Protein kinase C

Overview
NameProtein kinase C
Smed IDSMED30007480
Length (bp)2154
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase C (SMED30007480) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase C (SMED30007480) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase C (SMED30007480) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase C (SMED30007480) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007480

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30007480SMESG000039865.1 SMESG000039854.1 SmedASXL_006678SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30007480SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007480SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007480SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30007480SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30007480SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30007480SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007480SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007480SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007480SMESG000039865.1 Contig35071newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007480SMESG000039865.1 Contig35071uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007480SMESG000039865.1 SMESG000039854.1 Contig26788newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007480SMESG000039865.1 SMESG000039854.1 Contig26788uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007480SMESG000039865.1 SMESG000039854.1 Contig38802newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007480SMESG000039865.1 SMESG000039854.1 Contig38802uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30007480SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v6_4244_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30007480SMESG000039865.1 SMESG000039854.1 SMED30007480smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30007480SMESG000039865.1 SMESG000039854.1 OX_Smed_1.0.13700ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007480SMESG000039865.1 SMESG000039854.1 SMESG000032749.1 SMESG000032747.1 dd_Smed_v4_4244_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCB (protein kinase C beta [Source:HGNC Symbol;Acc:HGNC:9395])

HSP 1 Score: 976.467 bits (2523), Expect = 0.000e+0
Identity = 455/656 (69.36%), Postives = 546/656 (83.23%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKS-------ILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
            F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KC+TC  NVHK+C  NVP LCG DHTERRGRIY++ + +   + V V +AKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNP WNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL K  VD WFKLLS EEGE++++PV  + + A+  +L+ KFE++       + EEK    ++  +N  N+++  +   +DFNF++VLGKGSFGKV+L+ERKGTDELYAVKILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY IQQ G+FKEP AVFYAAEIAIGLFFL SKGIIYRDLKLDN+MLD EGHIKIADFGMCKE I+D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD++EH FFR IDWEK+  +++QPP KPK +D RD SNFD+EFT++  +LTPTDKLFIMNLDQ EF+GFS+ NPEF++ V
Sbjct:   20 FARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEAN-EELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKL---TDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV 671          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCA (protein kinase C alpha [Source:HGNC Symbol;Acc:HGNC:9393])

HSP 1 Score: 965.296 bits (2494), Expect = 0.000e+0
Identity = 446/647 (68.93%), Postives = 538/647 (83.15%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQIT-NENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            F R+GALRQKNVHE+KDH+F+ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GPDTD  ++ H FK+HTY SPTFCDHCGSLLYGL+HQG+KC+TCD NVHK+C  NVP LCGMDHTE+RGRIYLK    + K++V V +AKNL+PMDPNGL+DPYVK+K++P+ ++  KQKTKTI++TLNP WNE F F +   D  +R+S+E+WDWDRT+RNDFMG+LSFG+SEL+K P   W+KLL+ EEGE+Y++P+ +     ++ +L+ KFEK+ L    N+ I+ +E+     N  D  + +DFNF++VLGKGSFGKV+LA+RKGT+ELYA+KILKKDV+IQDDDVECTM+EKRVLAL +KP FL QLHSCFQT+DRLYFVME+VNGGDLMY IQQ GKFKEP AVFYAAEI+IGLFFLH +GIIYRDLKLDN+MLD EGHIKIADFGMCKE + D  TTRTFCGTPDYIAPEII YQPYGKSVDWWAYGV+LYEMLAGQ PFDGEDE+ELF +I EHNVSYPKS+SKE+VS+CKGL+TK P KRLG    G+RDVREH FFRRIDWEK+  R++QPP KPK+   +   NFD+ FT+    LTP D+L I N+DQ++F GFS+VNP+F+
Sbjct:   20 FARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNM-ELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCG-KGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFV 664          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCB (protein kinase C beta [Source:HGNC Symbol;Acc:HGNC:9395])

HSP 1 Score: 942.954 bits (2436), Expect = 0.000e+0
Identity = 445/653 (68.15%), Postives = 534/653 (81.78%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKS-------ILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KC+TC  NVHK+C  NVP LCG DHTERRGRIY++ + +   + V V +AKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNP WNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL K  VD WFKLLS EEGE++++PV  + + A+  +L+ KFE++       + EEK    ++  +N  N+++  +   +DFNF++VLGKGSFGKV+L+ERKGTDELYAVKILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY IQQ G+FKEP AVFYAAEIAIGLFFL SKGIIYRDLKLDN+MLD EGHIKIADFGMCKE I+D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD++EH FFR IDWEK+  +++QPP KPK    R+  NFD+ FT+    LTP D+  I N+DQ+EF GFSFVN EF+
Sbjct:   20 FARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEAN-EELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKL---TDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACG-RNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFL 667          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCG (protein kinase C gamma [Source:HGNC Symbol;Acc:HGNC:9402])

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 410/676 (60.65%), Postives = 515/676 (76.18%), Query Frame = 2
Query:   50 AIEEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDFKTN-HDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNG-KMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQS-RKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKA-KFEKSILEEKKNQQITNENNYINQNKQDIPRA-----------SDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPS-----FLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
             + +     +  F R+GALRQK VHE+K H+F ARFFKQ TFC HC DFIWG GKQG QC++C F VH+RCHE VTF+CPG   GP TD   N H F++H+Y+SPTFCDHCGSLLYGL+HQG+KC  C+ NVH++C ++VP LCG+DHTERRGR+ L+I      +++V V EA+NL+PMDPNGL+DPYVK+K++P+ ++  KQKT+T+KATLNP WNE F+F +   D  +R+S+EVWDWDRTSRNDFMGA+SFG+SEL+K PVD W+KLL+ EEGE+Y++PVAD  N + +   +A  +   + E  +    ++     + +  D  R            SDF+F++VLGKGSFGKV+LAER+G+DELYA+KILKKDVI+QDDDV+CT++EKRVLAL  +       FL QLHS FQT DRLYFVME+V GGDLMY IQQ GKFKEP A FYAAEIAIGLFFLH++GIIYRDLKLDN+MLD EGHIKI DFGMCKE +F   TTRTFCGTPDYIAPEII YQPYGKSVDWW++GV+LYEMLAGQ PFDGEDEEELF AI E  V+YPKS+S+E+V+ICKG LTK P KRLGS   G+  +R H FFR IDWE++   ++ PP +P+    R   NFD+ FT+    LTP D+L + ++DQ +F GF++VNP+F+
Sbjct:    7 GVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCG-RSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFV 681          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCE (protein kinase C epsilon [Source:HGNC Symbol;Acc:HGNC:9401])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 293/656 (44.66%), Postives = 397/656 (60.52%), Query Frame = 2
Query:   92 RRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWG-FGKQGFQCKICLFAVHKRCHELVTFQCPG--KDDGPDT----DFKTN--HDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPE--DQSRKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWD-RTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLG--SNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            R+GA+R++ VH++  H+F+A + +Q T+C HC+DFIWG  GKQG+QC++C   VHKRCHEL+  +C G  K + PD      F  N  H F +H Y  PTFCDHCGSLL+GLL QGL+C+ C  NVH++CE NV   CG+                                 D  G+A     + + P+    S +++ K I    +P        + S+ED +K       D + +   N+   ALSF                     GE +    + D  + S                       EN  + Q +       +FNFI VLGKGSFGKV+LAE KG DE+YAVK+LKKDVI+QDDDV+CTM EKR+LAL  K  +L QL+ CFQT DRL+FVME+VNGGDLM++IQ+  KF EP + FYAAE+   L FLH  G+IYRDLKLDNI+LD EGH K+ADFGMCKEGI +  TT TFCGTPDYIAPEI++   YG SVDWWA GV++YEM+AGQ PF+ ++E++LF +I   +V YP  +SKE+VSI K  +TK+P KRLG  +++ G+  +++H FF+ IDW  +  ++++PP KP+IK  RDV+NFDQ+FT+E   LT  D+  +  ++Q EF GFS+   + +
Sbjct:  156 RQGAVRRR-VHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGV---------------------------------DARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGS--SPSEEDRSKSAPTSPCDQEIKELENNIRKALSF------------------DNRGEEHRAASSPDGQLMS---------------------PGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLM 736          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 951.814 bits (2459), Expect = 0.000e+0
Identity = 446/679 (65.68%), Postives = 536/679 (78.94%), Query Frame = 2
Query:   32 SIMSEQAIEEGNTSAKAG--FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQS--RKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNY-------INQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRL---GSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVE 2023
            S+ +  +++E       G  F RRGALRQKNVHEIK H+F+ARFFKQ TFC HCKDF+WG  KQGFQC++C   VHKRCHE V F CPG D G DTD  +  H +KV TY+SPTFCDHCGSLLYG+LHQG+KC++CDTNVH +C KNVP +CG D+TE+RGR+ ++ +  N ++ +++LEAKNL+PMDPNGL+DPYVK K++PED     KQKTKT++ATLNP WNE F + +   D  +R+SIEVWDWDRTSRNDFMG+LSFGISEL+K+    W+KLLS EEGEFY+I +  + +   +  ++ K  ++ +    +     +          +  +  ++ +ASDFNF+ VLGKGSFGKV+L E+K T EL+A+K+LKKDVIIQDDDVECTM EKRVLAL EKPSFLV LHSCFQTMDRLYFVMEFVNGGDLMY+IQQ GKFKEPVAVFYAAEIA+GLFFLHSKGIIYRDLKLDN+ML+ +GHIKI DFGMCKE IF D TT+TFCGTPDYIAPEII YQPYGKSVDWWAYGV+L+EMLAGQ PFDGEDE+ELF AITEHNVSYPKS+SKE+VS+CK LL K+P KRL   G +    RD++EH FFRRIDW KI  RQ+QPP KPK+K   D SNFD EFT E  +LTP D+LF+MNLDQTEF GFSFVNPE++ E
Sbjct:    2 SLSTNSSVKEDEAQRIEGKAFVRRGALRQKNVHEIKSHKFIARFFKQPTFCSHCKDFLWGITKQGFQCQVCTLVVHKRCHEFVNFACPGADKGVDTDDPRQQHKWKVQTYSSPTFCDHCGSLLYGILHQGMKCQSCDTNVHHRCVKNVPNMCGTDNTEKRGRLRIEAHIENDQLTIKILEAKNLIPMDPNGLSDPYVKCKLIPEDSGCKSKQKTKTLRATLNPQWNETFTYKLLPGDKDRRLSIEVWDWDRTSRNDFMGSLSFGISELMKEAASGWYKLLSAEEGEFYNINITPEYD-EDMEKVRKKMNENFITRDNSSSKPKDPAAPRASTLPLGSSNHNVIKASDFNFLTVLGKGSFGKVLLGEQKTTKELFAIKVLKKDVIIQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTMDRLYFVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQPPFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGCTGDDESASRDIKEHPFFRRIDWFKIETRQIQPPFKPKLKSADDTSNFDSEFTHEVPKLTPIDRLFLMNLDQTEFEGFSFVNPEYVQE 679          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 951.044 bits (2457), Expect = 0.000e+0
Identity = 443/660 (67.12%), Postives = 528/660 (80.00%), Query Frame = 2
Query:   83 GFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQS--RKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNY-------INQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRL---GSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVE 2023
             F RRGALRQKNVHEIK H+F+ARFFKQ TFC HCKDF+WG  KQGFQC++C   VHKRCHE V F CPG D G DTD  +  H +KV TY+SPTFCDHCGSLLYG+LHQG+KC++CDTNVH +C KNVP +CG D+TE+RGR+ ++ +  N ++ +++LEAKNL+PMDPNGL+DPYVK K++PED     KQKTKT++ATLNP WNE F + +   D  +R+SIEVWDWDRTSRNDFMG+LSFGISEL+K+    W+KLLS EEGEFY+I +  + +   +  ++ K  ++ +    +     +          +  +  ++ +ASDFNF+ VLGKGSFGKV+L E+K T EL+A+K+LKKDVIIQDDDVECTM EKRVLAL EKPSFLV LHSCFQTMDRLYFVMEFVNGGDLMY+IQQ GKFKEPVAVFYAAEIA+GLFFLHSKGIIYRDLKLDN+ML+ +GHIKI DFGMCKE IF D TT+TFCGTPDYIAPEII YQPYGKSVDWWAYGV+L+EMLAGQ PFDGEDE+ELF AITEHNVSYPKS+SKE+VS+CK LL K+P KRL   G +    RD++EH FFRRIDW KI  RQ+QPP KPK+K   D SNFD EFT E  +LTP D+LF+MNLDQTEF GFSFVNPE++ E
Sbjct:   66 AFVRRGALRQKNVHEIKSHKFIARFFKQPTFCSHCKDFLWGITKQGFQCQVCTLVVHKRCHEFVNFACPGADKGVDTDDPRQQHKWKVQTYSSPTFCDHCGSLLYGILHQGMKCQSCDTNVHHRCVKNVPNMCGTDNTEKRGRLRIEAHIENDQLTIKILEAKNLIPMDPNGLSDPYVKCKLIPEDSGCKSKQKTKTLRATLNPQWNETFTYKLLPGDKDRRLSIEVWDWDRTSRNDFMGSLSFGISELMKEAASGWYKLLSAEEGEFYNINITPEYD-EDMEKVRKKMNENFITRDNSSSKPKDPAAPRASTLPLGSSNHNVIKASDFNFLTVLGKGSFGKVLLGEQKTTKELFAIKVLKKDVIIQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTMDRLYFVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQPPFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGCTGDDESASRDIKEHPFFRRIDWFKIETRQIQPPFKPKLKSADDTSNFDSEFTHEVPKLTPIDRLFLMNLDQTEFEGFSFVNPEYVQE 724          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 926.391 bits (2393), Expect = 0.000e+0
Identity = 434/673 (64.49%), Postives = 522/673 (77.56%), Query Frame = 2
Query:   56 EEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQS--RKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNY-------INQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRL---GSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV*PY 2035
            E+        F RRGALRQKNVHEIK H+F+ARFFKQ TFC HCKDF+WG  KQGFQC++C   VHKRCHE V F CPG D G DTD  +  H +KV TY+SPTFCDHCGSLLYG+LHQG+KC++CDTNVH +C KNVP +CG D+TE+RGR+ ++ +  N ++ +++LEAKNL+PMDPNGL+DPYVK K++PED     KQKTKT++ATLNP WNE F + +   D  +R+SIEVWDWDRTSRNDFMG+LSFGISEL+K+    W+KLLS EEGEFY+I +  + +   +  ++ K  ++ +    +     +          +  +  ++ +ASDFNF+ VLGKGSFGKV+L E+K T EL+A+K+LKKDVIIQDDDVECTM EKRVLAL EKPSFLV LHSCFQTMDRLYFVMEFVNGGDLMY+IQQ GKFKEPVAVFYAAEIA+GLFFLHSKGIIYRDLKLDN+ML+ +GHIKI DFGMCKE IF D TT+TFCGTPDYIAPEII YQPYGKSVDWWAYGV+L+EMLAGQ PFDGEDE+ELF AITEHNVSYPKS+SKE+VS+CK LL K+P KRL   G +    RD++EH FFRRIDW KI  RQ+QPP KPK+K  R   NFD  F K   ++TP D   + NL   EFS FSFVNP ++ +V P+
Sbjct:  152 EQAQRIEGKAFVRRGALRQKNVHEIKSHKFIARFFKQPTFCSHCKDFLWGITKQGFQCQVCTLVVHKRCHEFVNFACPGADKGVDTDDPRQQHKWKVQTYSSPTFCDHCGSLLYGILHQGMKCQSCDTNVHHRCVKNVPNMCGTDNTEKRGRLRIEAHIENDQLTIKILEAKNLIPMDPNGLSDPYVKCKLIPEDSGCKSKQKTKTLRATLNPQWNETFTYKLLPGDKDRRLSIEVWDWDRTSRNDFMGSLSFGISELMKEAASGWYKLLSAEEGEFYNINITPEYD-EDMEKVRKKMNENFITRDNSSSKPKDPAAPRASTLPLGSSNHNVIKASDFNFLTVLGKGSFGKVLLGEQKTTKELFAIKVLKKDVIIQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTMDRLYFVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQPPFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGCTGDDESASRDIKEHPFFRRIDWFKIETRQIQPPFKPKLKTDRSTENFDHSFLKLPTKMTPPDWEVLENLKGDEFSNFSFVNPFYVKDVEPH 823          

HSP 2 Score: 77.0258 bits (188), Expect = 3.368e-14
Identity = 62/225 (27.56%), Postives = 95/225 (42.22%), Query Frame = 2
Query: 1469 GMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHN-VSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFF-------------------RRIDWEKINARQV------------------QPPNKPKI--KDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVE 2023
             +CK  +  + + R  C   D  A   IK  P+ + +DW+       E    Q PF  + + +      +H+ +  P  M+     + + L   +       N +  +DV  H+F+                    ++    I++  +                   P NK K+  K   D SNFD EFT E  +LTP D+LF+MNLDQTEF GFSFVNPE++ E
Sbjct:  716 SLCKALLIKNPSKRLGCTGDDESASRDIKEHPFFRRIDWFKI-----ETRQIQPPFKPKLKTDRSTENFDHSFLKLPTKMTPPDWEVLENLKGDEFSNFSFVNPFYVKDVEPHIFYVLFIFLILRPFLLLPYLSHLQLTLSAIHSPLLLLSASVFFKFLFKNNFSQSPYNKIKVLLKSADDTSNFDSEFTHEVPKLTPIDRLFLMNLDQTEFEGFSFVNPEYVQE 935          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 922.924 bits (2384), Expect = 0.000e+0
Identity = 436/682 (63.93%), Postives = 527/682 (77.27%), Query Frame = 2
Query:   32 SIMSEQAIEEGNTSAKAG--FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQS--RKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNY-------INQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRL---GSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV*P 2032
            S+ +  +++E       G  F RRGALRQKNVHEIK H+F+ARFFKQ TFC HCKDF+WG  KQGFQC++C   VHKRCHE V F CPG D G DTD  +  H +KV TY+SPTFCDHCGSLLYG+LHQG+KC++CDTNVH +C KNVP +CG D+TE+RGR+ ++ +  N ++ +++LEAKNL+PMDPNGL+DPYVK K++PED     KQKTKT++ATLNP WNE F + +   D  +R+SIEVWDWDRTSRNDFMG+LSFGISEL+K+    W+KLLS EEGEFY+I +  + +   +  ++ K  ++ +    +     +          +  +  ++ +ASDFNF+ VLGKGSFGKV+L E+K T EL+A+K+LKKDVIIQDDDVECTM EKRVLAL EKPSFLV LHSCFQTMDRLYFVMEFVNGGDLMY+IQQ GKFKEPVAVFYAAEIA+GLFFLHSKGIIYRDLKLDN+ML+ +GHIKI DFGMCKE IF D TT+TFCGTPDYIAPEII YQPYGKSVDWWAYGV+L+EMLAGQ PFDGEDE+ELF AITEHNVSYPKS+SKE+VS+CK LL K+P KRL   G +    RD++EH FFRRIDW KI  RQ+QPP KPK+K  R   NFD  F K   ++TP D   + NL   EFS FSFVNP ++ +V P
Sbjct:    2 SLSTNSSVKEDEAQRIEGKAFVRRGALRQKNVHEIKSHKFIARFFKQPTFCSHCKDFLWGITKQGFQCQVCTLVVHKRCHEFVNFACPGADKGVDTDDPRQQHKWKVQTYSSPTFCDHCGSLLYGILHQGMKCQSCDTNVHHRCVKNVPNMCGTDNTEKRGRLRIEAHIENDQLTIKILEAKNLIPMDPNGLSDPYVKCKLIPEDSGCKSKQKTKTLRATLNPQWNETFTYKLLPGDKDRRLSIEVWDWDRTSRNDFMGSLSFGISELMKEAASGWYKLLSAEEGEFYNINITPEYD-EDMEKVRKKMNENFITRDNSSSKPKDPAAPRASTLPLGSSNHNVIKASDFNFLTVLGKGSFGKVLLGEQKTTKELFAIKVLKKDVIIQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTMDRLYFVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQPPFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGCTGDDESASRDIKEHPFFRRIDWFKIETRQIQPPFKPKLKTDRSTENFDHSFLKLPTKMTPPDWEVLENLKGDEFSNFSFVNPFYVKDVEP 682          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-1 (Protein kinase C-like 1B [Source:UniProtKB/Swiss-Prot;Acc:P34885])

HSP 1 Score: 430.254 bits (1105), Expect = 3.798e-142
Identity = 208/356 (58.43%), Postives = 264/356 (74.16%), Query Frame = 2
Query:  971 QQITNENNYINQNKQ--DIPRAS----DFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGS--NRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEF 2014
            QQI+ +++    ++    +P  +    DF F+ VLGKGSFGKV+LAERKGTDE+YA+KILKKDVI+QDDDVECTM EKR+L+L  K  FL  LHS FQT DRL+FVME+VNGGDLM++IQ+  KF E  A FYAAE+   L FLH   +IYRDLKLDNI+LD EGH ++ADFGMCKEGI  D  T TFCGTPDYIAPEI++   YG SVDWWA GV++YEM+AGQ PF+ ++E++LF AI   +V YP  +SKE+V+I K  +TK+  KRLG   ++ G+  +R H FFR IDW+ + +RQV+PP KPKIK  RD +NFD +FTKE   LTP+D   +  ++Q EF GFSF+NP F
Sbjct:  263 QQISEDDSGTTSSRSASKVPGGTLSIHDFTFMKVLGKGSFGKVMLAERKGTDEVYAIKILKKDVIVQDDDVECTMCEKRILSLAAKHPFLTALHSSFQTSDRLFFVMEYVNGGDLMFQIQRARKFDESRARFYAAEVTCALQFLHRNDVIYRDLKLDNILLDAEGHCRLADFGMCKEGINKDNLTSTFCGTPDYIAPEILQEMEYGVSVDWWALGVLMYEMMAGQPPFEADNEDDLFEAILNDDVLYPVWLSKEAVNILKAFMTKNAGKRLGCVVSQGGEDAIRAHPFFREIDWDALESRQVKPPFKPKIKSKRDANNFDSDFTKEEPVLTPSDPAVVRAINQDEFRGFSFINPHF 618          

HSP 2 Score: 175.637 bits (444), Expect = 1.639e-46
Identity = 79/167 (47.31%), Postives = 109/167 (65.27%), Query Frame = 2
Query:   92 RRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPG-KDDGPDT-------------DFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNV 550
            RRGA+R+K +HE+  H+F+A F +Q TFC HCK+FIWG GKQG+QC+IC   VHKRCHE V ++CPG K D  +              +    H F VH+Y  PTFCDHCGS+LYGL++QGL+C TC  NVHK+C++NV   CG++  +    +  ++     KM++
Sbjct:   70 RRGAMRRK-IHEVTGHKFMALFLRQPTFCAHCKEFIWGIGKQGYQCQICTVVVHKRCHEDVVWKCPGNKADAVEELGKEIQETGAGRFNINMPHRFSVHSYKRPTFCDHCGSMLYGLINQGLQCSTCKLNVHKRCQRNVANNCGINAKQMAAEL-AQLGLTGDKMSI 234          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0331960)

HSP 1 Score: 960.674 bits (2482), Expect = 0.000e+0
Identity = 450/644 (69.88%), Postives = 532/644 (82.61%), Query Frame = 2
Query:   92 RRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDF-KTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            R+GAL++KNV  +KDH F+ARFFKQ TFC HCKDFIWGFGKQGFQC++C + VHKRCHE VTF CPGKD G D+D  KT H+F+  TY  PTFCDHCGSLLYG+ HQGLKC  CD NVH +C++NVP LCG DHTERRGRIYL+IN     + V++ E +NL+PMDPNGL+DPYVK+K++P+D+ + K+KT+TIKA LNP WNE   + +  ED  +R+ IEVWDWDRTSRNDFMGALSFGISE++K P + WFKLL+ +EGE+Y++P ADD     +  LK K       +KK   + ++ N    +K+D+ RA+DFNFI VLGKGSFGKV+LAERKG++ELYA+KILKKDVIIQDDDVECTMIEKRVLAL EKP FLVQLHSCFQTMDRL+FVME+VNGGDLM++IQQ GKFKEPVAVFYAAEIA GLFFLH+KGI+YRDLKLDN++LD +GH+KIADFGMCKE I  DKTT+TFCGTPDYIAPEII YQPYGKSVDWWAYGV+LYEML GQ PFDGEDEEELF AIT+HNVSYPKS+SKE+   CKG LTK P KRLG    G+ DVR H FFRRIDWEKI  R+VQPP KPKIK  +DVSNFD++FT E   LTPTDK+F+MNLDQ+EF GFS++NPE++
Sbjct:   31 RKGALKKKNVFNVKDHCFIARFFKQPTFCSHCKDFIWGFGKQGFQCQVCSYVVHKRCHEYVTFICPGKDKGIDSDSPKTQHNFEPFTYAGPTFCDHCGSLLYGIYHQGLKCSACDMNVHARCKENVPSLCGCDHTERRGRIYLEINVKENLLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQ--DLLKLKQK-----PSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLDQSEFVGFSYMNPEYV 667          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0087049)

HSP 1 Score: 960.674 bits (2482), Expect = 0.000e+0
Identity = 450/644 (69.88%), Postives = 532/644 (82.61%), Query Frame = 2
Query:   92 RRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDF-KTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            R+GAL++KNV  +KDH F+ARFFKQ TFC HCKDFIWGFGKQGFQC++C + VHKRCHE VTF CPGKD G D+D  KT H+F+  TY  PTFCDHCGSLLYG+ HQGLKC  CD NVH +C++NVP LCG DHTERRGRIYL+IN     + V++ E +NL+PMDPNGL+DPYVK+K++P+D+ + K+KT+TIKA LNP WNE   + +  ED  +R+ IEVWDWDRTSRNDFMGALSFGISE++K P + WFKLL+ +EGE+Y++P ADD     +  LK K       +KK   + ++ N    +K+D+ RA+DFNFI VLGKGSFGKV+LAERKG++ELYA+KILKKDVIIQDDDVECTMIEKRVLAL EKP FLVQLHSCFQTMDRL+FVME+VNGGDLM++IQQ GKFKEPVAVFYAAEIA GLFFLH+KGI+YRDLKLDN++LD +GH+KIADFGMCKE I  DKTT+TFCGTPDYIAPEII YQPYGKSVDWWAYGV+LYEML GQ PFDGEDEEELF AIT+HNVSYPKS+SKE+   CKG LTK P KRLG    G+ DVR H FFRRIDWEKI  R+VQPP KPKIK  +DVSNFD++FT E   LTPTDK+F+MNLDQ+EF GFS++NPE++
Sbjct:   31 RKGALKKKNVFNVKDHCFIARFFKQPTFCSHCKDFIWGFGKQGFQCQVCSYVVHKRCHEYVTFICPGKDKGIDSDSPKTQHNFEPFTYAGPTFCDHCGSLLYGIYHQGLKCSACDMNVHARCKENVPSLCGCDHTERRGRIYLEINVKENLLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQ--DLLKLKQK-----PSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLDQSEFVGFSYMNPEYV 667          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0087048)

HSP 1 Score: 947.962 bits (2449), Expect = 0.000e+0
Identity = 450/653 (68.91%), Postives = 532/653 (81.47%), Query Frame = 2
Query:   92 RRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFI--------W-GFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDF-KTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            R+GAL++KNV  +KDH F+ARFFKQ TFC HCKDFI        W GFGKQGFQC++C + VHKRCHE VTF CPGKD G D+D  KT H+F+  TY  PTFCDHCGSLLYG+ HQGLKC  CD NVH +C++NVP LCG DHTERRGRIYL+IN     + V++ E +NL+PMDPNGL+DPYVK+K++P+D+ + K+KT+TIKA LNP WNE   + +  ED  +R+ IEVWDWDRTSRNDFMGALSFGISE++K P + WFKLL+ +EGE+Y++P ADD     +  LK K       +KK   + ++ N    +K+D+ RA+DFNFI VLGKGSFGKV+LAERKG++ELYA+KILKKDVIIQDDDVECTMIEKRVLAL EKP FLVQLHSCFQTMDRL+FVME+VNGGDLM++IQQ GKFKEPVAVFYAAEIA GLFFLH+KGI+YRDLKLDN++LD +GH+KIADFGMCKE I  DKTT+TFCGTPDYIAPEII YQPYGKSVDWWAYGV+LYEML GQ PFDGEDEEELF AIT+HNVSYPKS+SKE+   CKG LTK P KRLG    G+ DVR H FFRRIDWEKI  R+VQPP KPKIK  +DVSNFD++FT E   LTPTDK+F+MNLDQ+EF GFS++NPE++
Sbjct:   31 RKGALKKKNVFNVKDHCFIARFFKQPTFCSHCKDFICGYQSGYAWMGFGKQGFQCQVCSYVVHKRCHEYVTFICPGKDKGIDSDSPKTQHNFEPFTYAGPTFCDHCGSLLYGIYHQGLKCSACDMNVHARCKENVPSLCGCDHTERRGRIYLEINVKENLLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQ--DLLKLKQK-----PSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLDQSEFVGFSYMNPEYV 676          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0112819)

HSP 1 Score: 938.332 bits (2424), Expect = 0.000e+0
Identity = 444/652 (68.10%), Postives = 530/652 (81.29%), Query Frame = 2
Query:   92 RRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFI--------W-GFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            R+GAL++KNV  +KDH F+ARFFKQ TFC HCKDFI        W GFGKQGFQC++C + VHKRCHE VTF CPGKD G D+  +  H ++  T+ SPTFCDHCGSLL+G+ H+GLKC  CD NVH +C++NVP LCG DHTERRGRIYL+IN     + V++ E +NL+PMDPNGL+DPYVK+K++P+D+ + K+KT+TIKA LNP WNE   + +  ED  +R+ IEVWDWDRTSRNDFMGALSFGISE++K P + WFKLL+ +EGE+Y++P ADD     +  LK K       +KK   + ++ N    +K+D+ RA+DFNFI VLGKGSFGKV+LAERKG++ELYA+KILKKDVIIQDDDVECTMIEKRVLAL EKP FLVQLHSCFQTMDRL+FVME+VNGGDLM++IQQ GKFKEPVAVFYAAEIA GLFFLH+KGI+YRDLKLDN++LD +GH+KIADFGMCKE I  DKTT+TFCGTPDYIAPEII YQPYGKSVDWWAYGV+LYEML GQ PFDGEDEEELF AIT+HNVSYPKS+SKE+   CKG LTK P KRLG    G+ DVR H FFRRIDWEKI  R+VQPP KPKIK  +DVSNFD++FT E   LTPTDK+F+MNLDQ+EF GFS++NPE++
Sbjct:   31 RKGALKKKNVFNVKDHCFIARFFKQPTFCSHCKDFICGYQSGYAWMGFGKQGFQCQVCSYVVHKRCHEYVTFICPGKDKGIDSAHQMPHKWQNVTFLSPTFCDHCGSLLHGITHKGLKCRACDMNVHARCKENVPSLCGCDHTERRGRIYLEINVKENLLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQ--DLLKLKQK-----PSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLDQSEFVGFSYMNPEYV 675          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0305070)

HSP 1 Score: 938.332 bits (2424), Expect = 0.000e+0
Identity = 444/652 (68.10%), Postives = 530/652 (81.29%), Query Frame = 2
Query:   92 RRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFI--------W-GFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            R+GAL++KNV  +KDH F+ARFFKQ TFC HCKDFI        W GFGKQGFQC++C + VHKRCHE VTF CPGKD G D+  +  H ++  T+ SPTFCDHCGSLL+G+ H+GLKC  CD NVH +C++NVP LCG DHTERRGRIYL+IN     + V++ E +NL+PMDPNGL+DPYVK+K++P+D+ + K+KT+TIKA LNP WNE   + +  ED  +R+ IEVWDWDRTSRNDFMGALSFGISE++K P + WFKLL+ +EGE+Y++P ADD     +  LK K       +KK   + ++ N    +K+D+ RA+DFNFI VLGKGSFGKV+LAERKG++ELYA+KILKKDVIIQDDDVECTMIEKRVLAL EKP FLVQLHSCFQTMDRL+FVME+VNGGDLM++IQQ GKFKEPVAVFYAAEIA GLFFLH+KGI+YRDLKLDN++LD +GH+KIADFGMCKE I  DKTT+TFCGTPDYIAPEII YQPYGKSVDWWAYGV+LYEML GQ PFDGEDEEELF AIT+HNVSYPKS+SKE+   CKG LTK P KRLG    G+ DVR H FFRRIDWEKI  R+VQPP KPKIK  +DVSNFD++FT E   LTPTDK+F+MNLDQ+EF GFS++NPE++
Sbjct:   31 RKGALKKKNVFNVKDHCFIARFFKQPTFCSHCKDFICGYQSGYAWMGFGKQGFQCQVCSYVVHKRCHEYVTFICPGKDKGIDSAHQMPHKWQNVTFLSPTFCDHCGSLLHGITHKGLKCRACDMNVHARCKENVPSLCGCDHTERRGRIYLEINVKENLLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQ--DLLKLKQK-----PSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLDQSEFVGFSYMNPEYV 675          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcbb (protein kinase C, beta b [Source:NCBI gene;Acc:393953])

HSP 1 Score: 970.689 bits (2508), Expect = 0.000e+0
Identity = 457/667 (68.52%), Postives = 541/667 (81.11%), Query Frame = 2
Query:   38 MSEQAIEEG--NTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKS-ILEEKKNQQITNENNYINQN-KQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIV 2020
            M+E A  +G   ++   GF R+GALRQKNVHE+K+H+F+ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FKVHTY+SPTFCDHCGSLLYGL+HQG++C+ C  N+HK+C  NVP LCG DHTERRGRI +     N  + V + EAKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK  LNPTWNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL KQ VD WFKLLS EEGE++++PV  +    +   L+ KFE++ I   K +   +N  +  + N  +D  + SDFNF++VLGKGSFGKV+LAERKG DEL+A+KILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME++NGGDLMY IQQ GKFKEP AVFYAAEIAIGLFFLHSKG+IYRDLKLDN+MLD EGHIKIADFGMCKE + D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQ PFDGEDE+ELF +I EH+VSYPKSMSKE+V+ICKGL+TK P KRLG    G+RD+REH FFR +DWEK+  R+VQPP KPK ++ RD  NFD+EFTK   +LTPTDKLFIMNLDQ EF GFS+ NPE+ V
Sbjct:    1 MAEPANSDGEERSAPMRGFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSLLYGLIHQGMRCDHCMMNIHKRCVANVPSLCGTDHTERRGRIQITAEIKNNVLTVSIKEAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCCLNPTWNETFTFNLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEE-LRQKFERAKIGPSKTDGSSSNAISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLAERKGADELFAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYINGGDLMYHIQQVGKFKEPHAVFYAAEIAIGLFFLHSKGVIYRDLKLDNVMLDAEGHIKIADFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYMDWEKLEHREVQPPFKPKARNSRDTCNFDREFTKMAVELTPTDKLFIMNLDQDEFLGFSYTNPEYEV 666          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcaa (protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GENE-050208-100])

HSP 1 Score: 957.207 bits (2473), Expect = 0.000e+0
Identity = 444/661 (67.17%), Postives = 541/661 (81.85%), Query Frame = 2
Query:   47 QAIEEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSIL-EEKKN-QQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            Q+ E+ ++     F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHELVTF CPG D GPDTD  ++ H FK+HTY SPTFCDHCGSLLYGL+HQG+KC++CD NVHK+C  NVP LCG DHTERRGR+Y+KI     KM+V V E KNL+PMDPNGL+DPYVK+K++P+ ++  KQKTKTI+++LNPTWNE F F +   D  +R+++EVWDWDRT+RNDFMG++SFG+SEL+K PV  W+K+L+ EEGE+Y++P+ D+ +  +  +L+ KFE + L   KKN   + +  + I  +  D  R SDFNF+ VLGKGSFGKV+LAE K +DEL+A+KILKKDV+IQDDDVECTM+EKRVLA Q+KP FL QLHSCFQT+DRLYFVME+VNGGDLMY IQQ GKFKEP AVFYAAEIA+GLFFLH KGIIYRDLKLDN+MLD EGHIKIADFGMCKE I +  TTRTFCGTPDYIAPEII YQPYG+SVDWWAYGV+LYEMLAGQ PFDGEDE+ELF +I EHNVSY K++SKE+VSICKGL+TK P KRLG  + G+RD+REH FFRRIDW+++  R+VQPP KPK+   +   NFD+ FT+   QLTP D+L I N+DQ +F GF+FVNP+F+
Sbjct:    5 QSNEQSSSDVANRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHELVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDSCDMNVHKQCVMNVPSLCGTDHTERRGRLYMKIEVIGDKMHVTVGEGKNLIPMDPNGLSDPYVKLKLIPDPKNETKQKTKTIRSSLNPTWNETFTFKLKPADKDRRLAVEVWDWDRTTRNDFMGSMSFGVSELMKSPVCGWYKMLNQEEGEYYNVPIPDEDDPDT--ELRQKFEIAKLGPPKKNITALDDSGSSITSSNVDNVRLSDFNFLAVLGKGSFGKVMLAEMKSSDELFAIKILKKDVVIQDDDVECTMVEKRVLAQQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHKKGIIYRDLKLDNVMLDAEGHIKIADFGMCKENIVEGVTTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYSKTLSKEAVSICKGLMTKHPSKRLGCGQEGERDIREHAFFRRIDWDRLANREVQPPFKPKVCG-KGAENFDKFFTRTQPQLTPPDELVIANIDQADFDGFTFVNPQFV 662          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcbb (protein kinase C, beta b [Source:NCBI gene;Acc:393953])

HSP 1 Score: 951.814 bits (2459), Expect = 0.000e+0
Identity = 452/665 (67.97%), Postives = 534/665 (80.30%), Query Frame = 2
Query:   38 MSEQAIEEG--NTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKS-ILEEKKNQQITNENNYINQN-KQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEF 2014
            M+E A  +G   ++   GF R+GALRQKNVHE+K+H+F+ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FKVHTY+SPTFCDHCGSLLYGL+HQG++C+ C  N+HK+C  NVP LCG DHTERRGRI +     N  + V + EAKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK  LNPTWNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL KQ VD WFKLLS EEGE++++PV  +    +   L+ KFE++ I   K +   +N  +  + N  +D  + SDFNF++VLGKGSFGKV+LAERKG DEL+A+KILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME++NGGDLMY IQQ GKFKEP AVFYAAEIAIGLFFLHSKG+IYRDLKLDN+MLD EGHIKIADFGMCKE + D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQ PFDGEDE+ELF +I EH+VSYPKSMSKE+V+ICKGL+TK P KRLG    G+RD+REH FFR +DWEK+  R+VQPP KPK    RD  NFD+ FT+    LTP D+  IMNLDQ EF GFSF+NPEF
Sbjct:    1 MAEPANSDGEERSAPMRGFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSLLYGLIHQGMRCDHCMMNIHKRCVANVPSLCGTDHTERRGRIQITAEIKNNVLTVSIKEAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCCLNPTWNETFTFNLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEE-LRQKFERAKIGPSKTDGSSSNAISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLAERKGADELFAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYINGGDLMYHIQQVGKFKEPHAVFYAAEIAIGLFFLHSKGVIYRDLKLDNVMLDAEGHIKIADFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYMDWEKLEHREVQPPFKPKACG-RDAENFDRFFTRHPPVLTPPDQEVIMNLDQDEFEGFSFINPEF 663          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcba (protein kinase C, beta a [Source:ZFIN;Acc:ZDB-GENE-040426-1354])

HSP 1 Score: 927.932 bits (2397), Expect = 0.000e+0
Identity = 437/665 (65.71%), Postives = 523/665 (78.65%), Query Frame = 2
Query:   38 MSEQAIEEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENN----YINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEF 2014
            M+E +  +G   A+ GF R+GALRQKNVHE+KDH+F+ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE V F CPG D GP +D  +  H FKVHTYTSPTFCDHCGSLLYGL+HQG++C  C  N+HK+C K+VP LCG DHTE+RGR++   +     ++V V EA+NLVPMDP+GL+DPYVK+K++P+ +S  KQKTKTIK  LNP WNE F F +   D  +R+ +EVWDWDR +RND+MG++SFGISEL+ Q VD WFK+L+ EEG F+++PV  D    +  +L  +FE++ +    N       N    Y     QD  + +DFNFI+VLGKGSFGKV+LAERKG+DELYAVKILKKDV+IQDDDVECTM+EKRVLAL  KP FL  LHSCFQTMDRLYFVME+++GGDLM++IQQ GKFKEP+AVFYA EIAIGLFFLHSKGIIYRDLKLDN+MLD EGHIKIADFGMCKE +FD  TT+TFCGTPDYIAPEII YQPYGKSVDWWAYGV+LYEMLAGQ PFDGEDE+ELF +I EH+VSYPKSMSKE+V+ICKGL+TK P KRLG    G+RD++EH FFR +DWE++  ++VQPP KPK    RD  NFD  FT+    LTP D   I NLDQ EF GFS+VN +F
Sbjct:    1 MTESSDSDGKEGAR-GFARQGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVHFSCPGSDKGPASDDPRKYHSFKVHTYTSPTFCDHCGSLLYGLIHQGMRCLNCLMNIHKRCFKHVPSLCGTDHTEKRGRLHFSASITGNVLSVSVKEARNLVPMDPSGLSDPYVKLKLIPDPKSESKQKTKTIKGCLNPVWNEDFTFALKDTDKDRRLYVEVWDWDRGTRNDYMGSMSFGISELMNQSVDGWFKILACEEGVFFNVPVYVDEEEGN-KELSKRFERAKIGPGTNNTDGASKNDLSKYDANGNQDRMKLADFNFIMVLGKGSFGKVMLAERKGSDELYAVKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTHLHSCFQTMDRLYFVMEYISGGDLMFQIQQTGKFKEPLAVFYAGEIAIGLFFLHSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENMFDKDTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGLEGERDIKEHAFFRFVDWERLQNKEVQPPYKPK-SCGRDAGNFDLFFTRHPPILTPPDLEVIQNLDQEEFRGFSYVNTKF 662          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcaa (protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GENE-050208-100])

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 424/628 (67.52%), Postives = 515/628 (82.01%), Query Frame = 2
Query:   47 QAIEEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSIL-EEKKN-QQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFT 1918
            Q+ E+ ++     F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHELVTF CPG D GPDTD  ++ H FK+HTY SPTFCDHCGSLLYGL+HQG+KC++CD NVHK+C  NVP LCG DHTERRGR+Y+KI     KM+V V E KNL+PMDPNGL+DPYVK+K++P+ ++  KQKTKTI+++LNPTWNE F F +   D  +R+++EVWDWDRT+RNDFMG++SFG+SEL+K PV  W+K+L+ EEGE+Y++P+ D+ +  +  +L+ KFE + L   KKN   + +  + I  +  D  R SDFNF+ VLGKGSFGKV+LAE K +DEL+A+KILKKDV+IQDDDVECTM+EKRVLA Q+KP FL QLHSCFQT+DRLYFVME+VNGGDLMY IQQ GKFKEP AVFYAAEIA+GLFFLH KGIIYRDLKLDN+MLD EGHIKIADFGMCKE I +  TTRTFCGTPDYIAPEII YQPYG+SVDWWAYGV+LYEMLAGQ PFDGEDE+ELF +I EHNVSY K++SKE+VSICKGL+TK P KRLG  + G+RD+REH FFRRIDW+++  R+VQPP KPK+     V  F Q+++
Sbjct:    5 QSNEQSSSDVANRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHELVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDSCDMNVHKQCVMNVPSLCGTDHTERRGRLYMKIEVIGDKMHVTVGEGKNLIPMDPNGLSDPYVKLKLIPDPKNETKQKTKTIRSSLNPTWNETFTFKLKPADKDRRLAVEVWDWDRTTRNDFMGSMSFGVSELMKSPVCGWYKMLNQEEGEYYNVPIPDEDDPDT--ELRQKFEIAKLGPPKKNITALDDSGSSITSSNVDNVRLSDFNFLAVLGKGSFGKVMLAEMKSSDELFAIKILKKDVVIQDDDVECTMVEKRVLAQQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHKKGIIYRDLKLDNVMLDAEGHIKIADFGMCKENIVEGVTTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYSKTLSKEAVSICKGLMTKHPSKRLGCGQEGERDIREHAFFRRIDWDRLANREVQPPFKPKV-----VRQFLQDYS 625          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcb (protein kinase C beta [Source:NCBI gene;Acc:100038043])

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 442/668 (66.17%), Postives = 532/668 (79.64%), Query Frame = 2
Query:   38 MSEQAIEEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSIL---EEKKNQQITNENNYINQN-KQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVE 2023
            M++ A  E        F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KCETC  NVHK+C  NVP LCG DHTERRGRI++K       + V V +A+NLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNPTWNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL+K  VD WFKLLS EEGE++++PV  +    +   L+ KFE++ +    +   +++ N    ++ N  +D  + SDFNF+ VLGKGSFGKVILAERKGTDELYA+KILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY+IQQ G+FKEP AVFYAAEIAIGL FLHSKGI+YRDLKLDN+MLD EGHIKIADFGMCKE ++D  TT+TFCGTPDYIAPEII YQPY KSVDWWA+G++LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD+++H FFR IDWEK+   ++QPP KPK    R+  NFD+ FT+    LTP D   I N+DQ+EF GFS+VN +F  E
Sbjct:    1 MADPAACEPGEDTTTRFARKGALRQKNVHEVKEHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCETCMMNVHKRCVMNVPSLCGTDHTERRGRIHIKAEIREEVLTVTVGDARNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPTWNESFKFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELLKAGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEE-LRQKFERAKIGPGTKAVEEKVVNPMPKVDNNGTRDRMKVSDFNFLKVLGKGSFGKVILAERKGTDELYAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQVGRFKEPHAVFYAAEIAIGLLFLHSKGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMWDGVTTKTFCGTPDYIAPEIIAYQPYAKSVDWWAFGILLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLERNEIQPPYKPKACG-RNAENFDKFFTRHPPVLTPPDHEVIRNIDQSEFEGFSYVNSDFAKE 666          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcb (protein kinase C beta [Source:NCBI gene;Acc:100038043])

HSP 1 Score: 933.71 bits (2412), Expect = 0.000e+0
Identity = 440/660 (66.67%), Postives = 528/660 (80.00%), Query Frame = 2
Query:   62 GNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSIL---EEKKNQQITNENNYINQN-KQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVE 2023
            G       F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KCETC  NVHK+C  NVP LCG DHTERRGRI++K       + V V +A+NLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNPTWNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL+K  VD WFKLLS EEGE++++PV  +    +   L+ KFE++ +    +   +++ N    ++ N  +D  + SDFNF+ VLGKGSFGKVILAERKGTDELYA+KILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY+IQQ G+FKEP AVFYAAEIAIGL FLHSKGI+YRDLKLDN+MLD EGHIKIADFGMCKE ++D  TT+TFCGTPDYIAPEII YQPY KSVDWWA+G++LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD+++H FFR IDWEK+   ++QPP KPK    R+  NFD+ FT+    LTP D   I N+DQ+EF GFS+VN +F  E
Sbjct:   10 GVADTTTRFARKGALRQKNVHEVKEHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCETCMMNVHKRCVMNVPSLCGTDHTERRGRIHIKAEIREEVLTVTVGDARNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPTWNESFKFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELLKAGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEE-LRQKFERAKIGPGTKAVEEKVVNPMPKVDNNGTRDRMKVSDFNFLKVLGKGSFGKVILAERKGTDELYAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQVGRFKEPHAVFYAAEIAIGLLFLHSKGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMWDGVTTKTFCGTPDYIAPEIIAYQPYAKSVDWWAFGILLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLERNEIQPPYKPKACG-RNAENFDKFFTRHPPVLTPPDHEVIRNIDQSEFEGFSYVNSDFAKE 667          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcb (protein kinase C beta [Source:NCBI gene;Acc:100038043])

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 439/652 (67.33%), Postives = 527/652 (80.83%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSIL---EEKKNQQITNENNYINQN-KQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVE 2023
            F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KCETC  NVHK+C  NVP LCG DHTERRGRI++K       + V V +A+NLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNPTWNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL+K  VD WFKLLS EEGE++++PV  +    +   L+ KFE++ +    +   +++ N    ++ N  +D  + SDFNF+ VLGKGSFGKVILAERKGTDELYA+KILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY+IQQ G+FKEP AVFYAAEIAIGL FLHSKGI+YRDLKLDN+MLD EGHIKIADFGMCKE ++D  TT+TFCGTPDYIAPEII YQPY KSVDWWA+G++LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD+++H FFR IDWEK+   ++QPP KPK    R+  NFD+ FT+    LTP D   I N+DQ+EF GFS+VN +F  E
Sbjct:   14 FARKGALRQKNVHEVKEHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCETCMMNVHKRCVMNVPSLCGTDHTERRGRIHIKAEIREEVLTVTVGDARNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPTWNESFKFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELLKAGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEE-LRQKFERAKIGPGTKAVEEKVVNPMPKVDNNGTRDRMKVSDFNFLKVLGKGSFGKVILAERKGTDELYAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQVGRFKEPHAVFYAAEIAIGLLFLHSKGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMWDGVTTKTFCGTPDYIAPEIIAYQPYAKSVDWWAFGILLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLERNEIQPPYKPKACG-RNAENFDKFFTRHPPVLTPPDHEVIRNIDQSEFEGFSYVNSDFAKE 663          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcb (protein kinase C beta [Source:NCBI gene;Acc:100038043])

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 440/662 (66.47%), Postives = 529/662 (79.91%), Query Frame = 2
Query:   56 EEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSIL---EEKKNQQITNENNYINQN-KQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVE 2023
            E  +      F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KCETC  NVHK+C  NVP LCG DHTERRGRI++K       + V V +A+NLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNPTWNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL+K  VD WFKLLS EEGE++++PV  +    +   L+ KFE++ +    +   +++ N    ++ N  +D  + SDFNF+ VLGKGSFGKVILAERKGTDELYA+KILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY+IQQ G+FKEP AVFYAAEIAIGL FLHSKGI+YRDLKLDN+MLD EGHIKIADFGMCKE ++D  TT+TFCGTPDYIAPEII YQPY KSVDWWA+G++LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD+++H FFR IDWEK+   ++QPP KPK    R+  NFD+ FT+    LTP D   I N+DQ+EF GFS+VN +F  E
Sbjct:    3 ESTDIDTTTRFARKGALRQKNVHEVKEHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCETCMMNVHKRCVMNVPSLCGTDHTERRGRIHIKAEIREEVLTVTVGDARNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPTWNESFKFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELLKAGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEE-LRQKFERAKIGPGTKAVEEKVVNPMPKVDNNGTRDRMKVSDFNFLKVLGKGSFGKVILAERKGTDELYAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQVGRFKEPHAVFYAAEIAIGLLFLHSKGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMWDGVTTKTFCGTPDYIAPEIIAYQPYAKSVDWWAFGILLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLERNEIQPPYKPKACG-RNAENFDKFFTRHPPVLTPPDHEVIRNIDQSEFEGFSYVNSDFAKE 662          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: ddb2 (damage-specific DNA binding protein 2 [Source:Xenbase;Acc:XB-GENE-971828])

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 431/664 (64.91%), Postives = 533/664 (80.27%), Query Frame = 2
Query:   74 AKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKIN-YNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQS-RKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEE-KKNQQIT---NENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV*PYSNP 2044
             K  F R+GALRQK VHE+K H+F ARFFKQ TFC HC DFIWG GKQGFQC++C F VHKRCHE VTF+CPG   GP +D  ++ H FKVH+Y+SPTFCDHCGSLLYG++HQG+KC  C+ NVHK+C +NVP LCG+DHTERRGR+++++   N+ +  V V EA+NL+PMDPNGL+DPYVK+K++P+ ++  KQKT+T+K+TLNP WNE FIF++   D  +R+S+EVWDWDRTSRNDFMG++SFG+SE++K  VD W+KLL+ EEGE+Y++PVADD +      L+ KFE   L +    QQ++    ++  +N         SDFNF++VLGKGSFGKV+LAER+G+DELYA+KILKKDVIIQ+DDVECTM+EKRVLAL ++P FL QLHS FQT+DRLYFVME+VNGGDLMY IQQ GKFKEP A+FYAAEIAIGLFFLH+KGIIYRDLKLDN+MLD EGHIKI DFGMCKE I+   TTRTFCGTPDYIAPEII YQPYGKSVDWW+YGV+LYEMLAGQ PFDGEDE+ELF +I E  VSYPKS+S+E+VSICKGLLTK P KRLGS   G+RD+R+H FFR IDWE++   ++QPP KP+    +   NFD+ FT+    LTP D+L +  +DQ+EF+GF+F+NPEFI     +SNP
Sbjct:   15 VKPLFCRKGALRQKLVHEVKSHKFTARFFKQPTFCSHCTDFIWGIGKQGFQCQVCSFVVHKRCHEFVTFECPGAGKGPHSDDPRSRHKFKVHSYSSPTFCDHCGSLLYGMVHQGMKCACCEMNVHKRCVQNVPSLCGVDHTERRGRLHIRVEAINDEEFQVTVGEARNLIPMDPNGLSDPYVKLKLIPDPKNMTKQKTRTVKSTLNPVWNEAFIFSLKSGDEDRRLSVEVWDWDRTSRNDFMGSMSFGVSEIMKNAVDGWYKLLNQEEGEYYNVPVADDEDDFG---LRQKFEVQALPKCTPGQQLSPSPTDSKRVNFFGTSRFHISDFNFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIIQEDDVECTMVEKRVLALSDRPHFLTQLHSTFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPHAMFYAAEIAIGLFFLHNKGIIYRDLKLDNVMLDSEGHIKITDFGMCKENIYSGATTRTFCGTPDYIAPEIIAYQPYGKSVDWWSYGVLLYEMLAGQPPFDGEDEDELFQSIMEQTVSYPKSLSREAVSICKGLLTKHPLKRLGSGSDGERDIRDHAFFRWIDWERLERLEIQPPFKPRPCG-KSGENFDKFFTRAPPVLTPPDQLVLAGIDQSEFAGFTFINPEFI-----HSNP 669          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcb (protein kinase C, beta [Source:MGI Symbol;Acc:MGI:97596])

HSP 1 Score: 973.385 bits (2515), Expect = 0.000e+0
Identity = 455/656 (69.36%), Postives = 545/656 (83.08%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSIL-------EEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
            F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KC+TC  NVHK+C  NVP LCG DHTERRGRIY++ + +   + V V +AKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNP WNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL K  VD WFKLLS EEGE++++PV  + +  +  +L+ KFE++ +       EEK    I+  +N  N+++  +   +DFNF++VLGKGSFGKV+L+ERKGTDELYAVKILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY IQQ G+FKEP AVFYAAEIAIGLFFL SKGIIYRDLKLDN+MLD EGHIKIADFGMCKE I+D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD++EH FFR IDWEK+  +++QPP KPK +D RD SNFD+EFT++  +LTPTDKLFIMNLDQ EF+GFS+ NPEF++ V
Sbjct:   20 FARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGN-EELRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKL---TDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV 671          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkca (protein kinase C, alpha [Source:MGI Symbol;Acc:MGI:97595])

HSP 1 Score: 966.066 bits (2496), Expect = 0.000e+0
Identity = 447/647 (69.09%), Postives = 538/647 (83.15%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQIT-NENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            F R+GALRQKNVHE+KDH+F+ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GPDTD  ++ H FK+HTY SPTFCDHCGSLLYGL+HQG+KC+TCD NVHK+C  NVP LCGMDHTE+RGRIYLK    + K++V V +AKNL+PMDPNGL+DPYVK+K++P+ ++  KQKTKTI++TLNP WNE F F +   D  +R+S+E+WDWDRT+RNDFMG+LSFG+SEL+K P   W+KLL+ EEGE+Y++P+ +     ++ +L+ KFEK+ L    N+ I+ +E+     N  D  + +DFNF++VLGKGSFGKV+LA+RKGT+ELYA+KILKKDV+IQDDDVECTM+EKRVLAL +KP FL QLHSCFQT+DRLYFVME+VNGGDLMY IQQ GKFKEP AVFYAAEI+IGLFFLH +GIIYRDLKLDN+MLD EGHIKIADFGMCKE + D  TTRTFCGTPDYIAPEII YQPYGKSVDWWAYGV+LYEMLAGQ PFDGEDE+ELF +I EHNVSYPKS+SKE+VSICKGL+TK P KRLG    G+RDVREH FFRRIDWEK+  R++QPP KPK+   +   NFD+ FT+    LTP D+L I N+DQ++F GFS+VNP+F+
Sbjct:   20 FARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNM-ELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCG-KGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFV 664          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcb (protein kinase C, beta [Source:MGI Symbol;Acc:MGI:97596])

HSP 1 Score: 939.488 bits (2427), Expect = 0.000e+0
Identity = 445/653 (68.15%), Postives = 533/653 (81.62%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSIL-------EEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KC+TC  NVHK+C  NVP LCG DHTERRGRIY++ + +   + V V +AKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNP WNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL K  VD WFKLLS EEGE++++PV  + +  +  +L+ KFE++ +       EEK    I+  +N  N+++  +   +DFNF++VLGKGSFGKV+L+ERKGTDELYAVKILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY IQQ G+FKEP AVFYAAEIAIGLFFL SKGIIYRDLKLDN+MLD EGHIKIADFGMCKE I+D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD++EH FFR IDWEK+  +++QPP KPK    R+  NFD+ FT+    LTP D+  I N+DQ+EF GFSFVN EF+
Sbjct:   20 FARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGN-EELRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKL---TDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACG-RNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFL 667          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcb (protein kinase C, beta [Source:MGI Symbol;Acc:MGI:97596])

HSP 1 Score: 939.488 bits (2427), Expect = 0.000e+0
Identity = 445/653 (68.15%), Postives = 533/653 (81.62%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSIL-------EEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KC+TC  NVHK+C  NVP LCG DHTERRGRIY++ + +   + V V +AKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNP WNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL K  VD WFKLLS EEGE++++PV  + +  +  +L+ KFE++ +       EEK    I+  +N  N+++  +   +DFNF++VLGKGSFGKV+L+ERKGTDELYAVKILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY IQQ G+FKEP AVFYAAEIAIGLFFL SKGIIYRDLKLDN+MLD EGHIKIADFGMCKE I+D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD++EH FFR IDWEK+  +++QPP KPK    R+  NFD+ FT+    LTP D+  I N+DQ+EF GFSFVN EF+
Sbjct:   20 FARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGN-EELRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKL---TDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACG-RNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFL 667          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcg (Protein kinase C gamma type [Source:UniProtKB/Swiss-Prot;Acc:P63318])

HSP 1 Score: 855.514 bits (2209), Expect = 0.000e+0
Identity = 410/664 (61.75%), Postives = 513/664 (77.26%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDFKTN-HDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINY-NNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQS-RKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKA-KFEKSILEEKKNQQITNENNYINQNKQDIPRA-----------SDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPS-----FLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            F R+GALRQK VHE+K H+F ARFFKQ TFC HC DFIWG GKQG QC++C F VH+RCHE VTF+CPG   GP TD   N H F++H+Y+SPTFCDHCGSLLYGL+HQG+KC  C+ NVH++C ++VP LCG+DHTERRGR+ L+I    + ++++ V EA+NL+PMDPNGL+DPYVK+K++P+ ++  KQKTKT+KATLNP WNE F+F +   D  +R+S+EVWDWDRTSRNDFMGA+SFG+SEL+K PVD W+KLL+ EEGE+Y++PVAD  N + +   +A  +   + E  +    ++     + +  D  R            SDF+F++VLGKGSFGKV+LAER+G+DELYA+KILKKDVI+QDDDV+CT++EKRVLAL  +       FL QLHS FQT DRLYFVME+V GGDLMY IQQ GKFKEP A FYAAEIAIGLFFLH++GIIYRDLKLDN+MLD EGHIKI DFGMCKE +F   TTRTFCGTPDYIAPEII YQPYGKSVDWW++GV+LYEMLAGQ PFDGEDEEELF AI E  V+YPKS+S+E+V+ICKG LTK P KRLGS   G+  +R H FFR IDWE++   ++ PP +P+    R   NFD+ FT+    LTP D+L + ++DQ +F GF++VNP+F+
Sbjct:   19 FCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHITVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTKTVKATLNPVWNETFVFNLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGSTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPRPCG-RSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFV 681          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|Q16974|KPC1_APLCA (Calcium-dependent protein kinase C OS=Aplysia californica OX=6500 GN=PRKC1 PE=1 SV=2)

HSP 1 Score: 1009.98 bits (2610), Expect = 0.000e+0
Identity = 477/647 (73.72%), Postives = 547/647 (84.54%), Query Frame = 2
Query:   89 TRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPED-QSRKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
             RRGALRQKNVHE+K+H+F+ARFFKQ TFC HCKDFIWGFGKQGFQC++C   VHKRCHE V F CPG D GPD+D    H FK+H+Y SPTFCDHCGSLLYGLLHQGLKC++CD NVHK+CEKNVP LCG DHTERRGRI +K      K+ VE+LEAKNL PMDPNGLADPYVK+K++P D    K KTKTIKA+LNP WNE F   I  ED +KR+S+EVWDWDRTSRNDFMG+LSFGISEL+K PV+ WFKLL+ EEGEFY +PV DD+   S+ ++K+K  +S +  +K  +    +   N +KQDI RASDFNF+ VLGKGSFGKV+LAERKGTDELYA+KILKKDVIIQDDDVECTMIEKRVLAL +KP FLVQLHSCFQTMDRLYFVME+VNGGDLMYRIQQEGKFKEPVA FYAAEIAIGLF+LH++GI+YRDLKLDN+MLD EGHIKIADFGMCKE I  DKTTRTFCGTPDYIAPEI+ YQPYG+SVDWWAYGV+LYEMLAGQ PFDGEDEEELF +IT+HNVSYPK++S+E+VS+CKGLLTK P KRLG    G+RD+++  FFR I WE+I  R+VQPP KP+IK  +DVSNFD+EFT E   +TPTDKLFIMNLDQ EFSGFS+VNPEF+V V
Sbjct:    6 ARRGALRQKNVHEVKNHKFLARFFKQPTFCSHCKDFIWGFGKQGFQCQVCSLVVHKRCHEFVCFICPGADKGPDSDATNLHKFKLHSYGSPTFCDHCGSLLYGLLHQGLKCDSCDMNVHKRCEKNVPLLCGTDHTERRGRILIKGAVKGSKVLVEILEAKNLCPMDPNGLADPYVKVKLIPYDAHKLKLKTKTIKASLNPVWNESFTVDIGPEDNSKRLSLEVWDWDRTSRNDFMGSLSFGISELIKSPVEGWFKLLNQEEGEFYGVPVTDDIT-ESIQEIKSKMHRSSISSEK--RYPEPDKVQNMSKQDIVRASDFNFLTVLGKGSFGKVVLAERKGTDELYAIKILKKDVIIQDDDVECTMIEKRVLALPDKPPFLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAAFYAAEIAIGLFYLHTQGIVYRDLKLDNVMLDAEGHIKIADFGMCKENIMGDKTTRTFCGTPDYIAPEIVLYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEEELFTSITDHNVSYPKALSREAVSLCKGLLTKTPAKRLGCGPNGERDIKDRAFFRPIQWERIELREVQPPYKPRIKSRKDVSNFDREFTSEAPNVTPTDKLFIMNLDQCEFSGFSYVNPEFVVTV 649          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|P05771|KPCB_HUMAN (Protein kinase C beta type OS=Homo sapiens OX=9606 GN=PRKCB PE=1 SV=4)

HSP 1 Score: 976.467 bits (2523), Expect = 0.000e+0
Identity = 455/656 (69.36%), Postives = 546/656 (83.23%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKS-------ILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
            F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KC+TC  NVHK+C  NVP LCG DHTERRGRIY++ + +   + V V +AKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNP WNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL K  VD WFKLLS EEGE++++PV  + + A+  +L+ KFE++       + EEK    ++  +N  N+++  +   +DFNF++VLGKGSFGKV+L+ERKGTDELYAVKILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY IQQ G+FKEP AVFYAAEIAIGLFFL SKGIIYRDLKLDN+MLD EGHIKIADFGMCKE I+D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD++EH FFR IDWEK+  +++QPP KPK +D RD SNFD+EFT++  +LTPTDKLFIMNLDQ EF+GFS+ NPEF++ V
Sbjct:   20 FARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEAN-EELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKL---TDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV 671          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|P05772|KPCB_RABIT (Protein kinase C beta type OS=Oryctolagus cuniculus OX=9986 GN=PRKCB PE=2 SV=3)

HSP 1 Score: 975.311 bits (2520), Expect = 0.000e+0
Identity = 458/669 (68.46%), Postives = 549/669 (82.06%), Query Frame = 2
Query:   47 QAIEEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSIL-------EEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
            Q   EG  S    F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KC+TC  NVHK+C  NVP LCG DHTERRGRIY++ + +   + V V +AKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNP WNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL K  VD WFKLLS EEGE++++PV  + +  +  +L+ KFE++ +       EEK    I+  +N  N+++  +   +DFNF++VLGKGSFGKV+L+ERKGTDELYAVKILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY IQQ G+FKEP AVFYAAEIAIGLFFL SKGIIYRDLKLDN+MLD EGHIKIADFGMCKE I+D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD+++H FFR IDWEK+  +++QPP KPK +D RD SNFD+EFT++  +LTPTDKLFIMNLDQ EF+GFS+ NPEF++ V
Sbjct:    8 QPPSEGEEST-VRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGN-EELRQKFERAKIGQGTKTPEEKTTNTISKFDNNGNRDRMKL---TDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV 671          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|P68403|KPCB_RAT (Protein kinase C beta type OS=Rattus norvegicus OX=10116 GN=Prkcb PE=1 SV=3)

HSP 1 Score: 973.385 bits (2515), Expect = 0.000e+0
Identity = 455/656 (69.36%), Postives = 545/656 (83.08%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSIL-------EEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
            F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KC+TC  NVHK+C  NVP LCG DHTERRGRIY++ + +   + V V +AKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNP WNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL K  VD WFKLLS EEGE++++PV  + +  +  +L+ KFE++ +       EEK    I+  +N  N+++  +   +DFNF++VLGKGSFGKV+L+ERKGTDELYAVKILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY IQQ G+FKEP AVFYAAEIAIGLFFL SKGIIYRDLKLDN+MLD EGHIKIADFGMCKE I+D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD++EH FFR IDWEK+  +++QPP KPK +D RD SNFD+EFT++  +LTPTDKLFIMNLDQ EF+GFS+ NPEF++ V
Sbjct:   20 FARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGN-EELRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKL---TDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV 671          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|P68404|KPCB_MOUSE (Protein kinase C beta type OS=Mus musculus OX=10090 GN=Prkcb PE=1 SV=4)

HSP 1 Score: 973.385 bits (2515), Expect = 0.000e+0
Identity = 455/656 (69.36%), Postives = 545/656 (83.08%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSIL-------EEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
            F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KC+TC  NVHK+C  NVP LCG DHTERRGRIY++ + +   + V V +AKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNP WNE F F + + D  +R+S+E+WDWD TSRNDFMG+LSFGISEL K  VD WFKLLS EEGE++++PV  + +  +  +L+ KFE++ +       EEK    I+  +N  N+++  +   +DFNF++VLGKGSFGKV+L+ERKGTDELYAVKILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME+VNGGDLMY IQQ G+FKEP AVFYAAEIAIGLFFL SKGIIYRDLKLDN+MLD EGHIKIADFGMCKE I+D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQAPF+GEDE+ELF +I EHNV+YPKSMSKE+V+ICKGL+TK P KRLG    G+RD++EH FFR IDWEK+  +++QPP KPK +D RD SNFD+EFT++  +LTPTDKLFIMNLDQ EF+GFS+ NPEF++ V
Sbjct:   20 FARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGN-EELRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKL---TDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV 671          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A267G679 (Protein kinase C OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019218g1 PE=3 SV=1)

HSP 1 Score: 1075.85 bits (2781), Expect = 0.000e+0
Identity = 498/648 (76.85%), Postives = 568/648 (87.65%), Query Frame = 2
Query:   83 GFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSRKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
             F RRGALRQKNVHE+K+H+FVARFFKQ TFCGHC DFIWGFGKQGFQCK+C FAVHKRCHELVTF CPG D GPDTDF  NH F+V +YTSPTFCDHCGSLLYGL HQGLKCE CD NVHK+CEKNVP LCG+DHTERRGR+ LKI     K++VEV+E KNLVPMDPNGLADPYVK+K++P+D + K+KT+ IKATLNP WNEK +F + KEDF KR+SIEVWDWDRTSRNDFMGA+SFGISELVK PV  WFKLL+ EEGEFY+IP  D++  A+V +L+ KFEK+  +EK+ +            KQDIPR++DFNF+++LGKGSFGKV+LAERKGT E+YA+KILKKDVIIQDDD+ECTMIEKRVLAL EKP FLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEG+FKEPVA FYAAEIAIGLFFLH+KGIIYRDLKLDN++LD EGHIKIADFGMCKE IFD  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQ PFDGEDEEELF AIT+HNVSYPK MSKE+V+ICKG LTKD KKRLG +  G+R++R+H+FFRRIDW+++ +R VQPP KP+IK  RDVSNFD++FT E A+LTPTDKLFIMNLDQTEF+GFS+VNPEFIV+V
Sbjct:   14 AFARRGALRQKNVHEVKNHKFVARFFKQPTFCGHCTDFIWGFGKQGFQCKVCSFAVHKRCHELVTFACPGADHGPDTDFHNNHKFRVTSYTSPTFCDHCGSLLYGLFHQGLKCECCDMNVHKRCEKNVPMLCGIDHTERRGRLDLKIRSEANKLHVEVIEGKNLVPMDPNGLADPYVKLKLLPDDSNSKKKTRVIKATLNPVWNEKLVFDLRKEDFGKRLSIEVWDWDRTSRNDFMGAMSFGISELVKAPVTGWFKLLNQEEGEFYNIPCPDEI-TANVQELRTKFEKARADEKEEKAKLAAAQGGQAVKQDIPRSTDFNFLMLLGKGSFGKVLLAERKGTTEIYAIKILKKDVIIQDDDIECTMIEKRVLALAEKPPFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGRFKEPVAAFYAAEIAIGLFFLHTKGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIFDGDTTKTFCGTPDYIAPEIILYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEELFTAITDHNVSYPKVMSKEAVTICKGFLTKDTKKRLGCSPAGEREIRDHVFFRRIDWDRVASRDVQPPFKPRIKSARDVSNFDRQFTDEAAKLTPTDKLFIMNLDQTEFTGFSYVNPEFIVDV 660          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A267GSY1 (Protein kinase C OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032341g1 PE=3 SV=1)

HSP 1 Score: 1048.11 bits (2709), Expect = 0.000e+0
Identity = 488/647 (75.43%), Postives = 560/647 (86.55%), Query Frame = 2
Query:   89 TRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSRKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQP-VDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
             R+GALRQKN HEIKDH+FVARFFKQ TFCGHC DFIWGFGKQGFQCKIC FAVHKRCHELVTF CPG D GPDTDF+ +H FKV +YTSPTFCDHCGSLLYGL HQGLKCE+CD NVHK+C+ NVPKLCG+DHTERRGRI L I     K+ VEV+E KNLVPMDPNGLADPYVK+K+ P D + KQKTK +KATLNP WNEKF+F + KED  KR+S+EVWDWDRTSRNDFMGALSFG+ ELVK   V+ WFKLL+ EEGEFY+IP  D+   A V +LK KF+K+  EEK+ +  +    ++ +NKQDIP++SDFNF++VLGKGSFGKV+LAER+GT E+YAVKILKKDVIIQDDD+ECTM EKRVLAL +KPSFLVQ+HSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVA FYA EIA+GLFFLHSKGI+YRDLKLDN++LD+EGHIKIADFGMCKE +F+  TTRTFCGTPDYIAPEII +QPYGKSVDWWA+GV++YEMLAGQ PFDGEDEEELF +IT+  VSYPK MSKE+VS+ +GLLT+DPKKRLG    G+R++REH+FFRRIDW ++  R+VQPP  P I   +DVSNFD++FT E A+LTPTDKLFIMNLDQTEFSGFS+VNPEFIVEV
Sbjct:   16 ARKGALRQKNEHEIKDHKFVARFFKQPTFCGHCTDFIWGFGKQGFQCKICSFAVHKRCHELVTFACPGADKGPDTDFQNDHKFKVTSYTSPTFCDHCGSLLYGLFHQGLKCESCDINVHKRCQNNVPKLCGVDHTERRGRINLSIRCQGKKLQVEVMEGKNLVPMDPNGLADPYVKLKLSPGDVNAKQKTKVVKATLNPNWNEKFLFDLRKEDQGKRLSLEVWDWDRTSRNDFMGALSFGVGELVKATTVNGWFKLLNQEEGEFYNIPCTDE-TAADVQELKNKFQKARAEEKEER--SKNAQFVQKNKQDIPKSSDFNFLMVLGKGSFGKVLLAERRGTSEIYAVKILKKDVIIQDDDMECTMTEKRVLALPQKPSFLVQMHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAAFYAVEIAVGLFFLHSKGILYRDLKLDNVLLDNEGHIKIADFGMCKENVFEGSTTRTFCGTPDYIAPEIINHQPYGKSVDWWAFGVLIYEMLAGQPPFDGEDEEELFASITDQTVSYPKIMSKEAVSLIRGLLTRDPKKRLGCTPDGEREIREHVFFRRIDWNRVENREVQPPYLPTITSDKDVSNFDRQFTDEAAKLTPTDKLFIMNLDQTEFSGFSYVNPEFIVEV 659          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A2R2MN12 (Protein kinase C OS=Lingula unguis OX=7574 GN=LOC106160836 PE=3 SV=1)

HSP 1 Score: 1034.25 bits (2673), Expect = 0.000e+0
Identity = 494/667 (74.06%), Postives = 573/667 (85.91%), Query Frame = 2
Query:   50 AIEEGNTS--AKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-----KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
            A E G +S  A  G  R+GALRQKNV  +KDH FV RFFKQ TFC HCKDFIWGFGKQGFQC +C F VHKRCHE V+FQCPG D GPD+D  +  H FK+HTY SPTFCDHCGSLLYGLLHQGLKC+ C+ NVHK+C+KNVPKLCG+DHTERRGR++ K+   NG + VEV EAKNL+PMDPNGLADPYVK+K++P++ S+     K+KTKT+K++LNP WNE F F +  +D+AKR+ +E+WDWDRTSRNDFMGA+SFGISE+ K P + WFKLL+ EEGEFYSIPV D+L V  V +L+ K E+S L+E+K+ Q+      I QNKQDIPRASDFNF++VLGKGSFGKV+LAERKGTDELYA+KILKKDVIIQDDDVECTMIEKRVLA+  KP FLVQLHSCFQTMDRLYFVME+VNGGDLM+RIQQEGKFKEPVAVFYAAEIAIGLF+LH KG++YRDLKLDN++LD EGHIKIADFGMCK+ + +DK TRTFCGTPDYIAPEI+ YQPYGK+VDWWAYGV+LYEMLAGQ PFDGEDEEELF AIT+H+V+YP+SMSKESVSICKG LTK+P KRLG    G+R+V+EH F+R IDWEKI  R+VQPP KPKIK  +DVSNFD+EFTKETA+LTPTDKLFIMNLDQTEF+GFSFVNPEFIV+V
Sbjct:    2 ADETGGSSNFASRGVQRKGALRQKNVFVVKDHNFVPRFFKQPTFCSHCKDFIWGFGKQGFQCNVCSFVVHKRCHEYVSFQCPGADHGPDSDKTQKRHRFKLHTYGSPTFCDHCGSLLYGLLHQGLKCDACEMNVHKRCQKNVPKLCGIDHTERRGRVHCKVVVENGILRVEVREAKNLIPMDPNGLADPYVKLKLIPDEDSKHDKGNKKKTKTVKSSLNPQWNETFTFKLRDDDYAKRLCVELWDWDRTSRNDFMGAMSFGISEVAKAPAEGWFKLLNQEEGEFYSIPVPDELGV-HVQELRKKLERSRLDEQKDFQLPE----IPQNKQDIPRASDFNFLMVLGKGSFGKVMLAERKGTDELYAIKILKKDVIIQDDDVECTMIEKRVLAMASKPPFLVQLHSCFQTMDRLYFVMEYVNGGDLMFRIQQEGKFKEPVAVFYAAEIAIGLFYLHGKGVVYRDLKLDNVLLDCEGHIKIADFGMCKDNMLNDKMTRTFCGTPDYIAPEIVLYQPYGKTVDWWAYGVLLYEMLAGQPPFDGEDEEELFTAITDHSVTYPRSMSKESVSICKGFLTKNPAKRLGCGANGEREVKEHPFYRFIDWEKIINREVQPPYKPKIKAKKDVSNFDKEFTKETAKLTPTDKLFIMNLDQTEFAGFSFVNPEFIVKV 663          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A210QM38 (Protein kinase C OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05705 PE=3 SV=1)

HSP 1 Score: 1031.55 bits (2666), Expect = 0.000e+0
Identity = 481/650 (74.00%), Postives = 551/650 (84.77%), Query Frame = 2
Query:   83 GFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR--KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
            G  RRGALRQKNVHE+KDH+FV RFFKQ TFC HCKDFIWGFGKQGFQCK+C F VHKRCHE V+F CPG D GPD+D    H FK+HTY SPTFCDHCGSLLYGL+HQGLKC+ CD NVHK+C+KNVP+LCGMDHTERRGRIY+K+N    KM + V EA+NL+PMDPNGLADPYVK+K++P + S+  KQKTKT KATLNP WNE F   +  ED +KR+S E+WDWDRTSRNDFMG+LSFGISEL+K+ +D WFKLLS EEGEFY IPV DD+ V  + ++  K EK ++E+     +    N    +K D  R +DFNF+ VLGKGSFGKV+LAERKGTDELYA+KILKKDVIIQDDDVECTMIEKRVLAL  KP FLVQLHSCFQTMDRLYFVME+VNGGDLMYRIQQEGKFKEP+AVFYAAEIAIGLF+LH +GIIYRDLKLDN+MLD +GHIKIADFGMCKE I  +KTTRTFCGTPDYIAPEI+ YQPYGKSVDWWAYGV+LYEMLAGQ PFDGEDEEELF +IT+HNVSYPKSMSKE+VS+CK LLTK+P KRLG    G+RD+++H FF+R+ W+KI +R VQPP KPKIK  +DVSNFD+EFT E  ++TPTDKLFIMNLDQTEF+GFSFVNPE+IV V
Sbjct:    8 GVHRRGALRQKNVHEVKDHKFVPRFFKQPTFCSHCKDFIWGFGKQGFQCKVCSFVVHKRCHEFVSFTCPGADVGPDSDSTNAHKFKLHTYGSPTFCDHCGSLLYGLIHQGLKCDACDMNVHKRCDKNVPQLCGMDHTERRGRIYIKVNMEGQKMVIMVREARNLIPMDPNGLADPYVKVKVIPVESSKGGKQKTKTQKATLNPVWNESFGIELLPEDQSKRLSFEIWDWDRTSRNDFMGSLSFGISELMKESIDGWFKLLSQEEGEFYGIPVTDDV-VNDMLEINKKMEKPMMEKDVLPHVDISKN---MSKHDTVRQTDFNFLTVLGKGSFGKVVLAERKGTDELYAIKILKKDVIIQDDDVECTMIEKRVLALPNKPPFLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPIAVFYAAEIAIGLFYLHKQGIIYRDLKLDNVMLDADGHIKIADFGMCKENILGEKTTRTFCGTPDYIAPEIVLYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEEELFTSITDHNVSYPKSMSKEAVSLCKALLTKNPSKRLGCGANGERDIQDHSFFKRVVWDKIQSRNVQPPYKPKIKTKKDVSNFDREFTSEALKMTPTDKLFIMNLDQTEFTGFSFVNPEYIVTV 653          
BLAST of Protein kinase C vs. TrEMBL
Match: V4B6K8 (Protein kinase C OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_211133 PE=3 SV=1)

HSP 1 Score: 1030.78 bits (2664), Expect = 0.000e+0
Identity = 484/658 (73.56%), Postives = 553/658 (84.04%), Query Frame = 2
Query:   56 EEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
            EE   +A  G  RRG  R KNV E+KDH+FV RFFKQ TFC HCKDFIWGFGKQGFQC++C F VHKRCHE V+FQCPG D GPD+D    H FKVH+Y SPTFCDHCGSLLYGLLHQGLKC+ CD NVHK+CEK+VPKLCG+D TERRGRIYL I     K+ VEV E KNL PMDPNGLADPY KIK+VP+D  + K+KTKTIKA+LNP W E F F +S ED +KR+S EVWDWDRTSRNDFMG+LSFG+SE++K PVD WFKLL+ EEGEFY IPV D++   ++ +L+++ +K+ ++E+K Q   N  N    +KQDI RASDFNF+ VLGKGSFGKV+LAERKGTDELYA+KILKKDVIIQDDDVECTMIEKRVLAL  KP FLVQLHSCFQTMDRLYFVME+VNGGDLMYRIQQEGKFKEP+A FYAAEIAIGLF+LHS+GI+YRDLKLDN+MLD EGHIKIADFGMCKEG+F +K TRTFCGTPDYIAPEI+ YQPY KSVDWWAYGV+LYEMLAGQ PFDGEDEEELF +IT+HNVSY KSMSKE+VSICKGLL K+P KRLG    G+RD+++H FFRRI W  +  + VQPP KPKIK  +DVSNFD+EFT E  ++TPTDKLFIMNLDQTEFSGFS+VNPEF+V V
Sbjct:    3 EESAPNAFKGVQRRGGFRHKNVFEVKDHKFVPRFFKQPTFCSHCKDFIWGFGKQGFQCQVCSFVVHKRCHEFVSFQCPGVDQGPDSDATNLHKFKVHSYGSPTFCDHCGSLLYGLLHQGLKCDACDMNVHKRCEKHVPKLCGIDFTERRGRIYLIIKPQGNKLVVEVREGKNLCPMDPNGLADPYCKIKLVPDDSHKSKRKTKTIKASLNPCWQETFTFDLSPEDHSKRISFEVWDWDRTSRNDFMGSLSFGVSEVIKNPVDGWFKLLNQEEGEFYGIPVTDEV-TPTIQELRSRMQKTDIQERKIQPPDNAQNI---SKQDIVRASDFNFLTVLGKGSFGKVVLAERKGTDELYAIKILKKDVIIQDDDVECTMIEKRVLALANKPPFLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPIAAFYAAEIAIGLFYLHSQGIVYRDLKLDNVMLDSEGHIKIADFGMCKEGMFGEKLTRTFCGTPDYIAPEIVLYQPYSKSVDWWAYGVLLYEMLAGQPPFDGEDEEELFTSITDHNVSYAKSMSKEAVSICKGLLNKNPAKRLGCGANGERDIKDHAFFRRIHWINMETKDVQPPYKPKIKSRKDVSNFDREFTSEAPKMTPTDKLFIMNLDQTEFSGFSYVNPEFVVTV 656          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcba (protein kinase C beta [Source:NCBI gene;Acc:103036012])

HSP 1 Score: 947.192 bits (2447), Expect = 0.000e+0
Identity = 446/653 (68.30%), Postives = 530/653 (81.16%), Query Frame = 2
Query:   83 GFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKS-ILEEKKNQQITNENN---YINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVE 2023
            GF R+GALRQKNVHE+KDH+F+ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FKVHTY+SPTFCDHCGSLLYGL+HQG+KC+ C  N+HK+C  NVP LCG DHTERRGR+++  +   G + V + + +NLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK +LNPT+NE F F + + D  +R+S+EVWDWD TSRNDFMG+LSFGISEL K+ V  W+KLL  EEGE++++PV  D    +  +L+ KFE++ I    KN   ++ N+   Y     QD  + SDFNF++VLGKGSFGKV+LAERKGTDELYAVKILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME++NGGDLMY+IQQ GKFKEP AVFYAAEIAIGLFFLHSKGIIYRDLKLDN+MLD EGHIKIADFGMCKE + D  TT+TFCGTPDYIAPEII YQPYGKSVDWWAYGV+LYEMLAGQ PFDGEDE+ELF +I EH+VSYPKSMSKE+V+ICKGL+TK P KRLG    G+RD++EH FFR +DWEK+  ++VQPP KPK    RD  NFD+ FT+    LTP D+  I+NLDQ EF GFS+VNPE+  +
Sbjct:   18 GFARQGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSLLYGLIHQGMKCDNCMMNIHKRCVTNVPSLCGTDHTERRGRLHISADIKEGTLTVTIGDGRNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPTFNETFTFHLRETDNNRRLSVEVWDWDLTSRNDFMGSLSFGISELQKKGVSGWYKLLGQEEGEYFNVPVQPDGEEGN-DELRQKFERARIGPGNKNTDSSSSNDISKYDANGNQDRVKLSDFNFVMVLGKGSFGKVMLAERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYINGGDLMYQIQQVGKFKEPHAVFYAAEIAIGLFFLHSKGIIYRDLKLDNVMLDAEGHIKIADFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYMDWEKLQNKEVQPPFKPKACG-RDAENFDRFFTRHPPVLTPPDQEVILNLDQEEFQGFSYVNPEYAAQ 668          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcbb (protein kinase C beta type [Source:NCBI gene;Acc:103025973])

HSP 1 Score: 945.651 bits (2443), Expect = 0.000e+0
Identity = 446/671 (66.47%), Postives = 535/671 (79.73%), Query Frame = 2
Query:   47 QAIEEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNEN---NYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV*PYSNP 2044
            Q+  +G   A+ GF R+GALRQKNVHE+K+H+F+ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FKVHTY+SPTFCDHCGSLLYGL+HQG++C+ C  N+HK+C  NVP LCG DHTERRGRI +  +  N  + V + EAKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK  LNPTWNE F F +   D  +R+S+E+WDWD TSRNDFMG+LSFGISEL KQ VD WFKLLS EEGE++++PV  +    +   L+ KFE++ +        ++ N    + +   +D  + SDFNF++VLGKGSFGKV+LAERKGTDEL+A+K+LKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME++NGGDLMY+IQQ GKFKEP AVFY+AEIAIGLFFLH+KGIIYRDLKLDN+MLD EGHIKIADFGMCKE + +  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQ PFDGEDE+ELF +I EH+VSYPKSMSKE+V+ICKGL+TK P KRLG    G+RD+REH FFR +DWEK+  ++VQPP KPK    RD  NFD+ FT+    LTP D+  IMNLDQ EF GFSF+NPE+     P + P
Sbjct:    6 QSGSDGEQRAR-GFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSLLYGLIHQGMRCDHCMMNIHKRCVANVPSLCGTDHTERRGRIQITADIKNNALTVSIKEAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCCLNPTWNETFTFNLKDADKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEE-LRQKFERAKIGAGTKNTDSSSNAISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLAERKGTDELFAIKVLKKDVVIQDDDVECTMVEKRVLALAGKPPFLTQLHSCFQTMDRLYFVMEYINGGDLMYQIQQVGKFKEPHAVFYSAEIAIGLFFLHTKGIIYRDLKLDNVMLDAEGHIKIADFGMCKENMSEGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYMDWEKLENKEVQPPFKPKACG-RDAENFDRFFTRHPPVLTPPDQEVIMNLDQDEFEGFSFINPEYPAMETPTTPP 673          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcbb (protein kinase C beta type [Source:NCBI gene;Acc:103025973])

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 433/663 (65.31%), Postives = 519/663 (78.28%), Query Frame = 2
Query:   47 QAIEEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNEN---NYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIV 2020
            Q+  +G   A+ GF R+GALRQKNVHE+K+H+F+ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FKVHTY+SPTFCDHCGSLLYGL+HQG++C+ C  N+HK+C  NVP LCG DHTERRGRI +  +  N  + V + EAKNLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK  LNPTWNE F F +   D  +R+S+E+WDWD TSRNDFMG+LSFGISEL KQ VD WFKLLS EEGE++++PV  +    +   L+ KFE++ +        ++ N    + +   +D  + SDFNF++VLGKGSFGKV+LAERKGTDEL+A+K+LKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQTMDRLYFVME++NGGDLMY+IQQ GKFKEP AV                     DLKLDN+MLD EGHIKIADFGMCKE + +  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQ PFDGEDE+ELF +I EH+VSYPKSMSKE+V+ICKGL+TK P KRLG    G+RD+REH FFR +DWEK+  ++VQPP KPK K+ RD SNFD+EFTK   +LTPTDKLFIMNLDQ EF GFS+ NPE+I 
Sbjct:    6 QSGSDGEQRAR-GFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSLLYGLIHQGMRCDHCMMNIHKRCVANVPSLCGTDHTERRGRIQITADIKNNALTVSIKEAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCCLNPTWNETFTFNLKDADKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEE-LRQKFERAKIGAGTKNTDSSSNAISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLAERKGTDELFAIKVLKKDVVIQDDDVECTMVEKRVLALAGKPPFLTQLHSCFQTMDRLYFVMEYINGGDLMYQIQQVGKFKEPHAV---------------------DLKLDNVMLDAEGHIKIADFGMCKENMSEGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYMDWEKLENKEVQPPFKPKAKNSRDTSNFDREFTKMPTELTPTDKLFIMNLDQDEFLGFSYTNPEYIA 645          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcaa (protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GENE-050208-100])

HSP 1 Score: 869.766 bits (2246), Expect = 0.000e+0
Identity = 411/649 (63.33%), Postives = 514/649 (79.20%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVA--DDLNVASVADLKAKFEKSILEEKK---NQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEF 2014
            F R+GALRQKNVHE+KDH+F+ARFFKQ TF G  +  + G            FA   R +  V+           TD ++ H FK+HTY SPTFCDHCGSLLYGL+HQG+KC+TCD NVHK+C  NVP LCG DHTERRGRI+LKI  +  +++V V EA+NL+PMDPNGL+DPYVK+K++P+ ++  K+KT+TI+++LNPTWNE F F +  +D  +R+S+E+WDWDRT+RNDFMGA+SFG+SEL+K P   W+K+L+ EEGE+Y++P++  DD N     +L+ KFEK+ L   K      + ++ + +  +  D  +  DFNF+ VLGKGSFGKV+LAE K ++ELYA+KILKKDV+IQDDDVECTM+EKRVLA Q+KP FL QLHSCFQT+DRLYFVME+VNGGDLMY IQQ GKFKEP AVFYAAEIA+GLFFLH KG+IYRDLKLDN+MLD EGHIKIADFGMCKE IF+  TTRTFCGTPDYIAPEII YQPYG+SVDWWAYGV+LYEMLAGQ PFDGEDE+ELF +I EHNVSYPK++SKE+VSICKGL+TK P KRLG ++ G+RD+REH FFRRIDWE++  R+VQPP KPK+   ++  NFD+ FT+   QLTP+D+L I N+DQ +F+GFSF+NP+F
Sbjct:   16 FARKGALRQKNVHEVKDHKFIARFFKQPTFLGAGRAKLRG-----------EFAASWRQNAEVS-----------TDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVLNVPSLCGTDHTERRGRIFLKIEVSGEELHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPKNETKKKTRTIRSSLNPTWNESFKFKLRAQDKDRRLSVEIWDWDRTTRNDFMGAMSFGVSELIKAPASGWYKMLNQEEGEYYNVPISEEDDGN----DELRQKFEKAKLGPGKKIITPTVDDDRSSLPSSSLDQVKLCDFNFLAVLGKGSFGKVMLAEMKSSEELYAIKILKKDVVIQDDDVECTMVEKRVLAQQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHQKGVIYRDLKLDNVMLDAEGHIKIADFGMCKENIFEGVTTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKALSKEAVSICKGLMTKHPTKRLGCSQEGERDIREHAFFRRIDWERLENREVQPPFKPKVCG-KNAENFDKFFTRTQPQLTPSDELVIANIDQADFAGFSFINPQF 637          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcg (protein kinase C, gamma [Source:ZFIN;Acc:ZDB-GENE-090206-1])

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 391/651 (60.06%), Postives = 487/651 (74.81%), Query Frame = 2
Query:   86 FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDT-DFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRAS------DFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEF 2014
            F R+GAL+ K + E+KDHQF ARFFKQ TFC HC DFIWG GKQGFQC++C F VHKRCHE VTF CPG   GP   D K+ H FK+HTY+SPTFCDHCGSLLYGL+HQG+KC +CD NVHK+CE +VP LCG DHTE+RGRI+L +      + V V EA+NL+PMDPNGL+DPYVK+K++P+ +S  KQKTKTI++TLNP WNE F        + +R+SIEVWDWDRTSRNDFMGALSFG+SE+ ++PV  WFKLL+ +EGE+Y+IPV D        DL+       +        T     ++     IP         DFNF++VLGKGSFGKV+LAE +G++ L+AVK+LKKDV+ QD+D E  M+E+RVL L  +P FL  L+  FQT DRLY+VME+VNGGDLM+ IQ  GKFKEP A FYA+EIA+GLFFLHSKGIIYRDLKLDN++LD EGHIKIADFGMC+EG+ +  TTRTFCGTPDYIAPEI+ YQPYGK+VDWW+YGV+LYEMLAGQ PFDG DEEELF +I E +VSYPKS+S+E+V     LLTK+P KRLG     +R++REH FFR IDW+++   ++QPP KP+    +   NFD+ FT  ++ LTP+D   +  +DQ +F  F+F+NPEF
Sbjct:  627 FQRKGALKHKRIVEVKDHQFTARFFKQPTFCSHCTDFIWGIGKQGFQCQVCSFVVHKRCHEFVTFTCPGAITGPKAEDLKSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCASCDMNVHKRCESSVPSLCGHDHTEKRGRIHLTVRGEKEDIYVTVREARNLIPMDPNGLSDPYVKLKLIPDPKSHSKQKTKTIRSTLNPVWNESFTL-----QWDRRLSIEVWDWDRTSRNDFMGALSFGVSEIFRRPVSGWFKLLNQDEGEYYNIPVPD-------PDLQVTHPHVTMSPH-----TALPPVLSPAPTSIPAGKGRVGLHDFNFLMVLGKGSFGKVMLAEERGSERLFAVKVLKKDVLFQDEDTESAMVERRVLGLAGRPHFLTSLYCAFQTEDRLYYVMEYVNGGDLMFHIQIVGKFKEPHAAFYASEIAVGLFFLHSKGIIYRDLKLDNVLLDSEGHIKIADFGMCREGMLEGDTTRTFCGTPDYIAPEIVAYQPYGKAVDWWSYGVLLYEMLAGQPPFDGLDEEELFQSIMEQSVSYPKSLSREAV-----LLTKNPGKRLGGGEDAEREIREHPFFRWIDWDRLERLEIQPPFKPRAGGKKG-ENFDKFFTSASSALTPSDPDVLAAIDQEDFQDFTFINPEF 1254          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 346.28 bits (887), Expect = 1.916e-111
Identity = 206/526 (39.16%), Postives = 284/526 (53.99%), Query Frame = 2
Query:  317 FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLC-GMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNG-LADPYVKIKIVPE--DQSRKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAV--FYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKI 1876
            F   H F    +  PTFC  C   ++GL  QG +C+ C+ + HK+C  NV   C G   T R+  I  +    +   + +V   ++    D  G L   + +  +  E  D +   K K   A L     E+    + + +  +   +              G LS  + E     V++  K     E    S P +     + + D +AK   +  +    Q + +E+   +           F+ + VLGKGSFGKV+LAE K   + +A+K LKK+V++  DDVECTM+EKRVL +  +  FL  L   FQT + L+FVMEF+ GGDLM+ IQ +GKF  P     FYAAE+  GL FLHS  IIYRDLKLDN++LD EGH+KIADFGMCKE +       TFCGTPDYIAPEI+  + YG SVDWW+ GV++YEML GQ+PF G DE+ELF AI  H   YP+ +S  S +I   L  +D  KRLG+      D+R H FF+ IDW  + AR++ PP KPK+
Sbjct:   13 FVKGHAFVTTFFPQPTFCSVCKEFVWGLNKQGFQCKECNASSHKRCVDNVLARCTGSADTNRQTEIVRESFNLHMSHSFKVHSYRSPTFCDHCGTLLWGFARQGLQCEACDANVHHKCKGKVANLCGISTERLAELLRQVEGGQVSCVGR-----RRGGAGRGILSRSLPEFDCISVETKEKGAPGAERPVESQPPSRKATRSVIFDQRAKGHLTPPQPAPPQSVPDESTRPSGEIAGKLSLDHFHLLKVLGKGSFGKVMLAELKEQGKFFAIKALKKEVVLMGDDVECTMVEKRVLLMACEHPFLTHLCGTFQTKEHLFFVMEFLTGGDLMFHIQDKGKFDLPTGTNRFYAAEVICGLQFLHSHNIIYRDLKLDNVLLDREGHVKIADFGMCKEHVGAGNLATTFCGTPDYIAPEILLGRAYGTSVDWWSMGVLIYEMLIGQSPFYGSDEDELFEAIKGHTPHYPRWLSDSSRNILSCLFERDHTKRLGAV----GDIRLHPFFKNIDWPSLEARKITPPFKPKV 529          

HSP 2 Score: 155.606 bits (392), Expect = 1.110e-40
Identity = 74/152 (48.68%), Postives = 93/152 (61.18%), Query Frame = 2
Query:   92 RRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDG--------PDTDFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKI 523
            RRGA++Q  V  +K H FV  FF Q TFC  CK+F+WG  KQGFQCK C  + HKRC + V  +C G  D            +   +H FKVH+Y SPTFCDHCG+LL+G   QGL+CE CD NVH KC+  V  LCG+  TER   +  ++
Sbjct:    2 RRGAIKQAKVKFVKGHAFVTTFFPQPTFCSVCKEFVWGLNKQGFQCKECNASSHKRCVDNVLARCTGSADTNRQTEIVRESFNLHMSHSFKVHSYRSPTFCDHCGTLLWGFARQGLQCEACDANVHHKCKGKVANLCGIS-TERLAELLRQV 152          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 317.39 bits (812), Expect = 5.679e-101
Identity = 152/329 (46.20%), Postives = 219/329 (66.57%), Query Frame = 2
Query: 1031 SDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHS-KGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIM----NLDQTEFSGFSFV 2002
            ++F+++ +LGKG+FGKVIL   K T + YA+KILKK+VI+  D+V  T+ E RVL   + P FL  L   FQT DRL FVME+VNGG+L + + +E  F E    FY AEI   L +LH+ K ++YRDLKL+N+MLD +GHIKIADFG+CKEGI D  T +TFCGTP+Y+APE+++   YG++VDWW  GV++YEM+ G+ PF  +D E+LF  I   ++ +P+++S ++ ++  GLL KDPK+RLG      +++  H FF  I W+ +  R++ PP KP++    D   FD+EFT +T  +TP D+   M    N  +  F  FS+ 
Sbjct:  148 NNFDYLKLLGKGTFGKVILVREKATGQYYAMKILKKEVIVAKDEVAHTLTENRVLQTTKHP-FLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDEEFTAQTITITPPDRFDSMESLDNERRPHFPQFSYC 475          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 306.605 bits (784), Expect = 9.643e-100
Identity = 149/268 (55.60%), Postives = 193/268 (72.01%), Query Frame = 2
Query: 1076 KVILAERKGTDE-LYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKI 1876
            +V LAE K      +A+K LKKDV+I  DDVECT++EKR+L+L     +L  L+S FQT + L FVME++NGGDLM+ IQ +G+F+   A FYAAEI  GL FLH +GIIYRDLKLDNI+LD +GH+KIADFGMCKE I  D    TFCGTPDYIAPEI+  Q Y  SVDWW++GV+LYEML GQ+PF G+DEEELF +I      YP+ ++K+S  I   LL ++P KRLG       ++R+H FFR I+WE +  R+++PP KP++
Sbjct:    1 QVFLAELKSRPRNFFAIKALKKDVVIMSDDVECTLVEKRILSLAWGHPYLAHLYSTFQTKEHLMFVMEYLNGGDLMFHIQVKGRFEIDRATFYAAEIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQSPFRGDDEEELFESIRTSVPYYPRWITKDSRDILPLLLEREPMKRLGVT----GEIRQHPFFRTINWEALEKRELEPPFKPRV 264          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.064 bits (780), Expect = 7.419e-97
Identity = 154/364 (42.31%), Postives = 231/364 (63.46%), Query Frame = 2
Query:  953 LEEKKNQQ---ITNENNYIN----QNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKE-----TAQLTPTDKLFIMNLDQT--EFSGFSFV 2002
            L+  +NQ    + N+ ++IN     N Q  P  SDF+F+ VLGKGSFGKV+LA+ K     YAVK++KK +I+Q  + +  M E+ VL    +  FLV LH  FQ+ D+LYFVM++VNGG+L + +Q++G F E  A FYAAEI   + +LHS  I+YRDLK +NI+LD++GHI + DFG+CKEGI    TT TFCGTP+Y+APE++K  PY ++VDWW  G +LYEML G  PF  ++ ++++ +I    +      +  ++S+ +GLL KDP +RLG+      +++ H+FF  I+W  ++A+++  P  P +  P D+ NFD  FT E      AQ + T  +   N+D+    F GF+++
Sbjct:   59 LDNPRNQTQGPMENDADHINLGPSANLQAKP--SDFDFLTVLGKGSFGKVLLAKHKSDGIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLGATS-DILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFDPAFTAEPLSMSMAQSSDTSSV-CANVDEAADAFVGFTYM 418          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: PRKCE (protein kinase C epsilon [Source:HGNC Symbol;Acc:HGNC:9401])

HSP 1 Score: 256.914 bits (655), Expect = 2.137e-79
Identity = 154/389 (39.59%), Postives = 214/389 (55.01%), Query Frame = 2
Query:  245 AVHKRCHELVTFQCPG-----KDDGPDTDFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSRKQKTKTIKATLNPTWN--EKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVA-DLKAKFEKSILEEKKNQQITNENNY-INQNKQDIPR---ASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGL 1375
             VHKRCHEL+  +CPG     +D+ P +     H F +H Y  PTFCDHCGSLL+GLL QGL+C+ C  NVH++CE+NV   CG+D      ++  +I     K++   ++ K               K  I P     + KT  I  +L   W             D    +S+++    R +R  F   L   IS+L+  P   W+ L     G F+  PV+  ++  + A +L++  +K++  E  ++    EN          + R     DF+FI VLGKGSFGKV+L E KGTDE++AVK+LKKD IIQDDDV+CT+ EKR+LAL  K  +L QL   FQT DRL+FVME+VNGGDLM++IQ+  KF EP +  Y AE+   L
Sbjct:    2 VVHKRCHELIITKCPGMKKEAQDEYPSS-VNVPHKFSIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCEQNVAPSCGVD-ARGIAKVLAEIGVTPDKIHQSTIKKK---------------KPAIYP-----RNKTAQISISLVQGWQNLRSASHMRPPTDRLSPLSLQLPRHARWTRALFFTIL---ISKLLLVPALGWWLLTQRNLGRFWPPPVSPPIHACTGAKELESGVKKALSFEAPSEGKAAENGEGAPPTTNRLCRRYGLDDFSFIKVLGKGSFGKVMLGELKGTDEVFAVKVLKKDSIIQDDDVDCTITEKRILALARKHPYLTQLFCSFQTRDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRVYGAEVTSAL 365          

HSP 2 Score: 58.151 bits (139), Expect = 3.362e-9
Identity = 22/50 (44.00%), Postives = 29/50 (58.00%), Query Frame = 2
Query:  137 HQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQC 286
            H+F    +K  TFC HC   +WG  +QG QCK+C   VH+RC + V   C
Sbjct:   34 HKFSIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCEQNVAPSC 83          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: PKC1 (Protein serine/threonine kinase; essential for cell wall remodeling during growth; localized to sites of polarized growth and the mother-daughter bud neck; homolog of the alpha, beta, and gamma isoforms of mammalian protein kinase C (PKC) [Source:SGD;Acc:S000000201])

HSP 1 Score: 332.413 bits (851), Expect = 1.816e-100
Identity = 168/325 (51.69%), Postives = 224/325 (68.92%), Query Frame = 2
Query: 1040 NFIL--VLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRV--LALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFV 2002
            NF+L  VLGKG+FGKVIL++ K TD L A+K+LKKD IIQ+ D+E    EK+V  LA + K  FL  L+  FQT +R+YF MEF+ GGDLM+ +Q + +     A FYAAE+ + L + H  G+IYRDLKL+NI+L  EGHIKIAD+G+CK+ ++    T TFCGTP+++APEI+K Q Y K+VDWWA+GV+LY+ML  Q+PF G+DE+E+FNAI      YP  M+ E V I +GLLTKDP+KRLG+      +V E  FFR I+++ I   +V+PP  P+IK P D S F+QEFT     LTP   +   +  Q EF GFSF+
Sbjct:  823 NFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGEIVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKPPYIPEIKSPEDTSYFEQEFTSAPPTLTPLPSVLTTS-QQEEFRGFSFM 1145          

HSP 2 Score: 80.8777 bits (198), Expect = 3.365e-16
Identity = 47/143 (32.87%), Postives = 65/143 (45.45%), Query Frame = 2
Query:   80 AGFTRRGAL--RQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGK---DDGPDT---DFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGM 484
             G  R GA+  R++ + E   H FV + F     C +C DF+      GFQC+ C F  HK+C+  V  +C  K   D  PD    + +  H F   +     +C HCG +L    H+  KC  C    H +C   VP  CGM
Sbjct:  394 GGLHRHGAIINRKEEIFEQHGHHFVQKSFYNIMCCAYCGDFL---RYTGFQCQDCKFLCHKKCYTNVVTKCIAKTSTDTDPDEAKLNHRIPHRFLPTSNRGTKWCCHCGYILPWGRHKVRKCSECGIMCHAQCAHLVPDFCGM 533          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 282.337 bits (721), Expect = 1.172e-85
Identity = 135/326 (41.41%), Postives = 210/326 (64.42%), Query Frame = 2
Query: 1034 DFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPE 2011
            DF+ + V+GKGSFGKV+   +K T ++YA+K ++K  I+   +V  T+ E+ VLA  + P F+V L   FQ+ ++LYFV+ F+NGG+L Y +Q+EG+F    A FY AE+   L  LH   ++YRDLK +NI+LD++GHI + DFG+CK  + DD  T TFCGTP+Y+APE++    Y K+VDWW  GV+LYEML G  P+  ED  +++  I +  + +P    +++  +  GLL++DP +RLG N  G  ++R H FF ++ W+++  +   PP KP + +  D SNFD+EFT+E    +  D+ ++    Q +F G+++V  E
Sbjct:  346 DFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCP-FIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRLGYN--GADEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKPIDSVVDE-YLSESVQKQFGGWTYVGNE 667          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 277.33 bits (708), Expect = 8.440e-84
Identity = 136/326 (41.72%), Postives = 206/326 (63.19%), Query Frame = 2
Query: 1034 DFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPE 2011
            DF+ + V+GKGSFGKV+   +K T ++YA+K L+K  I+   +V  T+ E+ VLA  + P F+V L   FQ+ ++LY V+ F+NGG+L Y +Q EG+F    + FY AE+   L  LH   +IYRDLK +NI+LD++GHI + DFG+CK  + D+  T TFCGTP+Y+APEI+  Q Y K+VDWW  G++LYEM+ G  P+  E+   ++  I +  + +P      +  +  GLL++DP +RLG N  G  ++R H FF+ I W+K+  +   PP KP +K   D +NFDQEFTKE    +  D+    ++ Q +F G++++  E
Sbjct:  343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP-FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVN--GTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEYLSASI-QKQFGGWTYIGDE 664          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 251.136 bits (640), Expect = 6.596e-77
Identity = 123/294 (41.84%), Postives = 183/294 (62.24%), Query Frame = 2
Query: 1031 SDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPR-DVSNFDQ 1909
            SDF  +  LG GSFG+V L         YA+K LKK  I++   VE T  E+R+L++   P F++++   FQ   +++ VM+++ GG+L   +++  +F  PVA FYAAE+ + L +LHSK IIYRDLK +NI+LD  GHIKI DFG  K   +    T T CGTPDYIAPE++  +PY KSVDWW++GV++YEMLAG  PF   +  + +  I    + +P     ++  + K L+T+D  +RLG+ + G  DV+ H +F  + WEK+ AR ++ P +P I+  + D S FD+
Sbjct:   86 SDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHP-FIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAK---YVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDR 375          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 247.284 bits (630), Expect = 9.232e-76
Identity = 124/293 (42.32%), Postives = 177/293 (60.41%), Query Frame = 2
Query: 1034 DFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDP-RDVSNFDQ 1909
            DF  +  LG GSFG+V L         YA+K+LKK  +++   VE T  E+R+L L E P FL+++   FQ    ++ VM+++ GG+L   +++  +F  PVA FYAAE+ + L +LH+  IIYRDLK +NI+LD  GHIKI DFG  KE       T T CGTPDYIAPE+I  +PY KSVDWW+ GV++YEMLAG  PF      + +  I +  V YP     + V +   L+T D  +R+G+ + G RD++ H +F  + WE++ A+ ++ P +P I     D S FDQ
Sbjct:   69 DFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHP-FLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEV---QTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQ 357          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO44925 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUL8])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 289/437 (66.13%), Postives = 347/437 (79.41%), Query Frame = 2
Query:  323 TNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPE-DQSRKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQA 1630
            + H+F  HTY SP FCDHCGSLLYG+ HQGLKC  CD NVHKKCEK VPKLCG DHTERRGRI+LKI+Y       E+ EA+NL+PMDPNGL+DPYVK+K++P+ D + K+KTK  K +L+P +NE F F I  +D  +R+SIEVWDWDRT+RNDFMG+LSFG+SEL K  V+ WFKLLS EEGE+Y+IP+ D           A+ E    EE+K +Q   E +  + N +   R  DF+F+ VLGKGSFGKV+LAERKGTD++YA+K+LKKDVI+QDDDVECTM EKRVLA+  KP FL QL  CF ++DRLYFVMEFVNGGDLM+ IQQ G+FKEP AVFYAAEI IGL FLH +GI+YRDLKLDN+MLD +GHIKIADFGMCKE +F+++TTRTFCGTPDYIAPEI+ YQPYG SVDWWA GV++YEMLAGQ 
Sbjct:    1 SPHNFGPHTYKSPCFCDHCGSLLYGVYHQGLKCTACDMNVHKKCEKAVPKLCGADHTERRGRIHLKISY-------ELREARNLMPMDPNGLSDPYVKVKLLPDPDNTSKKKTKIFKESLSPVFNETFEFKIQNKDKDRRLSIEVWDWDRTTRNDFMGSLSFGVSELQKNGVEGWFKLLSQEEGEYYNIPIDD-----------AREE----EERKCRQKL-EQSLSDPNAKKF-RPEDFHFLKVLGKGSFGKVMLAERKGTDQVYAIKVLKKDVIVQDDDVECTMTEKRVLAVPGKPPFLTQLFCCFHSVDRLYFVMEFVNGGDLMFHIQQAGRFKEPQAVFYAAEIVIGLVFLHKRGIVYRDLKLDNVMLDSDGHIKIADFGMCKESMFNNQTTRTFCGTPDYIAPEIVAYQPYGFSVDWWALGVLIYEMLAGQV 413          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO35585 (Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7SL27])

HSP 1 Score: 442.58 bits (1137), Expect = 5.264e-146
Identity = 209/329 (63.53%), Postives = 260/329 (79.03%), Query Frame = 2
Query: 1034 DFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYG-DRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            DF FI VLGKGSFGKV+LAERKGTDE+YA+KILKK+ ++QDDDVECTMIE+RVLAL     FL  LHS FQT++RL+FVME+VNGGDLM++IQ+  KF E  + FYAAE+ + L FLH  G+IYRDLKLDN++LD +GHIK+ADFGMCKE +   KTT TFCGTPDYIAPEI++ QPYG SVDWWA GV++YEM+AGQ PF+ E+EE+LF +I   +V YP  +S+E+VSI KG +TK+  KRLG      +  +REH FFR I++EK+ ARQ+ PP KPKI+   DV NFD +FTKE  +LTPTD+  I+N+DQ EF GFSFVNP F+
Sbjct:  382 DFTFIKVLGKGSFGKVLLAERKGTDEVYAIKILKKESVLQDDDVECTMIERRVLALSAGHPFLTSLHSSFQTVERLFFVMEYVNGGDLMFQIQKSRKFDENRSRFYAAEVVLALQFLHQNGVIYRDLKLDNVLLDADGHIKLADFGMCKENMAPGKTTTTFCGTPDYIAPEILQEQPYGFSVDWWALGVLMYEMMAGQPPFEAENEEDLFESILHDDVLYPVWLSREAVSILKGFMTKNYLKRLGCTPTSTESSIREHAFFRLINFEKLEARQINPPFKPKIRSRTDVGNFDTDFTKEEPKLTPTDRNVIVNIDQREFRGFSFVNPHFV 710          

HSP 2 Score: 146.747 bits (369), Expect = 8.255e-37
Identity = 62/134 (46.27%), Postives = 88/134 (65.67%), Query Frame = 2
Query:  119 VHEIKDHQFVARFFKQFTFCGHCKDFIWG-FGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDT--------DFKTN--HDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMD 487
            +H+I  H+F+A + +Q TFC HC DFIWG  GKQG+QC++C   VHKRCH++V  +CPG     +T         FK +  H F+  +Y  PTFC+ CGSLLYG++ QG++C  C  NVH++C +NV   CG++
Sbjct:  160 IHQINSHKFMATYLRQPTFCSHCNDFIWGVIGKQGYQCQVCTCVVHKRCHKMVVTKCPGTRQDAETMPLGGGSLRFKMDVPHKFEKKSYNRPTFCELCGSLLYGIVRQGMQCTVCKMNVHRRCHQNVANNCGIN 293          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO44938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU22])

HSP 1 Score: 358.992 bits (920), Expect = 1.474e-115
Identity = 171/337 (50.74%), Postives = 230/337 (68.25%), Query Frame = 2
Query: 1028 ASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPF---------DGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSN-RYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNP 2008
             +DFN I V+G+GS+ KV+L E K T  +YA+K++KK+++  D+D++    EK V        FLV LHSCFQT  RL+FV+E+V+GGDLMY +Q++ +  E  A FY+AEI   L FLH KG+IYRDLKLDN++LD +GHIK+ D+GMCKEGI     T TFCGTP+YIAPEI++ + YG SVDWWA GV+LYEMLAG++PF         D   E+ LF  I E  +  P+S+S ++ SI KG L K+P +RLG + + G  D+  H FFR + WE++ ARQV PP KP+ +DP  + NFD +FT E  Q TP D   +  +DQTEF GF ++NP
Sbjct:  219 VNDFNLIRVIGRGSYAKVMLVELKKTKRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTSSRLFFVIEYVSGGDLMYHMQRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNVLLDSDGHIKLTDYGMCKEGIRPGDVTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDIVGSADNPDQNTEDYLFQVILEKPIRIPRSLSVKAASILKGYLNKNPTERLGCHPQTGFADITSHAFFRTVSWEQLEARQVTPPFKPRQEDPYGLENFDPQFTNEDVQFTPDDPKMLETIDQTEFEGFEYINP 555          

HSP 2 Score: 77.7962 bits (190), Expect = 6.582e-15
Identity = 29/65 (44.62%), Postives = 40/65 (61.54%), Query Frame = 2
Query:   92 RRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQC 286
            RRGA R + +H +  H FVA+ F +   C  C D IWG G+ G++C  C   VHK+CH+L+  QC
Sbjct:  108 RRGAKRWRKIHIVNGHSFVAKRFSRLAACAFCSDRIWGLGRSGYKCLECKLVVHKKCHKLIKIQC 172          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 300.442 bits (768), Expect = 3.865e-95
Identity = 158/370 (42.70%), Postives = 225/370 (60.81%), Query Frame = 2
Query:  953 LEEKKNQQITNENNYINQNKQDI----------PRA--SDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLT---PTDKLFI-MNLDQTE--FSGFSFVNP 2008
            L+  KN Q  +E+     +  D+          P+A  SDF F+ V+GKGSFGKV L++ K  D+ YA+K+L K  I + ++ +  M E+ VL       FLV LH  FQT D+LYFV+++VNGG+L + +Q+E  F E  A FYAAEIA  + +LH   IIYRDLK +NI+LD +GHI + DFG+CKEGI    TT TFCGTP+Y+APE+++ Q Y KSVDWW  G +LYEM+ G  PF   D  E+++ I    +    ++S+ +  I +GLL KD  KRLGS      D+R H FFR I+W+++ AR ++PP  P +    D+ +FD EF +E    +     D  F+  ++D  +  F GF++V P
Sbjct:   34 LDNPKNAQANDEDEQPGSDDADVEKIDLGESNNPKAKPSDFLFLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQLVARGIEPPYNPNVSGQLDLKHFDPEFVREPVPGSVGKSADSNFVSASVDDPDDAFVGFTYVAP 403          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO43312 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYZ0])

HSP 1 Score: 290.426 bits (742), Expect = 4.642e-86
Identity = 152/328 (46.34%), Postives = 223/328 (67.99%), Query Frame = 2
Query: 1031 SDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVL--ALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPE-IIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLD-QTEFSGFSFV 2002
            S+F  I VLG+G FGKVILAE + T+EL+A+K LKK  II  ++VE  + EKR+   A + +  FLV L +CFQT + + FVME+  GGDLM  I  +  F E   VFY A + +GL +LH   I+YRDLKLDN++LD EG++KIADFG+CKE +     T TFCGTP+++APE ++    Y ++VDWW  GV+++EML G++PF G+DEEE+F++I    V YP+ +S E+++I + LL ++P++RLG+      +V++  FFR + W+ + AR+++PP  P++K   DVSNFD+EFT E   LTP  +   +N D Q  F+ F++ 
Sbjct:  610 SNFRCISVLGRGHFGKVILAEYRNTNELFAIKALKKGDIIAREEVESLLAEKRIFLTANKTRHPFLVNLFACFQTQEHVCFVMEYAPGGDLMMHIHAD-VFAESRTVFYTACVVLGLQYLHDHEIVYRDLKLDNLLLDSEGYVKIADFGLCKEDMGYGARTGTFCGTPEFLAPEMLVTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIAIMRRLLRRNPERRLGAAEKDAEEVKKQPFFRDMRWDDLLARKIRPPFVPQVKHAEDVSNFDEEFTSEEPILTPPKEARSLNPDEQGLFADFNYT 936          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcba (protein kinase C beta type [Source:NCBI gene;Acc:101161464])

HSP 1 Score: 970.689 bits (2508), Expect = 0.000e+0
Identity = 453/660 (68.64%), Postives = 539/660 (81.67%), Query Frame = 2
Query:   59 EGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKK--NQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
            E   SA+ GF R+GALRQKNVHE+K+H+F+ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FKVHTY+SPTFCDHCGSLLYGL+HQG+KC+ C  N+HK+C  NVP LCG DHTERRGR+ +      G + V + E +NLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK  LNPTWNE F F + + D  +R+S+EVWDWD TSRNDFMG+LSFGISEL KQ +D WFKLLS EEGE++++PV  D    +  +L+ KFE++ +   K  +   ++ + Y +   QD  + SDF FI+VLGKGSFGKV+LAERKGTDELYA+K+LKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQT DRLYFVME+VNGGDLMY+IQQ GKFKEP AVFYAAEI+IGLFFLHS+GI+YRDLKLDN+MLD EGHIKIADFGMCKE + D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQ PFDGEDE+ELF +I EH+VSYPKSMSKE+V+ICKGL+TK P KRLG    G+RD+++H FFR IDWEK+  + VQPP KPK K  +DV NFD+EFTK   +LTPTDKLFIMNLDQ EF GFS+ NPEF+++V
Sbjct:    9 EAPESAR-GFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSLLYGLIHQGMKCDHCMMNIHKRCVANVPSLCGTDHTERRGRLQITAQITQGTLTVTIKEGRNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCCLNPTWNETFTFKLCENDKDRRLSVEVWDWDLTSRNDFMGSLSFGISELQKQGIDGWFKLLSQEEGEYFNVPVQPDGEDGN-EELRQKFERAKVGPGKPTDSSSSSVHKYDSNGNQDRVKLSDFTFIMVLGKGSFGKVMLAERKGTDELYAIKVLKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTTDRLYFVMEYVNGGDLMYQIQQVGKFKEPHAVFYAAEISIGLFFLHSRGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLENKMVQPPFKPKAKSRQDVGNFDKEFTKMPVELTPTDKLFIMNLDQNEFQGFSYTNPEFVIQV 666          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: PRKCB (protein kinase C beta [Source:NCBI gene;Acc:105353642])

HSP 1 Score: 957.977 bits (2475), Expect = 0.000e+0
Identity = 450/660 (68.18%), Postives = 532/660 (80.61%), Query Frame = 2
Query:   56 EEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNEN---NYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIV 2020
            E+G      GF R+GALRQKNVHE+KDH+F+ RFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE V F CPG D GP +D  +  H FK+HTY+SPTFCDHCGSLLYGL+HQG++C+ C  N+HK+C  NVP LCG DHTERRGRI +        + V + EA+NLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK  LNPTWNE F F + + D  +R+S+EVWDWD TSRNDFMG+LSFGISEL KQ VD WFKLLS EEGE++++PVA +   AS  +L+ KFE++ +   K+ +  + N    + +   QD  R SDFNF++VLGKGSFGKV+LAERKGT+ELYA+KILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHS FQTMDRLYFVME++NGGDLMY+IQQ GKFKEP AVFYAAEIAIGLFFLH KGIIYRDLKLDN+MLD EGHIKIADFGMCKE + D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQ PFDGEDE+ELF +I EH+VSYPKSMSKE+V+ICKGL+TK P KRLG    G+RD+R+H FFR +DWEK+  ++VQPP KP+ +  RD  NFD+EFTK    LTPTDKL IMNLDQ EF GFS+ NPE++ 
Sbjct:   12 EDGPRQPMRGFARQGALRQKNVHEVKDHKFIPRFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVAFSCPGADKGPASDDPRAKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMRCDHCMMNIHKRCVANVPSLCGTDHTERRGRIQITAEVKTNVLTVTIKEARNLVPMDPNGLSDPYVKLKLIPDPRSESKQKTKTIKCCLNPTWNETFKFHLKEYDKDRRLSVEVWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVAPEGEEAS-EELRQKFERAKIAVGKSTEGKSSNAASRFDSNGNQDRIRLSDFNFLMVLGKGSFGKVMLAERKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSTFQTMDRLYFVMEYINGGDLMYQIQQVGKFKEPHAVFYAAEIAIGLFFLHLKGIIYRDLKLDNVMLDCEGHIKIADFGMCKENMNDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPAKRLGCGPEGERDIRDHSFFRYMDWEKLENKEVQPPFKPRARTRRDTCNFDKEFTKMPTDLTPTDKLVIMNLDQDEFLGFSYTNPEYVA 670          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcab (protein kinase C alpha type [Source:NCBI gene;Acc:101159746])

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 445/659 (67.53%), Postives = 540/659 (81.94%), Query Frame = 2
Query:   65 NTSAKAG--FTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPV--ADDLNVASVADLKAKFEKSILEEKKNQQITNENNYIN--QNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFI 2017
            N SA  G  F R+GALRQKNVHE+K+H+F ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE V+F CPG D GPD+D  ++ H FK+HTY SPTFCDHCGSLLYGL+HQG+KC+TCD NVHK+C  NVP LCGMDHTERRGR++LKI  +  K+++ V EA+NL+PMDPNGL+DPYVK+K++P+ ++  KQKT+TI+++LNP WNE F F +   D  +R+SIEVWDWDRT+RNDFMG++SFG+SEL+K P   WFKLL+ EEGE+Y++P+   DD+N+    +L+ KFEK+ L   K     +++   +      D  R SDFNF+ +LGKGSFGKV+LAE K T+ELYA+KILKKDV+IQDDDVECTM+EKRVLAL++KP FL QLHSCFQT+DRLYFVME++NGGDLMY IQ+ GKFKEP AVFYAAEIA+GLFFLH KGIIYRDLKLDN+MLD EGHIKIADFGMCKE +++  TTRTFCGTPDYIAPEII YQPYGKSVDWWAYGV+LYEMLAGQ PFDGEDE+ELF +I EHNVSYPKSMSKE+VSICKGL+TK P KRLG    G+RD+RE  FFRRIDWE++  R++QPP KPK+   +   NFD+ FT+    LTP D+L I N+DQ+EF+GFSF+NP+FI
Sbjct:    9 NDSAGVGNRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVSFSCPGADKGPDSDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVVNVPSLCGMDHTERRGRVFLKIEVSGDKLHITVGEARNLIPMDPNGLSDPYVKLKLIPDPKNETKQKTRTIRSSLNPCWNESFTFKLKPSDKDRRLSIEVWDWDRTTRNDFMGSMSFGVSELIKAPHCGWFKLLNQEEGEYYNVPIPEVDDVNL----ELRQKFEKAKLGHGKKVITPSDHRRFSFPSGNLDRVRLSDFNFLALLGKGSFGKVMLAEMKSTEELYAIKILKKDVVIQDDDVECTMVEKRVLALRDKPPFLTQLHSCFQTVDRLYFVMEYINGGDLMYHIQRMGKFKEPQAVFYAAEIAVGLFFLHRKGIIYRDLKLDNVMLDSEGHIKIADFGMCKESMYEGMTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSMSKEAVSICKGLMTKHPSKRLGCGPEGERDIREQAFFRRIDWERLANREIQPPFKPKVCG-KAAENFDKFFTRTQPVLTPPDQLVISNIDQSEFAGFSFINPQFI 662          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcba (protein kinase C beta type [Source:NCBI gene;Acc:101161464])

HSP 1 Score: 944.495 bits (2440), Expect = 0.000e+0
Identity = 445/656 (67.84%), Postives = 528/656 (80.49%), Query Frame = 2
Query:   59 EGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKK--NQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEF 2014
            E   SA+ GF R+GALRQKNVHE+K+H+F+ARFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE VTF CPG D GP +D  ++ H FKVHTY+SPTFCDHCGSLLYGL+HQG+KC+ C  N+HK+C  NVP LCG DHTERRGR+ +      G + V + E +NLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK  LNPTWNE F F + + D  +R+S+EVWDWD TSRNDFMG+LSFGISEL KQ +D WFKLLS EEGE++++PV  D    +  +L+ KFE++ +   K  +   ++ + Y +   QD  + SDF FI+VLGKGSFGKV+LAERKGTDELYA+K+LKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHSCFQT DRLYFVME+VNGGDLMY+IQQ GKFKEP AVFYAAEI+IGLFFLHS+GI+YRDLKLDN+MLD EGHIKIADFGMCKE + D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQ PFDGEDE+ELF +I EH+VSYPKSMSKE+V+ICKGL+TK P KRLG    G+RD+++H FFR IDWEK+  + VQPP KPK    RD  NFD+ FT+    LTP D+  I NLDQ EF GFSFVNPE+
Sbjct:    9 EAPESAR-GFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSLLYGLIHQGMKCDHCMMNIHKRCVANVPSLCGTDHTERRGRLQITAQITQGTLTVTIKEGRNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCCLNPTWNETFTFKLCENDKDRRLSVEVWDWDLTSRNDFMGSLSFGISELQKQGIDGWFKLLSQEEGEYFNVPVQPDGEDGN-EELRQKFERAKVGPGKPTDSSSSSVHKYDSNGNQDRVKLSDFTFIMVLGKGSFGKVMLAERKGTDELYAIKVLKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTTDRLYFVMEYVNGGDLMYQIQQVGKFKEPHAVFYAAEISIGLFFLHSRGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLENKMVQPPFKPKACG-RDAENFDRFFTRHLPTLTPPDQELIANLDQDEFQGFSFVNPEY 661          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: PRKCB (protein kinase C beta [Source:NCBI gene;Acc:105353642])

HSP 1 Score: 940.258 bits (2429), Expect = 0.000e+0
Identity = 445/658 (67.63%), Postives = 527/658 (80.09%), Query Frame = 2
Query:   56 EEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD-FKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSR-KQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNEN---NYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEF 2014
            E+G      GF R+GALRQKNVHE+KDH+F+ RFFKQ TFC HC DFIWGFGKQGFQC++C F VHKRCHE V F CPG D GP +D  +  H FK+HTY+SPTFCDHCGSLLYGL+HQG++C+ C  N+HK+C  NVP LCG DHTERRGRI +        + V + EA+NLVPMDPNGL+DPYVK+K++P+ +S  KQKTKTIK  LNPTWNE F F + + D  +R+S+EVWDWD TSRNDFMG+LSFGISEL KQ VD WFKLLS EEGE++++PVA +   AS  +L+ KFE++ +   K+ +  + N    + +   QD  R SDFNF++VLGKGSFGKV+LAERKGT+ELYA+KILKKDV+IQDDDVECTM+EKRVLAL  KP FL QLHS FQTMDRLYFVME++NGGDLMY+IQQ GKFKEP AVFYAAEIAIGLFFLH KGIIYRDLKLDN+MLD EGHIKIADFGMCKE + D  TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GV+LYEMLAGQ PFDGEDE+ELF +I EH+VSYPKSMSKE+V+ICKGL+TK P KRLG    G+RD+R+H FFR +DWEK+  ++VQPP KP+    R+  NFD+ FT+    LTP D+  I NLDQ EF GFSF+NPEF
Sbjct:   12 EDGPRQPMRGFARQGALRQKNVHEVKDHKFIPRFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVAFSCPGADKGPASDDPRAKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMRCDHCMMNIHKRCVANVPSLCGTDHTERRGRIQITAEVKTNVLTVTIKEARNLVPMDPNGLSDPYVKLKLIPDPRSESKQKTKTIKCCLNPTWNETFKFHLKEYDKDRRLSVEVWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVAPEGEEAS-EELRQKFERAKIAVGKSTEGKSSNAASRFDSNGNQDRIRLSDFNFLMVLGKGSFGKVMLAERKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSTFQTMDRLYFVMEYINGGDLMYQIQQVGKFKEPHAVFYAAEIAIGLFFLHLKGIIYRDLKLDNVMLDCEGHIKIADFGMCKENMNDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPAKRLGCGPEGERDIRDHSFFRYMDWEKLENKEVQPPFKPRACG-REAENFDRFFTRHPPVLTPPDEEVIQNLDQDEFQGFSFINPEF 667          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000071570.1 (SMESG000071570.1)

HSP 1 Score: 1041.57 bits (2692), Expect = 0.000e+0
Identity = 481/650 (74.00%), Postives = 569/650 (87.54%), Query Frame = 2
Query:   83 GFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDFKTNHDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVP-EDQSRKQ-KTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
            GF R+GALRQKNVHE+KDH+F+ARFFKQ TFCGHCKDFIWGFGKQGFQC+IC FAVHKRCHELVTFQCPG D GPDT+++ NH FK HTYT+PTFCDHCGSLLYGL HQG+KC+ CD NVH KCEKNVP LCG+DHTERRGRI++ +     K++V V+E+KNLVPMDPNGLADPYVKIK+ P +DQS K+ KTKTI+++LNP WNE F   +SKED ++R+S+EVWDWDRT+RNDFMG+LSFG+SELV +PV++WFKLLS EEGEFY+I V ++ + A++ DL+ +FE++  E ++ +  +     +  +KQDIPR SDFNF+LVLGKGSFGKV+L ERKGTDELYA+KILKKDVIIQDDD+ECTMIEKRVLALQ KP  LVQLHSCFQTMDRLYFVME+VNGGDLMYRIQQEGKFKEPVAVFY+AEIA+GL FLH+ GIIYRDLKLDN++LD EGHIKIADFGMCKE I  + TT+TFCGTPDYIAPEIIKYQPYGKSVDWWA+GV+LYEMLAGQ PFDGEDEE+LFN+IT HNVS+P+SMS+E+V+IC+GL+TK+  KRLG    G R ++EH+FFRRI+W+KI  R++QPP KPK K+ RDVSNFD+ FTKE  Q+TPTDKLFIMNLDQTEF+GFSFVNPEF+VEV
Sbjct:   15 GFARKGALRQKNVHEVKDHKFLARFFKQPTFCGHCKDFIWGFGKQGFQCQICAFAVHKRCHELVTFQCPGADTGPDTEYQNNHKFKPHTYTTPTFCDHCGSLLYGLFHQGIKCDNCDMNVHGKCEKNVPCLCGVDHTERRGRIHIIVRLERLKLHVTVVESKNLVPMDPNGLADPYVKIKLTPSDDQSGKKFKTKTIRSSLNPVWNESFTIDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEAS-AAIMDLRNRFERASAESRERKSKSTSVT-MPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPKFKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 662          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000039865.1 (SMESG000039865.1)

HSP 1 Score: 991.104 bits (2561), Expect = 0.000e+0
Identity = 481/482 (99.79%), Postives = 481/482 (99.79%), Query Frame = 2
Query:  581 MDPNGLADPYVKIKIVPEDQSRKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 2026
            MDPNGLADPYVKIKIVPEDQSRKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFY AEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV
Sbjct:    1 MDPNGLADPYVKIKIVPEDQSRKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYTAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 482          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000042308.1 (SMESG000042308.1)

HSP 1 Score: 498.434 bits (1282), Expect = 6.985e-167
Identity = 283/678 (41.74%), Postives = 379/678 (55.90%), Query Frame = 2
Query:   38 MSEQAIEEGNTSAKAGFT----RRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPG-KDDGPDTDFKTN-------HDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSRKQKTKTI----KATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLG--SNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTD-KLFIMNLDQTEFSGFSFVNPEF 2014
            +S + +  G T +  GF     R GALR++ +H+IK H+F    FKQFTFC  C  FIWG   QG+QC++C   VHKRC++ V  +CPG KD    ++ + N       H F+VHT+  P FCDHCGSLL+GL+ QGL+CE C  N+HK+CEKNV   CG+                N K  VE ++   L P+D  G    Y +           QK+  +    ++  +P       + I+ E   K + +     DR+S+      +S   S L              E G+   +P   D N   V   K  F K IL                                            AE K T ++YA+KILKK+VI+QD+DVECTM E+R+LAL  K  FL  LHS FQT DRL+FVME+VNGGDLM++IQ+  +F EP A FY++E+ + L FLH  GIIYRDLKLDNI+LD EGH K+ADFGMCKEG+   K T TFCGTPDYIAPEI+  Q YG SVDWWA GV++YEM+AG  PF+G+ E++LFNAI+  +VS+P S+   SV I    L K+P KRLG  ++  G + +  H FFR IDW  +  R+++PP +PK++   D SNFD++FT E   LTP +    I  L +  F+GF F N ++
Sbjct:  136 ISREKLSPG-TQSIGGFHGKHYRAGALRRR-IHQIKGHKFQVTLFKQFTFCSLCNSFIWGLWNQGYQCQVCTCVVHKRCYQNVIVRCPGVKDTYSSSEAQLNRFNINVPHKFRVHTFMRPAFCDHCGSLLFGLMRQGLQCEACKLNIHKRCEKNVAPHCGV----------------NTKDLVEAIKKCGLNPLD-LGYNPRYERTSTSANITDSTQKSSDLPIHERSLSSPIPTHPDNYPITIEPVNKCLVLN--SGDRSSKR----VISHRPSSL-------------QEYGDTPKVPCLSDFNFVKVLG-KGSFGKVIL--------------------------------------------AEHKSTCDVYAIKILKKEVILQDEDVECTMTEQRILALAAKHPFLTALHSSFQTDDRLFFVMEYVNGGDLMFQIQRVRRFDEPRACFYSSEVTLALMFLHKHGIIYRDLKLDNILLDAEGHCKLADFGMCKEGMSGSKLTSTFCGTPDYIAPEILAEQDYGFSVDWWALGVLMYEMMAGAPPFEGDTEQDLFNAISYDSVSFPSSLQPASVDIVSKFLIKNPLKRLGCVAHEGGQQAIMRHPFFREIDWVLLEERRIRPPFRPKVRSRTDTSNFDKDFTSEDPVLTPIENSCEIAALGKDVFAGFDFFNTDY 730          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000066024.1 (SMESG000066024.1)

HSP 1 Score: 499.204 bits (1284), Expect = 1.217e-166
Identity = 280/693 (40.40%), Postives = 379/693 (54.69%), Query Frame = 2
Query:    5 ISG*YKLN*SIMSEQAIEEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD------FKTN--HDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSRKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAK-FEKSILEEKKNQQITNENNYINQNKQDIPRA---SDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLG---------SNRY--GDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEF 2014
            ISG  K     ++   ++ G   ++    RRGA+R++ VH+ K H+F+   FKQFTFC  CK+FIWG   QG+QC +C   +HKRC   +   CPG  +    +      F  N  H F  H Y  PTFCDHCGSLL+G + QGL+C+ C  N+HK+CEKNV K CG+                  KM VE ++A  L P                 + + R+ +    +    PT+        SK D                            S L+     +    + T        P  + L+  +V  +K +  E+S         I  + + ++Q     P++   SDFN + VLGKGSFGKV+L E K T E++A+K LKKDVI+QDDDV+CT+ E+R+LAL  K  FL  LHS FQT DRL+F+MEFVNGGDLM+ IQ+  +F EP A FY+AE+A+ L FLH+                  GH K+ADFGMCKEGI  DKTT TFCGTPDYIAPEII  + Y  SVDWWA GV++YEM+AG  PF+G  E+ELF AI    V +P ++S  +  +    LTK P++RLG         S RY  G +D+++H F+R +DW K+  RQ+ PP KP +    D SNFD++FT E  +LTP D   + ++DQ EF GFSFVNP++
Sbjct:  177 ISGSNKTPQDSLANSNVQSGPVISR--HNRRGAMRKQRVHQTKGHKFMVTMFKQFTFCSLCKEFIWGLWYQGYQCHVCTCVIHKRCLSNMITWCPGVKESSRNEENQLARFSINVPHHFHPHNYKWPTFCDHCGSLLFGFIRQGLQCKVCKLNIHKRCEKNVAKHCGV----------------KTKMLVERMQACGLSPA----------------DLEPRRTQPNITETPYTPTF--------SKHD----------------------------SGLMSCNSSTQLATMETCRSASLEDPPLEKLSPNTVVSVKRRSVERS---HSTPSGIRGKEDSLSQLAALAPKSYKLSDFNMLSVLGKGSFGKVMLVELKSTGEVFALKALKKDVILQDDDVDCTLTERRILALAAKHPFLTALHSSFQTPDRLFFIMEFVNGGDLMFHIQKARRFDEPRACFYSAEVALALHFLHN------------------GHCKLADFGMCKEGISGDKTTTTFCGTPDYIAPEIILEESYDFSVDWWAMGVLMYEMMAGAPPFEGSSEDELFKAILSDKVMFPSNLSLATADLISKFLTKRPQQRLGCAVNSNIPSSERYKKGFKDIQQHTFYRDLDWRKLEQRQLTPPFKPLVCSNSDTSNFDRDFTNEQPKLTPVDSECVKHIDQREFRGFSFVNPDY 778          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000066024.1 (SMESG000066024.1)

HSP 1 Score: 499.204 bits (1284), Expect = 3.587e-166
Identity = 280/693 (40.40%), Postives = 379/693 (54.69%), Query Frame = 2
Query:    5 ISG*YKLN*SIMSEQAIEEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHCKDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTD------FKTN--HDFKVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMDHTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPEDQSRKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAK-FEKSILEEKKNQQITNENNYINQNKQDIPRA---SDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLG---------SNRY--GDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEF 2014
            ISG  K     ++   ++ G   ++    RRGA+R++ VH+ K H+F+   FKQFTFC  CK+FIWG   QG+QC +C   +HKRC   +   CPG  +    +      F  N  H F  H Y  PTFCDHCGSLL+G + QGL+C+ C  N+HK+CEKNV K CG+                  KM VE ++A  L P                 + + R+ +    +    PT+        SK D                            S L+     +    + T        P  + L+  +V  +K +  E+S         I  + + ++Q     P++   SDFN + VLGKGSFGKV+L E K T E++A+K LKKDVI+QDDDV+CT+ E+R+LAL  K  FL  LHS FQT DRL+F+MEFVNGGDLM+ IQ+  +F EP A FY+AE+A+ L FLH+                  GH K+ADFGMCKEGI  DKTT TFCGTPDYIAPEII  + Y  SVDWWA GV++YEM+AG  PF+G  E+ELF AI    V +P ++S  +  +    LTK P++RLG         S RY  G +D+++H F+R +DW K+  RQ+ PP KP +    D SNFD++FT E  +LTP D   + ++DQ EF GFSFVNP++
Sbjct:  214 ISGSNKTPQDSLANSNVQSGPVISR--HNRRGAMRKQRVHQTKGHKFMVTMFKQFTFCSLCKEFIWGLWYQGYQCHVCTCVIHKRCLSNMITWCPGVKESSRNEENQLARFSINVPHHFHPHNYKWPTFCDHCGSLLFGFIRQGLQCKVCKLNIHKRCEKNVAKHCGV----------------KTKMLVERMQACGLSPA----------------DLEPRRTQPNITETPYTPTF--------SKHD----------------------------SGLMSCNSSTQLATMETCRSASLEDPPLEKLSPNTVVSVKRRSVERS---HSTPSGIRGKEDSLSQLAALAPKSYKLSDFNMLSVLGKGSFGKVMLVELKSTGEVFALKALKKDVILQDDDVDCTLTERRILALAAKHPFLTALHSSFQTPDRLFFIMEFVNGGDLMFHIQKARRFDEPRACFYSAEVALALHFLHN------------------GHCKLADFGMCKEGISGDKTTTTFCGTPDYIAPEIILEESYDFSVDWWAMGVLMYEMMAGAPPFEGSSEDELFKAILSDKVMFPSNLSLATADLISKFLTKRPQQRLGCAVNSNIPSSERYKKGFKDIQQHTFYRDLDWRKLEQRQLTPPFKPLVCSNSDTSNFDRDFTNEQPKLTPVDSECVKHIDQREFRGFSFVNPDY 815          
The following BLAST results are available for this feature:
BLAST of Protein kinase C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKCB0.000e+069.36protein kinase C beta [Source:HGNC Symbol;Acc:HGNC... [more]
PRKCA0.000e+068.93protein kinase C alpha [Source:HGNC Symbol;Acc:HGN... [more]
PRKCB0.000e+068.15protein kinase C beta [Source:HGNC Symbol;Acc:HGNC... [more]
PRKCG0.000e+060.65protein kinase C gamma [Source:HGNC Symbol;Acc:HGN... [more]
PRKCE0.000e+044.66protein kinase C epsilon [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkc-20.000e+065.68Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-20.000e+067.12Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-23.368e-1464.49Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-20.000e+063.93Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-13.798e-14258.43Protein kinase C-like 1B [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkc53E0.000e+069.88gene:FBgn0003091 transcript:FBtr0331960[more]
Pkc53E0.000e+069.88gene:FBgn0003091 transcript:FBtr0087049[more]
Pkc53E0.000e+068.91gene:FBgn0003091 transcript:FBtr0087048[more]
Pkc53E0.000e+068.10gene:FBgn0003091 transcript:FBtr0112819[more]
Pkc53E0.000e+068.10gene:FBgn0003091 transcript:FBtr0305070[more]
back to top
BLAST of Protein kinase C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcbb0.000e+068.52protein kinase C, beta b [Source:NCBI gene;Acc:393... [more]
prkcaa0.000e+067.17protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GE... [more]
prkcbb0.000e+067.97protein kinase C, beta b [Source:NCBI gene;Acc:393... [more]
prkcba0.000e+065.71protein kinase C, beta a [Source:ZFIN;Acc:ZDB-GENE... [more]
prkcaa0.000e+067.52protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcb0.000e+066.17protein kinase C beta [Source:NCBI gene;Acc:100038... [more]
prkcb0.000e+066.67protein kinase C beta [Source:NCBI gene;Acc:100038... [more]
prkcb0.000e+067.33protein kinase C beta [Source:NCBI gene;Acc:100038... [more]
prkcb0.000e+066.47protein kinase C beta [Source:NCBI gene;Acc:100038... [more]
ddb20.000e+064.91damage-specific DNA binding protein 2 [Source:Xenb... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkcb0.000e+069.36protein kinase C, beta [Source:MGI Symbol;Acc:MGI:... [more]
Prkca0.000e+069.09protein kinase C, alpha [Source:MGI Symbol;Acc:MGI... [more]
Prkcb0.000e+068.15protein kinase C, beta [Source:MGI Symbol;Acc:MGI:... [more]
Prkcb0.000e+068.15protein kinase C, beta [Source:MGI Symbol;Acc:MGI:... [more]
Prkcg0.000e+061.75Protein kinase C gamma type [Source:UniProtKB/Swi... [more]
back to top
BLAST of Protein kinase C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16974|KPC1_APLCA0.000e+073.72Calcium-dependent protein kinase C OS=Aplysia cali... [more]
sp|P05771|KPCB_HUMAN0.000e+069.36Protein kinase C beta type OS=Homo sapiens OX=9606... [more]
sp|P05772|KPCB_RABIT0.000e+068.46Protein kinase C beta type OS=Oryctolagus cuniculu... [more]
sp|P68403|KPCB_RAT0.000e+069.36Protein kinase C beta type OS=Rattus norvegicus OX... [more]
sp|P68404|KPCB_MOUSE0.000e+069.36Protein kinase C beta type OS=Mus musculus OX=1009... [more]
back to top
BLAST of Protein kinase C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G6790.000e+076.85Protein kinase C OS=Macrostomum lignano OX=282301 ... [more]
A0A267GSY10.000e+075.43Protein kinase C OS=Macrostomum lignano OX=282301 ... [more]
A0A2R2MN120.000e+074.06Protein kinase C OS=Lingula unguis OX=7574 GN=LOC1... [more]
A0A210QM380.000e+074.00Protein kinase C OS=Mizuhopecten yessoensis OX=657... [more]
V4B6K80.000e+073.56Protein kinase C OS=Lottia gigantea OX=225164 GN=L... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcba0.000e+068.30protein kinase C beta [Source:NCBI gene;Acc:103036... [more]
prkcbb0.000e+066.47protein kinase C beta type [Source:NCBI gene;Acc:1... [more]
prkcbb0.000e+065.31protein kinase C beta type [Source:NCBI gene;Acc:1... [more]
prkcaa0.000e+063.33protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GE... [more]
prkcg0.000e+060.06protein kinase C, gamma [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKCD1.916e-11139.16protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
ENSPMAT00000008480.15.679e-10146.20pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
PRKCD9.643e-10055.60protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
ENSPMAT00000006766.17.419e-9742.31pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
PRKCE2.137e-7939.59protein kinase C epsilon [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PKC11.816e-10051.69Protein serine/threonine kinase; essential for cel... [more]
YPK11.172e-8541.41S/T protein kinase; phosphorylates, downregulates ... [more]
YPK28.440e-8441.72Protein kinase similar to S/T protein kinase Ypk1p... [more]
TPK36.596e-7741.84cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK29.232e-7642.32cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO449250.000e+066.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355855.264e-14663.53Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
EDO449381.474e-11550.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378003.865e-9542.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433124.642e-8646.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcba0.000e+068.64protein kinase C beta type [Source:NCBI gene;Acc:1... [more]
PRKCB0.000e+068.18protein kinase C beta [Source:NCBI gene;Acc:105353... [more]
prkcab0.000e+067.53protein kinase C alpha type [Source:NCBI gene;Acc:... [more]
prkcba0.000e+067.84protein kinase C beta type [Source:NCBI gene;Acc:1... [more]
PRKCB0.000e+067.63protein kinase C beta [Source:NCBI gene;Acc:105353... [more]
back to top
BLAST of Protein kinase C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071570.10.000e+074.00SMESG000071570.1[more]
SMESG000039865.10.000e+099.79SMESG000039865.1[more]
SMESG000042308.16.985e-16741.74SMESG000042308.1[more]
SMESG000066024.11.217e-16640.40SMESG000066024.1[more]
SMESG000066024.13.587e-16640.40SMESG000066024.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007480 ID=SMED30007480|Name=Protein kinase C|organism=Schmidtea mediterranea sexual|type=transcript|length=2154bp
CTTTATTAGCGGGTAATATAAATTGAATTGATCGATTATGAGTGAACAAG
CCATAGAGGAAGGGAATACTTCTGCCAAAGCTGGATTCACTCGACGCGGA
GCGTTGAGACAAAAGAATGTTCACGAAATCAAAGACCATCAATTTGTCGC
ACGGTTTTTCAAGCAATTCACCTTCTGTGGACACTGTAAAGATTTTATTT
GGGGATTCGGTAAGCAAGGCTTCCAGTGTAAAATATGTTTGTTTGCAGTA
CACAAACGCTGTCACGAATTGGTAACGTTTCAATGCCCAGGCAAAGATGA
CGGGCCTGATACTGATTTCAAAACTAATCACGATTTCAAAGTCCACACTT
ATACGAGTCCAACGTTCTGCGATCACTGCGGATCTCTTCTCTATGGATTG
CTTCATCAGGGATTGAAATGCGAAACTTGTGACACAAATGTTCACAAAAA
ATGCGAGAAAAATGTACCAAAATTATGTGGAATGGATCACACTGAACGTA
GAGGTCGAATCTATTTGAAAATTAATTACAATAACGGGAAGATGAATGTA
GAAGTTTTGGAAGCAAAAAATCTCGTGCCAATGGATCCTAATGGTCTTGC
TGATCCCTATGTAAAAATTAAAATAGTTCCAGAAGATCAAAGCCGTAAGC
AAAAAACAAAAACAATTAAAGCAACGTTGAATCCAACATGGAACGAAAAG
TTTATTTTCACAATATCCAAAGAGGATTTCGCCAAAAGAATGTCAATAGA
AGTCTGGGACTGGGACAGAACCTCTCGAAATGATTTTATGGGAGCCCTCT
CATTTGGTATAAGTGAGCTTGTTAAACAGCCAGTTGACAGCTGGTTCAAG
TTGCTATCAACGGAAGAAGGAGAATTCTATTCAATCCCAGTTGCAGATGA
TCTGAATGTGGCGTCGGTTGCTGATCTGAAAGCCAAATTTGAAAAATCAA
TATTGGAAGAAAAGAAAAATCAACAAATAACAAATGAAAATAATTACATA
AATCAAAATAAACAAGATATTCCTCGGGCGTCTGATTTCAATTTTATTCT
GGTCCTTGGTAAAGGAAGTTTTGGAAAGGTAATTCTTGCTGAAAGAAAAG
GAACCGATGAGTTGTATGCAGTAAAAATTTTAAAGAAGGATGTCATTATT
CAAGATGATGACGTCGAATGCACAATGATAGAAAAAAGAGTTTTGGCTCT
TCAAGAAAAGCCATCGTTTTTGGTTCAGTTGCATTCGTGTTTCCAAACTA
TGGATCGACTGTACTTTGTCATGGAATTTGTGAATGGTGGGGATTTGATG
TATCGAATACAACAGGAAGGAAAGTTTAAGGAACCCGTAGCCGTATTTTA
TGCTGCTGAAATAGCCATTGGATTATTTTTTTTACATTCCAAAGGGATTA
TATACAGGGACTTGAAACTGGATAATATCATGCTAGATCACGAAGGCCAC
ATAAAGATTGCTGATTTTGGCATGTGCAAAGAAGGAATCTTTGATGATAA
AACCACGAGAACGTTTTGCGGAACACCGGATTACATTGCACCAGAGATTA
TCAAATACCAGCCTTACGGTAAATCAGTTGATTGGTGGGCATATGGCGTG
ATTTTATACGAAATGCTGGCTGGGCAAGCTCCATTCGACGGAGAAGACGA
GGAAGAATTATTCAACGCCATAACGGAGCACAATGTTTCCTATCCCAAGT
CAATGTCAAAGGAATCTGTTTCAATATGCAAAGGACTGTTAACAAAAGAT
CCTAAAAAACGGCTTGGATCCAATCGTTATGGAGATCGAGATGTACGGGA
GCATTTATTCTTTAGACGCATTGATTGGGAGAAAATAAATGCCCGACAAG
TTCAGCCTCCTAACAAACCAAAAATAAAAGATCCGAGAGACGTCAGCAAC
TTTGATCAAGAATTTACGAAAGAGACGGCGCAATTGACTCCGACAGATAA
ATTATTCATCATGAATCTTGATCAAACGGAATTCTCTGGATTTTCCTTTG
TTAATCCGGAATTCATTGTTGAGGTGTAACCGTATTCGAATCCCGCACCG
ACGTTACACCATTCAATTTAGAACACAATGTGCATAATATGTTGAAATTG
TTTCAGTACAGCTGACAATAATAATAAAAAAAAAATAATAATAATAATAA
TAAT
back to top

protein sequence of SMED30007480-orf-1

>SMED30007480-orf-1 ID=SMED30007480-orf-1|Name=SMED30007480-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=664bp
MSEQAIEEGNTSAKAGFTRRGALRQKNVHEIKDHQFVARFFKQFTFCGHC
KDFIWGFGKQGFQCKICLFAVHKRCHELVTFQCPGKDDGPDTDFKTNHDF
KVHTYTSPTFCDHCGSLLYGLLHQGLKCETCDTNVHKKCEKNVPKLCGMD
HTERRGRIYLKINYNNGKMNVEVLEAKNLVPMDPNGLADPYVKIKIVPED
QSRKQKTKTIKATLNPTWNEKFIFTISKEDFAKRMSIEVWDWDRTSRNDF
MGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAK
FEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVIL
AERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHS
CFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFFLH
SKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYI
APEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNV
SYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKI
NARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFS
GFSFVNPEFIVEV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004698calcium-dependent protein kinase C activity
GO:0005515protein binding
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004674protein serine/threonine kinase activity
GO:0008270zinc ion binding
GO:0004697protein kinase C activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000008C2_dom
IPR020454DAG/PE-bd
IPR000719Prot_kinase_dom
IPR000961AGC-kinase_C
IPR002219PE/DAG-bd
IPR014375Protein_kinase_C_a/b/g
IPR017892Pkinase_C
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0035556intracellular signal transduction
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainPRINTSPR00360C2DOMAINcoord: 184..196
score: 52.59
coord: 212..225
score: 52.33
coord: 235..243
score: 47.16
IPR000008C2 domainSMARTSM00239C2_3ccoord: 168..270
e-value: 8.7E-25
score: 98.3
IPR000008C2 domainPFAMPF00168C2coord: 167..272
e-value: 2.3E-27
score: 95.3
IPR000008C2 domainPROSITEPS50004C2coord: 168..255
score: 20.935
IPR020454Diacylglycerol/phorbol-ester bindingPRINTSPR00008DAGPEDOMAINcoord: 136..148
score: 47.98
coord: 47..56
score: 56.83
coord: 31..45
score: 40.13
coord: 60..71
score: 46.95
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 593..656
e-value: 9.6E-23
score: 91.6
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 593..663
score: 17.754
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 334..592
e-value: 3.9E-95
score: 332.0
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 338..578
e-value: 2.3E-65
score: 220.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 334..592
score: 48.386
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainSMARTSM00109c1_12coord: 98..147
e-value: 5.2E-16
score: 69.2
coord: 34..83
e-value: 2.4E-13
score: 60.3
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPFAMPF00130C1_1coord: 34..85
e-value: 1.8E-15
score: 56.6
coord: 98..149
e-value: 1.8E-16
score: 59.7
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS00479ZF_DAG_PE_1coord: 98..147
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 33..83
score: 15.518
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainPROSITEPS50081ZF_DAG_PE_2coord: 97..147
score: 15.935
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainCDDcd00029C1coord: 34..83
e-value: 2.6447E-17
score: 74.0655
IPR002219Protein kinase C-like, phorbol ester/diacylglycerol-binding domainCDDcd00029C1coord: 98..147
e-value: 2.39899E-17
score: 74.0655
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 332..649
e-value: 1.2E-138
score: 463.5
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 91..147
e-value: 1.4E-22
score: 81.2
NoneNo IPR availableGENE3DG3DSA:3.30.60.20coord: 18..86
e-value: 1.7E-23
score: 84.1
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 418..623
e-value: 1.2E-138
score: 463.5
NoneNo IPR availablePANTHERPTHR24356:SF193PROTEIN KINASE C ALPHA TYPEcoord: 26..661
NoneNo IPR availablePANTHERPTHR24356SERINE/THREONINE-PROTEIN KINASEcoord: 26..661
NoneNo IPR availableCDDcd04026C2_PKC_alpha_gammacoord: 155..284
e-value: 1.81853E-81
score: 251.412
NoneNo IPR availableCDDcd05587STKc_cPKCcoord: 337..656
e-value: 0.0
score: 683.737
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 95..150
NoneNo IPR availableSUPERFAMILYSSF57889Cysteine-rich domaincoord: 19..85
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 153..278
IPR017892Protein kinase, C-terminalPFAMPF00433Pkinase_Ccoord: 613..654
e-value: 5.9E-8
score: 33.3
IPR014375Protein kinase C, alpha/beta/gamma typesPIRSFPIRSF000550PKC_alphacoord: 1..663
e-value: 0.0
score: 1151.8
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 150..290
e-value: 1.7E-45
score: 156.1
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 340..363
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 454..466
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 331..657