Ribosomal protein L19

Overview
NameRibosomal protein L19
Smed IDSMED30007498
Length (bp)740
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribosomal protein L19 (SMED30007498) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribosomal protein L19 (SMED30007498) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribosomal protein L19 (SMED30007498) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribosomal protein L19 (SMED30007498) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007498

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007498SMESG000057653.1 SmedASXL_004295SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30007498SMESG000057653.1 dd_Smed_v4_228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007498SMESG000057653.1 dd_Smed_v4_228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007498SMESG000057653.1 dd_Smed_v4_228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007498SMESG000057653.1 dd_Smed_v4_228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007498SMESG000057653.1 dd_Smed_v4_228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007498SMESG000057653.1 dd_Smed_v4_228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007498SMESG000057653.1 dd_Smed_v4_228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007498SMESG000057653.1 dd_Smed_v4_228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30007498SMESG000057653.1 dd_Smed_v4_228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007498SMESG000057653.1 dd_Smed_v4_228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30007498SMESG000057653.1 dd_Smed_v4_228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007498SMESG000057653.1 dd_Smed_v4_228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007498SMESG000022408.1 Contig111GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007498SMESG000057653.1 Contig111GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30007498SMESG000057653.1 dd_Smed_v6_228_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribosomal protein L19 vs. Ensembl Human
Match: RPL19 (ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC:10312])

HSP 1 Score: 204.142 bits (518), Expect = 8.050e-66
Identity = 111/158 (70.25%), Postives = 130/158 (82.28%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMG GKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    1 MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Human
Match: RPL19 (ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC:10312])

HSP 1 Score: 201.06 bits (510), Expect = 1.268e-64
Identity = 109/155 (70.32%), Postives = 128/155 (82.58%), Query Frame = 1
Query:  133 LRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMG GKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    2 LRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQ 156          
BLAST of Ribosomal protein L19 vs. Ensembl Human
Match: RPL19 (ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC:10312])

HSP 1 Score: 201.06 bits (510), Expect = 1.268e-64
Identity = 109/155 (70.32%), Postives = 128/155 (82.58%), Query Frame = 1
Query:  133 LRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMG GKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    2 LRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQ 156          
BLAST of Ribosomal protein L19 vs. Ensembl Human
Match: RPL19 (ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC:10312])

HSP 1 Score: 200.29 bits (508), Expect = 2.164e-64
Identity = 108/155 (69.68%), Postives = 128/155 (82.58%), Query Frame = 1
Query:  133 LRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            +RLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMG GKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    1 MRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQ 155          
BLAST of Ribosomal protein L19 vs. Ensembl Celegans
Match: rpl-19 (60S ribosomal protein L19 [Source:UniProtKB/Swiss-Prot;Acc:O02639])

HSP 1 Score: 210.305 bits (534), Expect = 1.017e-68
Identity = 108/158 (68.35%), Postives = 133/158 (84.18%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MSNLRLQKRLA++V+ CG++++WLDPNE ++I+ ANSRQSIR+L+ DGLIIRKPV VHSRFR R   EARR+GRH G GKR+GTANARMP K +WIRRMRVLRNLL++YR+ KK+D HLY +LY   KGN FKNK+ LIEYI +KK++  R+KQL DQ
Sbjct:    1 MSNLRLQKRLASAVLKCGKHRVWLDPNEVSEISGANSRQSIRRLVNDGLIIRKPVTVHSRFRAREYEEARRKGRHTGYGKRRGTANARMPEKTLWIRRMRVLRNLLRRYRDAKKLDKHLYHELYLRAKGNNFKNKKNLIEYIFKKKTENKRAKQLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Celegans
Match: rpl-19 (60S ribosomal protein L19 [Source:UniProtKB/Swiss-Prot;Acc:O02639])

HSP 1 Score: 210.305 bits (534), Expect = 1.017e-68
Identity = 108/158 (68.35%), Postives = 133/158 (84.18%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MSNLRLQKRLA++V+ CG++++WLDPNE ++I+ ANSRQSIR+L+ DGLIIRKPV VHSRFR R   EARR+GRH G GKR+GTANARMP K +WIRRMRVLRNLL++YR+ KK+D HLY +LY   KGN FKNK+ LIEYI +KK++  R+KQL DQ
Sbjct:    1 MSNLRLQKRLASAVLKCGKHRVWLDPNEVSEISGANSRQSIRRLVNDGLIIRKPVTVHSRFRAREYEEARRKGRHTGYGKRRGTANARMPEKTLWIRRMRVLRNLLRRYRDAKKLDKHLYHELYLRAKGNNFKNKKNLIEYIFKKKTENKRAKQLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Celegans
Match: rpl-19 (60S ribosomal protein L19 [Source:UniProtKB/Swiss-Prot;Acc:O02639])

HSP 1 Score: 210.305 bits (534), Expect = 1.017e-68
Identity = 108/158 (68.35%), Postives = 133/158 (84.18%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MSNLRLQKRLA++V+ CG++++WLDPNE ++I+ ANSRQSIR+L+ DGLIIRKPV VHSRFR R   EARR+GRH G GKR+GTANARMP K +WIRRMRVLRNLL++YR+ KK+D HLY +LY   KGN FKNK+ LIEYI +KK++  R+KQL DQ
Sbjct:    1 MSNLRLQKRLASAVLKCGKHRVWLDPNEVSEISGANSRQSIRRLVNDGLIIRKPVTVHSRFRAREYEEARRKGRHTGYGKRRGTANARMPEKTLWIRRMRVLRNLLRRYRDAKKLDKHLYHELYLRAKGNNFKNKKNLIEYIFKKKTENKRAKQLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Celegans
Match: rpl-19 (60S ribosomal protein L19 [Source:UniProtKB/Swiss-Prot;Acc:O02639])

HSP 1 Score: 210.305 bits (534), Expect = 1.017e-68
Identity = 108/158 (68.35%), Postives = 133/158 (84.18%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MSNLRLQKRLA++V+ CG++++WLDPNE ++I+ ANSRQSIR+L+ DGLIIRKPV VHSRFR R   EARR+GRH G GKR+GTANARMP K +WIRRMRVLRNLL++YR+ KK+D HLY +LY   KGN FKNK+ LIEYI +KK++  R+KQL DQ
Sbjct:    1 MSNLRLQKRLASAVLKCGKHRVWLDPNEVSEISGANSRQSIRRLVNDGLIIRKPVTVHSRFRAREYEEARRKGRHTGYGKRRGTANARMPEKTLWIRRMRVLRNLLRRYRDAKKLDKHLYHELYLRAKGNNFKNKKNLIEYIFKKKTENKRAKQLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Fly
Match: RpL19 (gene:FBgn0285950 transcript:FBtr0072406)

HSP 1 Score: 230.335 bits (586), Expect = 2.621e-76
Identity = 112/158 (70.89%), Postives = 133/158 (84.18%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS+L+LQKRLAASV+ CG+ K+WLDPNE  +IAN NSRQ+IRKL+KDGLII+KPV VHSR+R R   EARR+GRH G GKRKGTANARMP K++W++R RVLR LLKKYR+ KKID HLY  LY  CKGN FKNKRVL+EYIH+KK+++ RSK L DQ
Sbjct:    1 MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSRYRVRKNTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEYIHKKKAEKQRSKMLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Fly
Match: RpL19 (gene:FBgn0285950 transcript:FBtr0072405)

HSP 1 Score: 230.335 bits (586), Expect = 2.621e-76
Identity = 112/158 (70.89%), Postives = 133/158 (84.18%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS+L+LQKRLAASV+ CG+ K+WLDPNE  +IAN NSRQ+IRKL+KDGLII+KPV VHSR+R R   EARR+GRH G GKRKGTANARMP K++W++R RVLR LLKKYR+ KKID HLY  LY  CKGN FKNKRVL+EYIH+KK+++ RSK L DQ
Sbjct:    1 MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSRYRVRKNTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEYIHKKKAEKQRSKMLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Zebrafish
Match: rpl19 (ribosomal protein L19 [Source:NCBI gene;Acc:406489])

HSP 1 Score: 201.06 bits (510), Expect = 7.385e-65
Identity = 110/158 (69.62%), Postives = 130/158 (82.28%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLII+KPV VHSR RCR    ARR+GRHMG GKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    1 MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLVKDGLIIKKPVTVHSRARCRKNTLARRKGRHMGVGKRKGTANARMPEKLCWMRRMRILRRLLRRYREAKKIDRHMYHSLYLRAKGNVFKNKRILMEHIHKLKADKARKKLLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Xenopus
Match: rpl19 (ribosomal protein L19 [Source:NCBI gene;Acc:448704])

HSP 1 Score: 202.986 bits (515), Expect = 2.098e-65
Identity = 111/158 (70.25%), Postives = 130/158 (82.28%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMG GKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    1 MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLVKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKLAWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Xenopus
Match: rpl19 (ribosomal protein L19 [Source:NCBI gene;Acc:448704])

HSP 1 Score: 199.904 bits (507), Expect = 3.149e-63
Identity = 109/155 (70.32%), Postives = 128/155 (82.58%), Query Frame = 1
Query:  133 LRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMG GKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:   72 LRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLVKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKLAWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQ 226          
BLAST of Ribosomal protein L19 vs. Ensembl Mouse
Match: Rpl19 (ribosomal protein L19 [Source:MGI Symbol;Acc:MGI:98020])

HSP 1 Score: 204.142 bits (518), Expect = 5.527e-66
Identity = 111/158 (70.25%), Postives = 130/158 (82.28%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMG GKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    1 MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Mouse
Match: Rpl19 (ribosomal protein L19 [Source:MGI Symbol;Acc:MGI:98020])

HSP 1 Score: 201.06 bits (510), Expect = 8.707e-65
Identity = 109/155 (70.32%), Postives = 128/155 (82.58%), Query Frame = 1
Query:  133 LRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMG GKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    2 LRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQ 156          
BLAST of Ribosomal protein L19 vs. UniProt/SwissProt
Match: sp|P36241|RL19_DROME (60S ribosomal protein L19 OS=Drosophila melanogaster OX=7227 GN=RpL19 PE=1 SV=2)

HSP 1 Score: 230.335 bits (586), Expect = 2.627e-75
Identity = 112/158 (70.89%), Postives = 133/158 (84.18%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS+L+LQKRLAASV+ CG+ K+WLDPNE  +IAN NSRQ+IRKL+KDGLII+KPV VHSR+R R   EARR+GRH G GKRKGTANARMP K++W++R RVLR LLKKYR+ KKID HLY  LY  CKGN FKNKRVL+EYIH+KK+++ RSK L DQ
Sbjct:    1 MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSRYRVRKNTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEYIHKKKAEKQRSKMLADQ 158          
BLAST of Ribosomal protein L19 vs. UniProt/SwissProt
Match: sp|Q9LUQ6|RL192_ARATH (60S ribosomal protein L19-2 OS=Arabidopsis thaliana OX=3702 GN=RPL19B PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 5.403e-69
Identity = 102/158 (64.56%), Postives = 125/158 (79.11%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            M +L++QKRLAASV+ CG+ K+WLDPNE+ DI+ ANSRQ+IRKL+KDG IIRKP K+HSR R R   EA+R+GRH G GKRKGT  AR+P KI+W+RRMRVLR  L KYRE KKID H+Y  +Y   KGN FKNKRVL+E IH+ K+++AR K L DQ
Sbjct:    1 MVSLKIQKRLAASVMKCGKGKVWLDPNESGDISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARALNEAKRKGRHSGYGKRKGTREARLPTKILWMRRMRVLRRFLSKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKMKAEKAREKTLADQ 158          
BLAST of Ribosomal protein L19 vs. UniProt/SwissProt
Match: sp|O02639|RL19_CAEEL (60S ribosomal protein L19 OS=Caenorhabditis elegans OX=6239 GN=rpl-19 PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.294e-67
Identity = 108/158 (68.35%), Postives = 133/158 (84.18%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MSNLRLQKRLA++V+ CG++++WLDPNE ++I+ ANSRQSIR+L+ DGLIIRKPV VHSRFR R   EARR+GRH G GKR+GTANARMP K +WIRRMRVLRNLL++YR+ KK+D HLY +LY   KGN FKNK+ LIEYI +KK++  R+KQL DQ
Sbjct:    1 MSNLRLQKRLASAVLKCGKHRVWLDPNEVSEISGANSRQSIRRLVNDGLIIRKPVTVHSRFRAREYEEARRKGRHTGYGKRRGTANARMPEKTLWIRRMRVLRNLLRRYRDAKKLDKHLYHELYLRAKGNNFKNKKNLIEYIFKKKTENKRAKQLADQ 158          
BLAST of Ribosomal protein L19 vs. UniProt/SwissProt
Match: sp|P84100|RL19_RAT (60S ribosomal protein L19 OS=Rattus norvegicus OX=10116 GN=Rpl19 PE=1 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 3.866e-65
Identity = 111/158 (70.25%), Postives = 130/158 (82.28%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMG GKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    1 MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQ 158          
BLAST of Ribosomal protein L19 vs. UniProt/SwissProt
Match: sp|Q5RB99|RL19_PONAB (60S ribosomal protein L19 OS=Pongo abelii OX=9601 GN=RPL19 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 3.866e-65
Identity = 111/158 (70.25%), Postives = 130/158 (82.28%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMG GKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    1 MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQ 158          
BLAST of Ribosomal protein L19 vs. TrEMBL
Match: A0A2T7PFM1 (Ribosomal protein L19 OS=Pomacea canaliculata OX=400727 GN=C0Q70_07641 PE=3 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 1.469e-78
Identity = 116/158 (73.42%), Postives = 139/158 (87.97%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS LRLQKRL+A+V+ CG+NK+WLDPNE  +IANANSRQ+IRKL+KDGLIIRKPVKVHSR R R    ARR+GRHMG GKRKGTANARMP K++WIRRMRVLRNLL+KYRE KKID HLY +LY   KGN FKNKR+L+E+IH++K+++AR+KQL+DQ
Sbjct:    1 MSTLRLQKRLSAAVLKCGKNKVWLDPNETNEIANANSRQNIRKLIKDGLIIRKPVKVHSRARVRKNALARRKGRHMGHGKRKGTANARMPQKVLWIRRMRVLRNLLRKYREAKKIDKHLYHELYLKSKGNGFKNKRILMEFIHKRKAEKARTKQLSDQ 158          
BLAST of Ribosomal protein L19 vs. TrEMBL
Match: A0A1L8DRT6 (Ribosomal protein L19 OS=Nyssomyia neivai OX=330878 PE=3 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 8.123e-76
Identity = 115/158 (72.78%), Postives = 136/158 (86.08%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS+L+LQKRLAASV+GCG+ K+WLDPNE  +IAN NSRQ+IRKL+KDGLII+KPV VHSR+R R   EARR+GRH GTGKRKGTANARMPVK +W++RMRVLR LLKKYR+ KKID HLY  LY   KGN FKNKRVL+EYIH+KK+++ R+K LNDQ
Sbjct:    1 MSSLKLQKRLAASVMGCGKKKVWLDPNEVNEIANTNSRQNIRKLVKDGLIIKKPVVVHSRYRVRKNTEARRKGRHCGTGKRKGTANARMPVKYLWMQRMRVLRRLLKKYRDAKKIDRHLYHDLYMKSKGNVFKNKRVLMEYIHKKKAEKQRTKMLNDQ 158          
BLAST of Ribosomal protein L19 vs. TrEMBL
Match: A8CAG8 (Ribosomal protein L19 OS=Phlebotomus papatasi OX=29031 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 8.123e-76
Identity = 115/158 (72.78%), Postives = 136/158 (86.08%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS+L+LQKRLAASV+GCG+ K+WLDPNE  +IAN NSRQ+IRKL+KDGLII+KPV VHSR+R R   EARR+GRH GTGKRKGTANARMPVK +W++RMRVLR LLKKYR+ KKID HLY  LY   KGN FKNKRVL+EYIH+KK+++ R+K LNDQ
Sbjct:    1 MSSLKLQKRLAASVMGCGKKKVWLDPNEVNEIANTNSRQNIRKLVKDGLIIKKPVVVHSRYRVRKNTEARRKGRHCGTGKRKGTANARMPVKYLWMQRMRVLRRLLKKYRDAKKIDRHLYHDLYMKSKGNVFKNKRVLMEYIHKKKAEKQRTKMLNDQ 158          
BLAST of Ribosomal protein L19 vs. TrEMBL
Match: A8CWA3 (Ribosomal protein L19 OS=Lutzomyia longipalpis OX=7200 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 8.123e-76
Identity = 115/158 (72.78%), Postives = 136/158 (86.08%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS+L+LQKRLAASV+GCG+ K+WLDPNE  +IAN NSRQ+IRKL+KDGLII+KPV VHSR+R R   EARR+GRH GTGKRKGTANARMPVK +W++RMRVLR LLKKYR+ KKID HLY  LY   KGN FKNKRVL+EYIH+KK+++ R+K LNDQ
Sbjct:    1 MSSLKLQKRLAASVMGCGKKKVWLDPNEVNEIANTNSRQNIRKLVKDGLIIKKPVVVHSRYRVRKNTEARRKGRHCGTGKRKGTANARMPVKYLWMQRMRVLRRLLKKYRDAKKIDRHLYHDLYMKSKGNVFKNKRVLMEYIHKKKAEKQRTKMLNDQ 158          
BLAST of Ribosomal protein L19 vs. TrEMBL
Match: A0A1B6FHR7 (Ribosomal protein L19 (Fragment) OS=Cuerna arida OX=1464854 GN=g.47476 PE=3 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 2.527e-75
Identity = 114/158 (72.15%), Postives = 134/158 (84.81%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS L+LQKRLAASV+GCG+ K+WLDPNE  +IAN NSRQ+IRKL+KDGLII+KPV VHSR R R   EARR+GRH G GKRKGTANARMP K++W+ RMRVLR LLKKYRE KKID HLY +LY   KGN FKNKRVL+E+IH+KK+++AR+K LNDQ
Sbjct:    4 MSTLKLQKRLAASVMGCGRKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVAVHSRARVRKNTEARRKGRHCGFGKRKGTANARMPRKVLWVNRMRVLRRLLKKYREAKKIDRHLYHQLYMKAKGNVFKNKRVLMEFIHKKKAEKARTKMLNDQ 161          
BLAST of Ribosomal protein L19 vs. Ensembl Cavefish
Match: rpl19 (ribosomal protein L19 [Source:NCBI gene;Acc:103027236])

HSP 1 Score: 209.534 bits (532), Expect = 2.766e-68
Identity = 115/158 (72.78%), Postives = 133/158 (84.18%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS LRLQKRLA+SV+ CG+ KIWLDPNE  +IANANSRQ IRKL+KDGLII+KPV VHSR RCR  + ARR+GRHMG GKRKGTANARMPVK+ W+RRMR+LR LL++YREGKKID H+Y  LY   KGN FKNKR+LIE+IHR K+D+AR K L DQ
Sbjct:    1 MSMLRLQKRLASSVLHCGKKKIWLDPNETNEIANANSRQQIRKLVKDGLIIKKPVTVHSRARCRKNMLARRKGRHMGLGKRKGTANARMPVKLCWMRRMRILRRLLRRYREGKKIDKHMYHNLYLKAKGNVFKNKRILIEHIHRLKADKARKKLLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Cavefish
Match: RPL19 (60S ribosomal protein L19 [Source:NCBI gene;Acc:103032189])

HSP 1 Score: 207.994 bits (528), Expect = 7.351e-67
Identity = 112/158 (70.89%), Postives = 134/158 (84.81%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLII+KPV VHSR RCR  + ARR+GRHMGTGKRKGTAN+RMPVK+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+LIE+IH+ K+D+AR K L+DQ
Sbjct:   61 MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLVKDGLIIKKPVTVHSRARCRKNMLARRKGRHMGTGKRKGTANSRMPVKLCWMRRMRILRRLLRRYREAKKIDRHMYHSLYLRAKGNMFKNKRILIEHIHKLKADRARKKLLSDQ 218          
BLAST of Ribosomal protein L19 vs. Ensembl Sea Lamprey
Match: rpl19 (ribosomal protein L19 [Source:NCBI gene;Acc:406489])

HSP 1 Score: 212.616 bits (540), Expect = 4.012e-70
Identity = 112/155 (72.26%), Postives = 131/155 (84.52%), Query Frame = 1
Query:  133 LRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            LRLQKRL+ASV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR  LEARR+GRHMG GKRKGTANARMP K++W+RRMR+LR LL+KYRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    2 LRLQKRLSASVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVAVHSRARCRKNLEARRKGRHMGYGKRKGTANARMPEKLVWMRRMRILRRLLRKYREAKKIDRHMYHNLYLKVKGNVFKNKRILMEHIHKMKADKARKKLLADQ 156          
BLAST of Ribosomal protein L19 vs. Ensembl Yeast
Match: RPL19B (Ribosomal 60S subunit protein L19B; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal; homologous to mammalian ribosomal protein L19, no bacterial homolog; RPL19B has a paralog, RPL19A, that arose from the whole genome duplication [Source:SGD;Acc:S000000123])

HSP 1 Score: 185.267 bits (469), Expect = 1.190e-59
Identity = 95/158 (60.13%), Postives = 122/158 (77.22%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            M+NLR QKRLAASVVG G+ K+WLDPNE ++IA ANSR +IRKL+K+G I++K V VHS+ R R   +++REGRH G GKRKGT  AR+P +++WIRR+RVLR LL KYR+  KID HLY  LYK  KGN FK+KR L+E+I + K+D  R K LN++
Sbjct:    1 MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEE 158          
BLAST of Ribosomal protein L19 vs. Ensembl Yeast
Match: RPL19A (Ribosomal 60S subunit protein L19A; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal; homologous to mammalian ribosomal protein L19, no bacterial homolog; RPL19A has a paralog, RPL19B, that arose from the whole genome duplication [Source:SGD;Acc:S000002156])

HSP 1 Score: 185.267 bits (469), Expect = 1.190e-59
Identity = 95/158 (60.13%), Postives = 122/158 (77.22%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            M+NLR QKRLAASVVG G+ K+WLDPNE ++IA ANSR +IRKL+K+G I++K V VHS+ R R   +++REGRH G GKRKGT  AR+P +++WIRR+RVLR LL KYR+  KID HLY  LYK  KGN FK+KR L+E+I + K+D  R K LN++
Sbjct:    1 MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEE 158          
BLAST of Ribosomal protein L19 vs. Ensembl Nematostella
Match: EDO30125 (Ribosomal protein L19 [Source:UniProtKB/TrEMBL;Acc:A7T1P0])

HSP 1 Score: 201.83 bits (512), Expect = 1.202e-65
Identity = 114/158 (72.15%), Postives = 131/158 (82.91%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS LRLQKRLAAS++ CG+ KIWLDPNE  +IANANSRQ++RKL+KDGLII+KP  VHSR R R   EAR +GRH G GKRKGTANARMP K IWIRRMRVLR LL+KYRE KKID H+Y  LY   KGN FKNKRVL+EYIH+KK+++ARSK L+DQ
Sbjct:    1 MSTLRLQKRLAASLLKCGKKKIWLDPNECNEIANANSRQNVRKLIKDGLIIKKPEIVHSRARVRKADEARSKGRHSGHGKRKGTANARMPQKTIWIRRMRVLRRLLRKYREAKKIDNHMYHSLYMKSKGNVFKNKRVLMEYIHKKKAEKARSKLLSDQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Medaka
Match: RPL19 (60S ribosomal protein L19 [Source:NCBI gene;Acc:101157455])

HSP 1 Score: 205.297 bits (521), Expect = 1.566e-66
Identity = 112/158 (70.89%), Postives = 131/158 (82.91%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMGTGKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    1 MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLVKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGTGKRKGTANARMPEKLSWMRRMRILRRLLRRYRESKKIDRHMYHSLYLRAKGNVFKNKRILMEHIHKLKADKARKKLLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Medaka
Match: RPL19 (60S ribosomal protein L19 [Source:NCBI gene;Acc:101170879])

HSP 1 Score: 202.986 bits (515), Expect = 1.429e-65
Identity = 111/158 (70.25%), Postives = 130/158 (82.28%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            MS LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMG GKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    1 MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLVKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGYGKRKGTANARMPEKLSWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKAKGNVFKNKRILMEHIHKLKADKARKKLLADQ 158          
BLAST of Ribosomal protein L19 vs. Ensembl Medaka
Match: RPL19 (60S ribosomal protein L19 [Source:NCBI gene;Acc:101157455])

HSP 1 Score: 201.83 bits (512), Expect = 2.937e-65
Identity = 110/155 (70.97%), Postives = 129/155 (83.23%), Query Frame = 1
Query:  133 LRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQ 597
            LRLQKRLA+SV+ CG+ K+WLDPNE  +IANANSRQ IRKL+KDGLIIRKPV VHSR RCR    ARR+GRHMGTGKRKGTANARMP K+ W+RRMR+LR LL++YRE KKID H+Y  LY   KGN FKNKR+L+E+IH+ K+D+AR K L DQ
Sbjct:    2 LRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLVKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGTGKRKGTANARMPEKLSWMRRMRILRRLLRRYRESKKIDRHMYHSLYLRAKGNVFKNKRILMEHIHKLKADKARKKLLADQ 156          
BLAST of Ribosomal protein L19 vs. Planmine SMEST
Match: SMESG000057653.1 (SMESG000057653.1)

HSP 1 Score: 330.487 bits (846), Expect = 4.782e-116
Identity = 194/195 (99.49%), Postives = 195/195 (100.00%), Query Frame = 1
Query:  124 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEVVEATE 708
            MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKI+WIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQAEALRAKKKEARLRKEARIAEKRIERIKRHEVVEATE
Sbjct:    1 MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLIIRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIMWIRRMRVLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQARSKQLNDQAEALRAKKKEARLRKEARIAEKRIERIKRHEVVEATE 195          
The following BLAST results are available for this feature:
BLAST of Ribosomal protein L19 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RPL198.050e-6670.25ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL191.268e-6470.32ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL191.268e-6470.32ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL192.164e-6469.68ribosomal protein L19 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Ribosomal protein L19 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rpl-191.017e-6868.3560S ribosomal protein L19 [Source:UniProtKB/Swiss... [more]
rpl-191.017e-6868.3560S ribosomal protein L19 [Source:UniProtKB/Swiss... [more]
rpl-191.017e-6868.3560S ribosomal protein L19 [Source:UniProtKB/Swiss... [more]
rpl-191.017e-6868.3560S ribosomal protein L19 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Ribosomal protein L19 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RpL192.621e-7670.89gene:FBgn0285950 transcript:FBtr0072406[more]
RpL192.621e-7670.89gene:FBgn0285950 transcript:FBtr0072405[more]
back to top
BLAST of Ribosomal protein L19 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl197.385e-6569.62ribosomal protein L19 [Source:NCBI gene;Acc:406489... [more]
back to top
BLAST of Ribosomal protein L19 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl192.098e-6570.25ribosomal protein L19 [Source:NCBI gene;Acc:448704... [more]
rpl193.149e-6370.32ribosomal protein L19 [Source:NCBI gene;Acc:448704... [more]
back to top
BLAST of Ribosomal protein L19 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rpl195.527e-6670.25ribosomal protein L19 [Source:MGI Symbol;Acc:MGI:9... [more]
Rpl198.707e-6570.32ribosomal protein L19 [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of Ribosomal protein L19 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P36241|RL19_DROME2.627e-7570.8960S ribosomal protein L19 OS=Drosophila melanogast... [more]
sp|Q9LUQ6|RL192_ARATH5.403e-6964.5660S ribosomal protein L19-2 OS=Arabidopsis thalian... [more]
sp|O02639|RL19_CAEEL1.294e-6768.3560S ribosomal protein L19 OS=Caenorhabditis elegan... [more]
sp|P84100|RL19_RAT3.866e-6570.2560S ribosomal protein L19 OS=Rattus norvegicus OX=... [more]
sp|Q5RB99|RL19_PONAB3.866e-6570.2560S ribosomal protein L19 OS=Pongo abelii OX=9601 ... [more]
back to top
BLAST of Ribosomal protein L19 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PFM11.469e-7873.42Ribosomal protein L19 OS=Pomacea canaliculata OX=4... [more]
A0A1L8DRT68.123e-7672.78Ribosomal protein L19 OS=Nyssomyia neivai OX=33087... [more]
A8CAG88.123e-7672.78Ribosomal protein L19 OS=Phlebotomus papatasi OX=2... [more]
A8CWA38.123e-7672.78Ribosomal protein L19 OS=Lutzomyia longipalpis OX=... [more]
A0A1B6FHR72.527e-7572.15Ribosomal protein L19 (Fragment) OS=Cuerna arida O... [more]
back to top
BLAST of Ribosomal protein L19 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl192.766e-6872.78ribosomal protein L19 [Source:NCBI gene;Acc:103027... [more]
RPL197.351e-6770.8960S ribosomal protein L19 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Ribosomal protein L19 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl194.012e-7072.26ribosomal protein L19 [Source:NCBI gene;Acc:406489... [more]
back to top
BLAST of Ribosomal protein L19 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPL19B1.190e-5960.13Ribosomal 60S subunit protein L19B; rpl19a and rpl... [more]
RPL19A1.190e-5960.13Ribosomal 60S subunit protein L19A; rpl19a and rpl... [more]
back to top
BLAST of Ribosomal protein L19 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO301251.202e-6572.15Ribosomal protein L19 [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Ribosomal protein L19 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RPL191.566e-6670.8960S ribosomal protein L19 [Source:NCBI gene;Acc:10... [more]
RPL191.429e-6570.2560S ribosomal protein L19 [Source:NCBI gene;Acc:10... [more]
RPL192.937e-6570.9760S ribosomal protein L19 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Ribosomal protein L19 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000057653.14.782e-11699.49SMESG000057653.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007498 ID=SMED30007498|Name=Ribosomal protein L19|organism=Schmidtea mediterranea sexual|type=transcript|length=740bp
ATTAAATATGTTAACATTTCTTTTTTGATTAAAAAACCATTTTATTATAA
ATATTCAAAATTTTAATAACCTTTAACAAATTTGTTTAAATCGCTGTTAA
AATATTAGAAGTTATAATTTGAAATGAGTAATTTACGATTACAAAAGCGT
TTGGCAGCCAGCGTTGTCGGATGTGGTCAAAATAAAATCTGGTTGGATCC
AAATGAAAATGCAGATATTGCAAATGCAAATTCACGTCAAAGCATTCGAA
AACTTTTAAAGGATGGTTTGATTATCAGGAAACCAGTTAAAGTACATTCA
AGATTTCGATGCCGTGTTAAACTTGAAGCCAGACGTGAAGGTAGACACAT
GGGTACTGGTAAGAGGAAGGGTACTGCAAATGCCAGAATGCCAGTTAAAA
TTATCTGGATCAGACGAATGCGTGTTTTAAGAAATCTTTTAAAGAAATAC
CGAGAGGGAAAGAAAATTGATTGCCATCTTTACAGAAAATTGTACAAAAT
GTGCAAGGGTAATCAATTCAAAAACAAGCGGGTTTTGATTGAATACATTC
ACCGTAAGAAATCTGACCAAGCAAGATCAAAACAATTGAATGACCAAGCT
GAAGCTTTGAGAGCTAAAAAGAAAGAAGCTAGACTCCGAAAAGAAGCTCG
AATTGCCGAAAAGAGAATTGAACGCATTAAAAGACACGAAGTTGTCGAAG
CAACTGAATAATTTAAAATTGAATAAAATATGTTGGATGT
back to top

protein sequence of SMED30007498-orf-1

>SMED30007498-orf-1 ID=SMED30007498-orf-1|Name=SMED30007498-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=196bp
MSNLRLQKRLAASVVGCGQNKIWLDPNENADIANANSRQSIRKLLKDGLI
IRKPVKVHSRFRCRVKLEARREGRHMGTGKRKGTANARMPVKIIWIRRMR
VLRNLLKKYREGKKIDCHLYRKLYKMCKGNQFKNKRVLIEYIHRKKSDQA
RSKQLNDQAEALRAKKKEARLRKEARIAEKRIERIKRHEVVEATE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003735structural constituent of ribosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR039547RPL19
IPR033935Ribosomal_L19_euka
IPR03597060S_ribosomal_L19/L19e_sf
IPR000196Ribosomal_L19/L19e
IPR015972Ribosomal_L19/L19e_dom1
IPR015974Ribosomal_L19/L19e_dom3
IPR023638Ribosomal_L19/L19e_CS
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
GO:0022625cytosolic large ribosomal subunit
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 145..188
NoneNo IPR availableGENE3DG3DSA:1.10.1200.240coord: 57..195
e-value: 1.5E-54
score: 185.7
IPR000196Ribosomal protein L19/L19eSMARTSM01416Ribosomal_L19e_2coord: 3..146
e-value: 6.4E-92
score: 321.4
IPR000196Ribosomal protein L19/L19ePFAMPF01280Ribosomal_L19ecoord: 3..146
e-value: 1.8E-62
score: 209.7
IPR015972Ribosomal protein L19/L19e, domain 1GENE3DG3DSA:1.10.1650.10coord: 1..56
e-value: 2.0E-30
score: 106.2
IPR03954760S ribosomal protein L19PANTHERPTHR1072260S RIBOSOMAL PROTEIN L19coord: 1..188
IPR023638Ribosomal protein L19/L19e conserved sitePROSITEPS00526RIBOSOMAL_L19Ecoord: 7..26
IPR033935Ribosomal protein L19, eukaryoticCDDcd01417Ribosomal_L19e_Ecoord: 4..167
e-value: 5.13221E-79
score: 231.085
IPR035970Ribosomal protein L19/L19e superfamilySUPERFAMILYSSF48140Ribosomal protein L19 (L19e)coord: 3..143