY + L +L   M +  +  D+GFD+  + + AR  QL +LE +   +++   H+L RK+K  KE++ SK++H++LL +K+A  +  +++   +  ERD+  L+ +KL K  +++Q+E+   +    ELK  L + N+LK+  L   + ++ L    ++LE +++   K L    S   N EQE    +E + A I   + EL+ ++ SL++ +R+  Q+ + R V++ +LGL++ +   PD+EII  LE
Sbjct:   51 ELAAMLVKFECAQSELRELRSKMLSKEACCQELKVEMESYKESSARKSALLTSLRGRMEELQEESAAVSASKSRAEASVHAMMKENQELMKKVLELDEKLQNCSKENEESKKQGSEHLRRHEEFRAQLHDC-LSLDKKHEEASDEDL------ILKLRELYKEPTFLKGQLATLEETVTVHEMEAKANRETIRRLAAEVSREQTKAASWAEEKDKLNQDLLSAVEGRTALEREVKLYQERLLASQRAWDASKQELTQLRKRCQELDVSLKASREATTASQSRNSCFREKLTALLCSRFDTAESTEDAILERIRELGIEE---ESQRRMASQLEAQISEFVGKLGNESESHQKALQRAHVAEKK-----LEALQSQLSHLEGELLSGDVVRDNLFLEKQKYLKFLDQLTEKMKLGHVAADLGFDVCLDVVLARIEQLVRLESNAVIENKTMAHNLQRKLKTQKERLESKEVHMNLLRQKIAQLQQEKEARSALAVERDEAHLAMRKLEKKLERMQKELSACQEHNTELKAKLADTNELKIKTLEQTKAIEDLNQSRDELEKMKENAEKKLMLVMSELENTEQEARAHQERSRAMIELASLELKTLRKSLDEAERRGMQLADFREVVSSMLGLNMTSHDPPDYEIIKCLE 683          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Mouse
Match: Ccdc170 (coiled-coil domain containing 170 [Source:MGI Symbol;Acc:MGI:2685067])

HSP 1 Score: 139.813 bits (351), Expect = 9.137e-34
Identity = 171/648 (26.39%), Postives = 330/648 (50.93%), Query Frame = 3
Query:  336 EVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVE--NKV--YAKELED---QISDISAARDELQRQIQDIKLSI----TEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQ-TDEQQALINHFINSLISILSENYKTPKNDSLTIFEWI--IGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLE 2237
            E+AA+ VK +  ++EL E   ++  KE   + +K      +E  AR    L +    + E  E   A    + R    + ++  E  E  + ++E   K+   +KE E+   Q S+     +E + Q+ D  LS+     EA+ E++      I K++ L  E    K ++ +LEE +   + E +A+R+TI RL A++S E+TK A+  E+   L +++      +T +E ++  Y+ +L + ++  +   Q+     KR QE+  + K +++ T   Q+  + F   L ++L   + T ++    I E I  +G  +   +++  + +   + ++E +  L ++    +K   R    E       +E L  +L + E +LLS  ++ D L  +K KY + L +L   M +  +  D+GFD+  + + AR  QL +LE +   +++   H+L RK+K  KE++ SK++H++LL +K+A  +  +++   +  ERD+  L+ +KL K  +++Q+E+   +    ELK  L + N+LK+  L   + ++ L    ++LE +++   K L    S   N EQE    +E + A I   + EL+ ++ SL++ +R+  Q+ + R V++ +LGL++ +   PD+EII  LE
Sbjct:   45 ELAAMLVKFECAQSELRELRSKMLSKEACCQELKVEMESYKESSARKSALLTSLRGRMEELQEESAAVSASKSRAEASVHAMMKENQELMKKVLELDEKLQNCSKENEESKKQGSEHLRRHEEFRAQLHDC-LSLDKKHEEASDEDL------ILKLRELYKEPTFLKGQLATLEETVTVHEMEAKANRETIRRLAAEVSREQTKAASWAEEKDKLNQDLLSAVEGRTALEREVKLYQERLLASQRAWDASKQELTQLRKRCQELDVSLKASREATTASQSRNSCFREKLTALLCSRFDTAESTEDAILERIRELGIEE---ESQRRMASQLEAQISEFVGKLGNESESHQKALQRAHVAEKK-----LEALQSQLSHLEGELLSGDVVRDNLFLEKQKYLKFLDQLTEKMKLGHVAADLGFDVCLDVVLARIEQLVRLESNAVIENKTMAHNLQRKLKTQKERLESKEVHMNLLRQKIAQLQQEKEARSALAVERDEAHLAMRKLEKKLERMQKELSACQEHNTELKAKLADTNELKIKTLEQTKAIEDLNQSRDELEKMKENAEKKLMLVMSELENTEQEARAHQERSRAMIELASLELKTLRKSLDEAERRGMQLADFREVVSSMLGLNMTSHDPPDYEIIKCLE 677          
BLAST of coiled-coil domain-containing protein 170 vs. UniProt/SwissProt
Match: sp|Q8IYT3|CC170_HUMAN (Coiled-coil domain-containing protein 170 OS=Homo sapiens OX=9606 GN=CCDC170 PE=1 SV=3)

HSP 1 Score: 142.51 bits (358), Expect = 8.106e-34
Identity = 181/660 (27.42%), Postives = 335/660 (50.76%), Query Frame = 3
Query:  330 REEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVE-NKVYAK------ELEDQISDISAARDELQRQIQDIKLSITE----ATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQT-DEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYT 2273
            R E+AA  VK +  ++EL +   ++  KE   + +K      +E  AR    L +    V E  E   A  T + R  I   +   E  E ++ +VE N+   K      E + Q+S      +E   Q++D  L   E    A+ E++      I K++ L  EN+  K +I+ LEE +   + E +ASR+TI RL ++++ E+ K A+  E+   L +++     +K  +E ++  ++ +L + ++  +   Q+  +  K   E+  + K +Q      Q+    F   + ++L        +   TI E I   + S  +++  + +   + ++E +  L  +    +K   R    E+      +E L  +L + E +L+S  ++ D LN +K KY + L +L++ M ++++  ++GFDM  + + AR  QL +LE +   +++   H+L RK+K  KE++ SK+LH+ LL +K+A  E  +Q+   +  ERD   L+ + L K  ++LQ+E+   R    ELK  L + N+LK+  L   + ++ L    ++LE +++K  K L   KS     E E  E KE A   I  + +E++ +K SL + +++E Q+ + R V++++LGL++ +LA+PD+EII  LERL+ +H  +  T
Sbjct:   46 RSELAATLVKFECAQSELQDLRSKMLSKEVSCQELKAEMESYKENNARKSSLLTSLRDRVQELEEESAALSTSKIRTEITAHAAIKENQELKKKVVELNEKLQKCSKENEENKKQVSKNCRKHEEFLTQLRDC-LDPDERNDKASDEDL------ILKLRDLRKENEFVKGQIVILEETINVHEMEAKASRETIMRLASEVNREQKKAASCTEEKEKLNQDLLSAVEAKEALEREVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIRE-MDSREESRDRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAEN-----MLETLQGQLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMAAELGFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALVVERDNAHLTIRNLQKKVERLQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNMIEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDYEIIKCLERLVHSHQHHFVT 692          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: A0A1S3J8Y0 (coiled-coil domain-containing protein 170 OS=Lingula unguis OX=7574 GN=LOC106171087 PE=4 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 4.048e-71
Identity = 237/778 (30.46%), Postives = 406/778 (52.19%), Query Frame = 3
Query:   96 LESPYLINGSSRSISFMKSPTQTE---RAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKL--------LPSRNICVE--REEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYN------VSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAK-TNQQTDEQQALINHFINSLISILSENYKT--PKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDI---IDIEKLNSRISSEEDPQLRLTVE--DLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGF---FHDPCVV 2339
            +ESP L    S       SP+ T+   R  L +LQ+Q+K++++E+++KD+LI QLS ++  N      +  +          +  +  E  R E AAL+VK+++++ +  +   +++ K+  ++ +++   + +E  ARL   + +    ++E      + E    R  + ISSLQ E  E Q  +VE +   +    +  +        +++ Q+I   I  A  E+  +      V  ++ K K +I EN   K K+ SL E L++ + E +ASR+TI RLV++++ E+  ++    ++ NL  E D   +SK  +E +I   + +L + ++       + + + KR+  +   A+ ++      Q   N F  +L SILS+ ++T  P  DS      I   +  LL    D K +    L   + +L+       D++K        E    RL VE  D+ +RL   E DL +  +  DGL  DK  Y + + ++A VM M+ I+ +IGFDM  E L  RA QL KLE D   D     ++L RK+K +KE++ SKDLH+DLL KK+ + E +      + KERD E +  +KL K N+K Q  ++  R E+ +LK  L++   LK+  +  ++E+  L   V++LE IR KQ+K ++  K+     E E  E K ++   + +L++ELR  K  L D  ++E Q++++R VI+++LGLD++ LAIPD+EII+RLE+LI  HH++  T   +E  L++M  GF   + D  VV
Sbjct:   59 VESPVLFGRPSSPFGRPSSPSTTQTQNRKMLMELQDQVKSYKEELLKKDQLISQLSTVDATNSSRGLSQRSIEIAKLETVFGAERMSAETARGEAAALHVKVEHLQAQNKDLQIQVESKDDKIKEIRKEVEKYKENDARLSSLVQSLRDRLHEAESQSGSLEAAAGRCEVTISSLQKENREAQDRIVELESRLRSHLSEREEAEQKAAAAEKKYQEIWTHIGSALGEDGISPASSSSVDILVRKAKDIIAENAIMKGKLTSLHEALENTELETKASRETIMRLVSEVNREQNASSKYTVEMDNLRMERDNAIMSKRELEQEIKLLKERLDASQRAWNATRHELDEREKRLSHLDREARESSFSVRNYQTQYNAFRETLASILSDAFRTVPPSEDS------IKDKIGQLLAANKD-KESHIELLESKVKNLQEQFQNQYDLQK------ESEHRAHRLEVERRDIAERLHKYEADLAAGEVFRDGLRTDKENYLKFMEKMAEVMKMDRISSEIGFDMNGETLLTRAEQLVKLEADALADRSTHIYNLQRKIKTMKEQLESKDLHMDLLRKKIVALEEKLVGRSELEKERDGETIRVRKLQKQNEKYQVLLQEARVEITDLKAQLMDSTNLKIKTMEQEKELAGLEKTVSELEKIRHKQAKKIAGLKNDFEATENEFAEKKSSSLNTVQALSSELRTTKQLLEDTSKRERQLVDLRQVISRMLGLDVNTLAIPDYEIISRLEKLIQTHHAHTITAAGLESALEDMEDGFIRGYQDARVV 823          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: A0A1I8G8S9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 2.436e-70
Identity = 211/697 (30.27%), Postives = 375/697 (53.80%), Query Frame = 3
Query:  330 REEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCE---LREEIARLQVAL-GNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDIS---AARDELQRQIQDIKLSIT-EATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQT--DEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKN-TPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFHDPCVVHTHHTHLIDEKPIYPK 2387
            R EVAAL VK+D ++ +L E   EL   ++ +ES +R   E   LRE+ AR Q+AL    ++ ++     + ++E ++ R+   +  LQ++L   Q          ++LE +++D     A R   +R++ +   S+       E  ++  +IN+   L  E  + + +  S EE+L + + E +A+R+TI RL+A+++ E    A      +      ++    +  +   +   E +L S R+ +E    +   K   + ++ +T++  Q+   D +Q L +  + SL S LS  +         + E +    +       D K  + +S  +E  +   +  ++ +  NSR    +  +  + + D+++RL+  E++L +  ++ DGL  D+ K+++ + +LA  M M+++  DIGFDM+ +AL ARA QL +L  D   D   T +SL RKVK LKE++ S+DLH+DLL KK+   E R      + +ERD E    ++L K  +K Q ++E  RAE++ LK  L+  + LK+ AL  D+E+ +L   + KLE +RQKQ+K +S  KS    +++EL +    A+ A+++L++ELR  K +L + +R+E+Q++++R V+ ++LGLD+++LA+PD+EI+NRLERLI AH SN+YT  S  + +Q+M   F         H   L       PK
Sbjct:   56 RSEVAALRVKVDGLQAKLREKQLEL---DSALESAQRHRAEADRLREDNAR-QLALNAELSRQIDCCEATRGSYEEVKSRSGQAVFELQEQLRRAQD-------RTRDLEAKLADRDVRDAGRSSSERRLTEFAASLAYHLEVSESASLDTLINRASNLAQEAATLRARSRSQEEQLAAHEAEARANRETIQRLLAEVNREHRAAAAYQTHQSEFRTGTEKLTAERDDLARQVELLEARLESNRRVLEATKAELAEKDSHVAKVDSTSRELQRRAEDSEQQLAS-LLQSLASTLSTQFSHVTATEEAVKERVCALCR-------DYKELSEASAAHEERSRKAAKQLEAQVSNSREREAQARRAEVELRDMHERLRAMESELAAGDVVRDGLAADRQKFYKYMQQLAEAMKMDQVGADIGFDMLGDALLARAQQLARLSDDAAHDKASTVYSLQRKVKALKEQLESRDLHMDLLRKKIGQLEERAAGRVEVERERDNENGRVRRLQKQLEKSQAQLEQARAEIVSLKAQLLECSNLKLAALEQDRELAALENTMEKLEQVRQKQAKKISLLKSEVETRQRELGDKSTAAEGALSNLSSELRTTKSALEEARRREHQLLDLRAVVGRMLGLDVESLAVPDYEIVNRLERLIQAHQSNVYTAVSANEAMQDMQASFLDGYTDAQRHQLSLTAASKQEPK 733          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: A0A210PKU6 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09803 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 9.704e-66
Identity = 224/744 (30.11%), Postives = 392/744 (52.69%), Query Frame = 3
Query:  147 KSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQL------SKIELKNCPENFLEPKLLPSRNICVE--REEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAAR----------DELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQ-TDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFF 2321
            + P+ ++R  + +L +Q+K+F++E+ +KD LI QL       K+ +++  + +    +       V+  R EVA L VK + ++  +SE   E + K+  ++ +  +    +E   RL   L +    + E      ++ET   R+   +S+LQ ++ E Q+ ++E       L   + D  AA           DEL  Q+  + L +    S       +++ ++  L+ EN   K KI+++ E L S + E +ASR+TI RLV+++  E+        +I NL  E D+   ++   E +I   + +L +  K +E   ++ +++  RI  +    +++          +  F   L +ILS    TP        E II  +K + Q   +  N   S L E + +L   +    +L+   +S    +    + + + RL++AE +L +  ++ D L  D+ KY R L +L  +M M  I+ D+G DM  EAL ARA QL K+E D   D     ++L RK+K LKE++ SKDLH+DLL KK+ S E +      I KERD E    +KL K  +K + + ++LR E+  LK +L+  +++K+  L   +E++ L A+V++LE  R +Q++ +S+ K+S   +E E  E +  AD A+ +L++ELR  K++L   + +E Q+++ R V++++LGLDL  LA+PD+EII+RLE+LI AHH++ +T  SME+ L +M  GF 
Sbjct:   60 RPPSPSQRRAVSELNDQVKSFKEELRKKDALIQQLVSMDAIPKVTVRSGADAYRHDAVFMGDRHAVDTARSEVATLQVKNEKLQIHISELRTEGESKDIKIKELMTLYNTSKENEQRLTSLLDSHRNQIIELEGKAGSYETAVGRSEFTVSALQQQIREGQEKILE---LEGRLRTHLDDREAAETKCQSVTKRNDELLFQLTSL-LQVESMQSGCCLCPEDIVRRLTDLVQENAILKGKIVTMSECLNSTELETKASRETIMRLVSEVGKEQKVATRYTSEIDNLRMERDEALSTRNTYEREIELLKERLEASHKSVEATRRELDLRETRISSLDREYRSHHHDVHVISTQLGTFKEKLAAILS----TPDYRLEMSEEAIIERIKIIYQENCEFINRMES-LQERVKTLTEQLESQYELHKSAASRA-RKAETDLSEYDSRLRSAEGELTAGDVLRDSLRGDREKYLRCLQQLGEIMKMERISIDLGLDMTMEALMARADQLVKMEKDALADKSTHIYNLQRKIKALKEQLESKDLHVDLLRKKMTSLEEKLLGKTEIMKERDGETYRVRKLEKVVEKYKLQNQDLRHELTNLKANLLGSSEMKIRTLEQRKEIEELAAQVDELEKSRSRQAQKISKLKNSVNYQESESQEKRVIADNAVHALSSELRTTKNALISLQNREKQLLDFRGVVSRMLGLDLSTLAVPDYEIISRLEKLIQAHHNHTFTTMSMEEALADMESGFM 793          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: A0A2C9LCU0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055479 PE=4 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 9.722e-65
Identity = 233/769 (30.30%), Postives = 406/769 (52.80%), Query Frame = 3
Query:  168 RAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIE----LKNCPENF-LEPKLLPSRN-ICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLV--ENKVYAKELEDQISD---ISAAR--DELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSP-LNETINSLRSDIIDI---------------EKLNSRISSEEDPQLR-----LTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQG---FFH------DPCVVHT 2345
            R Q+ +LQ+Q++ F++E+ +KD LI  L  +E    +   P+++ L+   L  R+ + + R E+AA+ VKLD  + ++++   E++ ++  ++ ++ +    RE   RL   + +    + E+     ++ET+  R    IS+LQ E  E    +V  E ++  K  + ++++   ++  R  +EL  QI  + L   + T     +V  VI K+  +I EN   K KI+++ E L     E +ASR+TI RLV+++  E+         I NL  E D    ++  +E              +EI+LL +           + A+ +  + T  +  L  +  +SL   L E     ++ S T F+     + +LL +  D+   PS   + E++  L +D  ++               E+L++ ++   D   R     +   DL +RL +AE +L +   + DG   DK KY R L +L  +M M+ I+ D+G D+  +AL ARA QL KLE D   D     ++L RK+K LKE++ SKDLHIDLL KK+ + E R      I K+R+ E +  +KL K  +K + ++++ R EV  LK  L+  ++LKV  L   ++++ L  ++ +LE IR++QS+ +SE KS+  N E    E K  ++ A+ +L++ELR  K++L+  K +E Q+++ RTV+A++LGLD++ LA+PD+EII RLE+LI AHH+  ++  S+E  LQ +++G    FH      DP +  +
Sbjct:   64 RRQINELQDQVRNFREELKKKDNLIQHLVSLESAPKVPRAPDSYRLDSLYLGERSAVDMTRSELAAVQVKLDRAQAQIADFQREMESRDIKIKELQHLLDSSRETENRLGSMVASLRDKLAEYESRAGSYETVANRGEFTISTLQRENRELSDKIVDLEQRLRKKTEDHELAESKLVTEGRRHNELLSQISSL-LYTEDLTDPYGPSVDIVIRKLNDIIQENAMLKGKIMTMNEHLNETQLETKASRETIMRLVSEVGREQKHATRYTSDIENLRLERDNALAARRDLE--------------REIDLLKE----------RLDASHRALEATKNELQLKENRFSSLDRDLREKTHNVRSAS-TQFDLFREQLANLLSS-ADINVVPSEENVKESVRRLVTDRKELTLRLDEYENRVKHLTEQLDNELTIHRDMAQRCKRFEVEAADLAERLHSAEAELAAGDCLRDGFKFDKEKYLRGLQKLGEIMKMDRISLDLGLDLTMDALIARAEQLMKLEADALADKTSHVYNLQRKIKALKEQLESKDLHIDLLRKKMTNLEERMHGRIDIEKQRESESIRVQKLEKLVEKYKLQLQDSRHEVQNLKAQLLGSSELKVRTLEQRKDIEELAKQIEELEEIRKRQSRKISELKSTVDNTETTFQEKKVASENAVQALSSELRTTKNALDTLKYREKQLVDFRTVVARMLGLDINTLAVPDYEIITRLEKLIQAHHATTFSTLSLEDALQGVHEGSAPLFHNTIDATDPVIARS 805          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: K1Q8J9 (Coiled-coil domain-containing protein C6orf97 OS=Crassostrea gigas OX=29159 GN=CGI_10014879 PE=4 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.618e-61
Identity = 219/746 (29.36%), Postives = 383/746 (51.34%), Query Frame = 3
Query:  153 PTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLS------KIELKNCPENFLEPKLLPSRNICVE--REEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIAN-LTREVDQYKVSKTIIETDINSYECQLTSLR-------KEIELLTQDNEIKSKRIQEISATAKTN----QQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDL---NKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFF 2321
            P    R Q+ ++QEQ+K  ++E  +K+ LI QLS      K+ +++  +      +       VE  R E+AAL VK D +  ++ E   +L+ KE  +  +K +    +E  ++L   L +  + + E      ++ET+  R+   +S LQ ++ ++   ++E       LE +I      R+  +   Q ++   +E T                L+ EN   K KI++L E L S   E +ASR+TI RLV+++  E+        K+A   T E+D  ++ +    T+  + E ++T +R       + +E    + ++K  R+  +    + N    ++   +  L    + S++S   E      +       +I+  +K++LQ+  D+     S L E I +L   +    +L+   +     + R    DL   ++RL++AE +L +  ++ D    DK KY R L  L   M M+ I+ D+G DM  +AL +RA QL KLE D   D     ++L RKVK LKE++ SKDLH+DLL KK+ S E +      I KERD E    +KL K  +K + ++ +L+ E   LK  L+  +++++  +   +E++ L A+V++LE++R+KQS  +   K       Q+  E +  +D A+ +L++ELR  K++LN  + +E Q+++ R V+A++LGLD++ LA+PD+EII+RLE+LI AHHS+ +   SME+ L +M  GF 
Sbjct:   13 PPSPNRRQMTEMQEQIKILREENQKKESLIQQLSSMDAVPKVHIRSSADTLRHDTIYLGDRHAVETARSELAALQVKTDKLIMQIRENEAQLESKEVKIRELKSLYETSKENESKLTAMLESYRQQILELESKAGSYETVVGRSEFTVSELQRQIRDSNDKILE-------LESRIRKHLDERERTEMNFQSMEKKYSEMTD---------------LVQENALLKGKIVTLNETLNSTQLESKASRETIMRLVSEVGKEQ--------KVATRFTSEIDNLRLERDTAITEKRNMEREMTMMRERLDANMRALEAARAELDLKQSRLSSLDREYRVNSEDIRKVHTEAHLFREQVASVLSTFDERCDISSD-------FILNRIKTILQDNRDLVVKVQS-LEERIKTLTEQLETQYELHKTAAH----RARKAENDLMSYDERLRSAEGELAAGDVLRDEFKTDKEKYLRALQRLGEKMKMDRISIDLGLDMTIDALISRAEQLVKLEQDTIVDKSTHIYNLQRKVKSLKEQLESKDLHLDLLRKKMTSLEEKLLGKTEIEKERDTESFRIRKLEKLIEKFKLQITDLKHENTNLKAQLLGSSEIQMRTMEQRKEIEELVAQVDELENVRKKQSHKIKHLKDEVEMSSQQNQEKRLVSDNAVQALSSELRTSKNALNSIQNREKQLLDFRNVVARMLGLDINTLAVPDYEIISRLEKLIQAHHSHAFNTMSMEEALADMEDGFL 716          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Cavefish
Match: CCDC170 (coiled-coil domain containing 170 [Source:HGNC Symbol;Acc:HGNC:21177])

HSP 1 Score: 75.0998 bits (183), Expect = 1.688e-13
Identity = 82/256 (32.03%), Postives = 137/256 (53.52%), Query Frame = 3
Query: 1500 ILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNI 2267
             L +L+  M +  I  D+GFDM  EA+ ARA QL + E     +++   +SL +KVKE K  + SKDLH+DLL +K+A  +  ++S   +  ER+   L+N+KL K  ++LQ E+  +R    ELK  L + N+LK+  +   Q ++  +  +  LE  + K  K L+  K+   N  QEL    E   A     N  L     ++ +   +E ++++  TV++++LG+D+    + + E I RLE LI + H + 
Sbjct:  350 FLEKLSEKMKIEHIATDLGFDMRLEAILARADQLTRQEGTALVENKTLVYSLRKKVKEQKVMLESKDLHMDLLRRKVAQLDEDKRSRSALAVEREDVTLTNRKLQKKVERLQAELSVMRFSNTELKAQLADTNELKIRVMEQKQAIEKQSKSLGTLEKNKAKVEKKLNTVKTELQN--QELRARDELHQA-----NKLLHSQAGTMAELAHREKKLLDFCTVVSQMLGVDMPA-TLLNSEAIKRLEALIHSSHPHF 597          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006087.1 (pep scaffold:Pmarinus_7.0:GL479553:21345:31721:-1 gene:ENSPMAG00000005504.1 transcript:ENSPMAT00000006087.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 9.128e-35
Identity = 86/274 (31.39%), Postives = 159/274 (58.03%), Query Frame = 3
Query: 1488 KYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMN 2309
            +Y R L +L R + + E+  D+G D+  EA+  RA  L KLE D   D +   +SL RKVK  KEK+ SK+LH+++L KKL+  E  + +   +  ERD    +  KL + +++LQ++++  R    ELK  L + + LK+  L  ++ +  +   +++LE ++ K ++ ++  +       +   E  E     + +   ELR VK +L +  R+E Q+++ R V+ + LGLD+ +LA+PD+E++ RLERL+ A H+++ T  +++ +L+ ++
Sbjct:    1 QYMRFLEDLGRRLKVEELGVDVGLDLQLEAMLTRADHLAKLESDSTADGKTLLYSLQRKVKAQKEKLQSKELHLEMLRKKLSQLEEERGTRTALAVERDDANAALHKLRRRSERLQQQLDAARTANTELKAQLADAHGLKIQTLEQNKTIAEMGRSIDRLEKVKDKAARKVASLRGQLDMTAEGAQEEMERTRVLLEATTGELRTVKRALEEVARREKQLLDFREVVGRTLGLDVGSLAVPDYEVVARLERLVRAQHASVATAAALDGSLERLH 274          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Nematostella
Match: EDO48576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIV6])

HSP 1 Score: 181.03 bits (458), Expect = 3.544e-49
Identity = 162/491 (32.99%), Postives = 274/491 (55.80%), Query Frame = 3
Query:  849 CEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQ-QALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGF 2318
             E +ASR+TI RLV+++  E+     + +++  + RE D  +     +E ++++ + Q++S +     L +  E K ++I  I     T++ T +  Q  +  FI  +  ++SE  +   +D  TI    +  V ++++   D K T  S L+  + +L SD +D ++   R + +   Q    +++  +R+   E +LLSS +  DGL  DK K+     ++AR M ++EI  D+GFD+  EAL ARA QL KLE D   D + T ++L R++K  K+++ SKDLH  LL KK+ S E        +  ERD+  +  +KL KHN+KLQ E+ + + EV  LK  L+  ++LKV  +   + ++ L   +NKL   +QK  + L   KS     E E  E +  A      L +EL   K +L + + +E Q++  R V+A+LLGLD++NL++PD++II+RLERL+ AHH++  T +S+E +LQ++  GF
Sbjct:    1 MESKASRETIMRLVSEVGQEKKALDGHKQQMDAVIRERDTLQQRVREMEIELDTQKKQVSSSQDAWASLKKALEEKEEKIYSIEHALSTSEYTGQATQNKLQGFIRQVAQMVSEVNEEMLHDEQTI----LNRVDAMIKGYRDFKTTSES-LHVRLRNL-SDELDSQRNLHRTTLKRATQAEEQLKEAQERVTGLEGELLSSDVERDGLKEDKRKFVAFCEKMARTMKLDEIADDVGFDVNGEALVARAEQLVKLETDALDDRKTTIYNLQRRLKWAKQQIESKDLHQGLLKKKVTSLEELLHDKGRVEVERDENSIKYRKLVKHNEKLQRELLDYKQEVTNLKAKLMEISELKVTTIEQCKTIEGLEQALNKLARSKQKTKEQLDGIKSELGVAESEARETRSKASMTQQQLRSELETTKLALEESRIREKQLLNFRQVLARLLGLDVNNLSVPDYDIISRLERLVQAHHAHSITTHSLEGSLQDLENGF 485          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000074429.1 (SMESG000074429.1)

HSP 1 Score: 1498.03 bits (3877), Expect = 0.000e+0
Identity = 781/783 (99.74%), Postives = 783/783 (100.00%), Query Frame = 3
Query:   54 MTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPSRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFHDPCVVHTHHTHLIDEKPIYPKTKNSQ 2402
            MTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLP+RNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFHDPCVVHTHHTHLIDEKPIYPKTK+SQ
Sbjct:    1 MTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPNRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFHDPCVVHTHHTHLIDEKPIYPKTKHSQ 783          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000074429.1 (SMESG000074429.1)

HSP 1 Score: 1451.03 bits (3755), Expect = 0.000e+0
Identity = 761/763 (99.74%), Postives = 762/763 (99.87%), Query Frame = 3
Query:   42 MYGGMTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPSRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFHDP 2330
            MYGGMTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLP+RNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFH P
Sbjct:    1 MYGGMTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPNRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFHVP 763          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000074429.1 (SMESG000074429.1)

HSP 1 Score: 1432.16 bits (3706), Expect = 0.000e+0
Identity = 756/763 (99.08%), Postives = 757/763 (99.21%), Query Frame = 3
Query:   42 MYGGMTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPSRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFHDP 2330
            MYGGMTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLP+RNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKN     LNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFH P
Sbjct:    1 MYGGMTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPNRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKN-----LNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFHVP 758          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000074429.1 (SMESG000074429.1)

HSP 1 Score: 1421.37 bits (3678), Expect = 0.000e+0
Identity = 752/759 (99.08%), Postives = 753/759 (99.21%), Query Frame = 3
Query:   54 MTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPSRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFHDP 2330
            MTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLP+RNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKN     LNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFH P
Sbjct:    1 MTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPNRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQEISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKN-----LNETINSLRSDIIDIEKLNSRISSEEDPQLRLTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEKTLQEMNQGFFHVP 754          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000048767.1 (SMESG000048767.1)

HSP 1 Score: 150.984 bits (380), Expect = 1.560e-37
Identity = 188/723 (26.00%), Postives = 364/723 (50.35%), Query Frame = 3
Query:  168 RAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPSRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARL-------QVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDIS-------AARDELQRQIQDIKLSI-TEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIE-LLTQDNEIKSKRIQEISATAKTNQQTDEQQALINH----FINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLR---LTVEDLNKRLKNAETDXXXXXXIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSXXXXXXXXXXXXASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRXXXXXXXXXXXXXXINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNI 2267
            R++  +L+EQLK  ++++++KD+ I  LS +++K C          P+      + E+A+L ++L N  N+L E   ELK K   VE ++ +N  L E+I  L       Q+ + + ++  N+   A         R+ + ISSLQ ELT++   +V+       LED++ +++        +R+ L   I +    + T    E       V  K+K L  EN+  K +I +++   + R+ +   SR++  +++  +  ++           NLT E+++ +V K  +E     +  +LT    +I+ +L +   I  ++  ++S      +++++  + +N     F  S+  +LS +     +   +I E +      +L N+   K+     L+  + ++        + N  I+ E   + R   L   DL  R++  E +L S  +  D L  DK K++  L  LA VM M+   ++  F +I + +  RA  + + E +   D   T  SL R++++LK+++HS+DLH++L+ KK+A+ E + +        R   + +   L +   K+Q +V+ LR E   LK  L   + +K++  S  +E+++L   + KLE +RQKQ++ +++   S    + E N  K  +D A+ SL +ELR ++++L   KR E ++++ R V+ ++LGL +D+LAIP+++II RLE+L++  HS +
Sbjct:    7 RSRNIELEEQLKVCKEDLIKKDEHIKVLSSMDIKQCTS--------PNSETNNSKAELASLQLQLSNTFNKLDENEIELKCKADQVEELRNLNRNLNEQIESLVAMNNEMQMKMASTDQTANDLSCAN-------ARSELAISSLQKELTDSLDKVVK-------LEDELKNLTLNNSTTEKSRESLAAVISNFYQELNTYLNLESDSEPGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEI----HNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERL-----RILINEAKEKDNKILQLDMKLKNVSEQY----ERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGV 694          
The following BLAST results are available for this feature:
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC1701.688e-3427.42coiled-coil domain containing 170 [Source:HGNC Sym... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1703.723e-2524.56coiled-coil domain containing 170 [Source:ZFIN;Acc... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
c1qtnf42.597e-3529.37C1q and TNF related 4 [Source:Xenbase;Acc:XB-GENE-... [more]
ENSXETT00000000426.11.283e-1824.33coiled-coil domain-containing protein 170-like [So... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ccdc1703.827e-3426.39coiled-coil domain containing 170 [Source:MGI Symb... [more]
Ccdc1709.137e-3426.39coiled-coil domain containing 170 [Source:MGI Symb... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8IYT3|CC170_HUMAN8.106e-3427.42Coiled-coil domain-containing protein 170 OS=Homo ... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J8Y04.048e-7130.46coiled-coil domain-containing protein 170 OS=Lingu... [more]
A0A1I8G8S92.436e-7030.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210PKU69.704e-6630.11Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A2C9LCU09.722e-6530.30Uncharacterized protein OS=Biomphalaria glabrata O... [more]
K1Q8J94.618e-6129.36Coiled-coil domain-containing protein C6orf97 OS=C... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC1701.688e-1332.03coiled-coil domain containing 170 [Source:HGNC Sym... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006087.19.128e-3531.39pep scaffold:Pmarinus_7.0:GL479553:21345:31721:-1 ... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO485763.544e-4932.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074429.10.000e+099.74SMESG000074429.1[more]
SMESG000074429.10.000e+099.74SMESG000074429.1[more]
SMESG000074429.10.000e+099.08SMESG000074429.1[more]
SMESG000074429.10.000e+099.08SMESG000074429.1[more]
SMESG000048767.11.560e-3726.00SMESG000048767.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007500 ID=SMED30007500|Name=coiled-coil domain-containing protein 170|organism=Schmidtea mediterranea sexual|type=transcript|length=2421bp
TAATAATCTCTATGGCAATAATGTTTCATTAATTCAAAGCAATGTATGGA
GGAATGACCCCCGAGAGAACACAGTCACAAGCATCATTGCCACCTCTTGA
AAGTCCATATTTAATAAATGGTAGTAGTAGAAGCATAAGTTTTATGAAAT
CCCCAACTCAAACTGAAAGAGCACAACTTTATAAATTACAAGAACAATTG
AAAACATTCCAAGATGAAATAATGAGAAAAGACAAATTAATAGACCAATT
ATCAAAAATTGAATTGAAAAATTGTCCAGAAAATTTTCTCGAACCTAAAT
TATTACCTAGCCGAAATATTTGTGTTGAGCGTGAAGAGGTTGCAGCATTG
AATGTCAAATTGGATAACATGAGGAATGAGCTTTCGGAAGCAATGTGTGA
ACTGAAGCAGAAGGAAACGATTGTAGAGTCAATGAAAAGAATTAATTGTG
AATTGCGTGAGGAAATAGCTCGTTTGCAAGTAGCTCTTGGTAATTGCAAC
AAAGATGTTAATGAATTTGGTGAAGCTAAAGAAGCATTTGAAACTATGCG
ACAAAGAAATAATATTTTAATTTCCAGCTTACAGGATGAGTTGACTGAAA
CTCAGCAAGGTCTAGTGGAGAATAAAGTTTACGCCAAAGAACTTGAAGAC
CAAATCTCAGACATTTCAGCTGCTAGAGATGAATTACAAAGACAAATCCA
AGATATAAAACTCTCAATTACAGAAGCGACTTCAGAAGAAATTTATAATG
TTTCTGAAGTGATTAACAAAGTGAAAACTTTAATTTTTGAAAATGACAGT
TCGAAAAATAAAATTCTGAGCTTGGAAGAAAAATTGAAATCGCGTGACTG
TGAACAACAAGCTTCAAGACAAACGATAACGAGATTGGTTGCGAAACTCA
GCGCAGAGGAAACGAAAAACGCAAATAATGATGAAAAAATTGCCAACTTG
ACTAGAGAAGTTGACCAGTACAAAGTCTCAAAGACAATTATCGAAACTGA
CATAAACTCATATGAATGCCAATTGACATCATTGAGAAAAGAAATCGAAC
TTTTAACCCAAGACAATGAAATCAAATCTAAGAGAATACAAGAGATTTCT
GCAACTGCCAAAACCAATCAACAAACTGATGAACAACAGGCCTTAATAAA
TCACTTTATAAACTCGCTGATTTCGATACTGTCAGAAAATTACAAAACAC
CTAAAAATGACTCTTTGACAATTTTTGAATGGATAATTGGATGTGTGAAA
TCTCTCCTTCAAAATAAAGGCGACGTAAAAAATACTCCTTCGTCGCCGTT
GAACGAAACGATCAACAGCTTGAGATCGGATATCATAGATATTGAAAAAT
TGAATTCCAGAATCTCGTCAGAAGAGGATCCACAACTGCGACTTACAGTA
GAGGACCTTAATAAGAGGCTGAAAAACGCCGAAACTGATTTGTTAAGTTC
GTCGCTAATAATAGATGGACTCAATTGTGACAAAACAAAATACTTTCGAA
TATTATCTGAGTTGGCAAGGGTGATGAATATGAATGAAATAAATAAAGAT
ATTGGGTTTGACATGATTTCCGAAGCCTTATACGCTAGAGCAACGCAACT
ACAAAAACTCGAATACGATGTAAAGACTGATCATCGATTGACCGAACATT
CCCTTAATAGAAAGGTTAAAGAGCTCAAAGAAAAGGTTCACAGCAAAGAT
CTCCATATAGATTTATTGCATAAAAAACTAGCCTCAACCGAAGGTCGACA
ACAAAGTGTTGAATTGATTGGAAAAGAAAGAGACAAAGAATTGCTGTCAA
ACAAAAAGTTAGCAAAACATAATCAAAAACTTCAAGAAGAAGTAGAAAAT
CTTAGAGCAGAAGTTATTGAGCTTAAAGGCAGTTTGATAAATTATAATAA
GTTAAAGGTAAACGCTCTGTCTTTGGATCAAGAAGTGAAATCACTGACAG
CAAAAGTAAATAAACTGGAAAGCATTCGACAGAAACAATCAAAATTATTA
AGTGAATCAAAGAGTTCTCAAATTAATAAAGAACAAGAATTAAATGAAAT
CAAAGAAACAGCTGATGCCGCAATAGCATCTCTCAACACTGAATTAAGAG
TAGTTAAAGATTCTTTAAATGATTGCAAGCGAAAGGAAAATCAGATGATT
GAAATGAGAACTGTAATTGCTAAACTTCTTGGTCTGGATCTTGACAATTT
GGCTATTCCAGACTTTGAAATAATAAATCGACTGGAGCGGCTGATTACTG
CCCACCATTCAAACATTTACACTCAATATTCAATGGAAAAAACATTGCAG
GAAATGAACCAAGGCTTTTTTCATGACCCGTGTGTTGTGCACACTCATCA
TACCCATTTGATAGACGAGAAGCCAATATATCCCAAAACCAAAAACAGTC
AATGATAATTGCACAATATTC
back to top

protein sequence of SMED30007500-orf-1

>SMED30007500-orf-1 ID=SMED30007500-orf-1|Name=SMED30007500-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=788bp
MYGGMTPERTQSQASLPPLESPYLINGSSRSISFMKSPTQTERAQLYKLQ
EQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPSRNICVEREEV
AALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARLQVALG
NCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKE
LEDQISDISAARDELQRQIQDIKLSITEATSEEIYNVSEVINKVKTLIFE
NDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKI
ANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIELLTQDNEIKSKRIQ
EISATAKTNQQTDEQQALINHFINSLISILSENYKTPKNDSLTIFEWIIG
CVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLR
LTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEI
NKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVH
SKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEE
VENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQS
KLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKEN
QMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNIYTQYSMEK
TLQEMNQGFFHDPCVVHTHHTHLIDEKPIYPKTKNSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR039139CCDC170-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 587..614
NoneNo IPR availableCOILSCoilCoilcoord: 321..348
NoneNo IPR availableCOILSCoilCoilcoord: 198..232
NoneNo IPR availableCOILSCoilCoilcoord: 100..127
NoneNo IPR availableCOILSCoilCoilcoord: 678..698
NoneNo IPR availableCOILSCoilCoilcoord: 286..306
NoneNo IPR availableCOILSCoilCoilcoord: 618..645
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
IPR039139Coiled-coil domain-containing protein 170-likePANTHERPTHR18863TSEC-2-RELATEDcoord: 97..754