Protein Abitram

Overview
NameProtein Abitram
Smed IDSMED30007479
Length (bp)585
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein Abitram (SMED30007479) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein Abitram (SMED30007479) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein Abitram (SMED30007479) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein Abitram (SMED30007479) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007479

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007479h1SMcG0016232 SmedASXL_019481SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein Abitram vs. Ensembl Human
Match: ABITRAM (actin binding transcription modulator [Source:HGNC Symbol;Acc:HGNC:1364])

HSP 1 Score: 101.679 bits (252), Expect = 8.866e-27
Identity = 55/156 (35.26%), Postives = 96/156 (61.54%), Query Frame = 3
Query:   81 FLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
             ++ YF   +  D+ G    D CIL HSN++CV+TLA+SH +    +  +++S+ +Q   N +RL N+V GK K+G QF++   + L K+    G+  T+   +RG+L+E+N+ +L  P +L +   TEG++ +++PK EE   I + LL++ +YE
Sbjct:   15 LVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQ--SGKTIKSISYQISTNCSRLQNKVSGKFKRGAQFLT-ELAPLCKIYCSDGEEYTVSSCVRGRLMEVNENILHKPSILQEKPSTEGYIAVVLPKFEESKSITEGLLTQKQYE 167          
BLAST of Protein Abitram vs. Ensembl Human
Match: ABITRAM (actin binding transcription modulator [Source:HGNC Symbol;Acc:HGNC:1364])

HSP 1 Score: 74.3294 bits (181), Expect = 9.789e-17
Identity = 44/131 (33.59%), Postives = 81/131 (61.83%), Query Frame = 3
Query:  153 LMHS---NKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSR 536
            ++HS     +CV+TLA+SH +    +  +++S+ +Q   N +RL N+V GK K+G QF++   + L K+    G+  T+   +RG+L+E+N+ +L  P +L +   TEG++ +++PK EE   I + LL++
Sbjct:    1 ILHSLVQTGICVITLAESHPVLQ--SGKTIKSISYQISTNCSRLQNKVSGKFKRGAQFLT-ELAPLCKIYCSDGEEYTVSSCVRGRLMEVNENILHKPSILQEKPSTEGYIAVVLPKFEESKSITEGLLTQ 128          
BLAST of Protein Abitram vs. Ensembl Human
Match: ABITRAM (actin binding transcription modulator [Source:HGNC Symbol;Acc:HGNC:1364])

HSP 1 Score: 55.0694 bits (131), Expect = 1.541e-9
Identity = 25/69 (36.23%), Postives = 42/69 (60.87%), Query Frame = 3
Query:   81 FLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEV 287
             ++ YF   +  D+ G    D CIL HSN++CV+TLA+SH +    +  +++S+ +Q   N +RL N+V
Sbjct:   15 LVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQ--SGKTIKSISYQISTNCSRLQNKV 81          
BLAST of Protein Abitram vs. Ensembl Fly
Match: CG9288 (gene:FBgn0260464 transcript:FBtr0082829)

HSP 1 Score: 77.7962 bits (190), Expect = 1.257e-17
Identity = 47/133 (35.34%), Postives = 73/133 (54.89%), Query Frame = 3
Query:  150 ILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
            +L HSN++C++ LA  H    +     + SV+F  G N +R  N V     K G  I   ES+L  +   +G    +P  IRGKL+E+N  ++ +P LL +     G+  I++PK+E  D IK SLL++ +YE
Sbjct:   59 VLYHSNRICLICLAPEHPALAQ----GISSVNFDIG-NVDRSQN-VVKGKGKKGGMILQAESTLALLTTANGGTYKVPSCIRGKLVEVNTAIVEEPKLLEQLPEGAGYFAILLPKIENCDAIKASLLTQEQYE 185          
BLAST of Protein Abitram vs. Ensembl Zebrafish
Match: abitram (actin binding transcription modulator [Source:NCBI gene;Acc:560419])

HSP 1 Score: 103.219 bits (256), Expect = 1.742e-27
Identity = 60/161 (37.27%), Postives = 100/161 (62.11%), Query Frame = 3
Query:   66 KESYHFLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
            K++   ++ YF   +  D+ G    D CIL HSN++CV+TLA+SH +F   N   ++++++Q     +RL N+V GK K+GGQF++   + L ++        TI   IRG+LLE+N+ +L+ P LL++   TEG++ +I+PK EE   + + LL+R +YE
Sbjct:    7 KKAPSVIDRYFTRWYRTDLKGKPCEDHCILQHSNRICVITLAESHPIFQ--NGRKIKNINYQISDGCSRLKNKVSGKSKRGGQFLTEF-APLCRITCTDEQEFTIFSCIRGRLLEVNEVILNKPDLLMEKPSTEGYIAVILPKFEESKSVTEGLLTREQYE 164          
BLAST of Protein Abitram vs. Ensembl Xenopus
Match: mtmr9 (myotubularin related protein 9 [Source:Xenbase;Acc:XB-GENE-1000525])

HSP 1 Score: 107.457 bits (267), Expect = 4.798e-29
Identity = 58/155 (37.42%), Postives = 98/155 (63.23%), Query Frame = 3
Query:   84 LEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
            ++ YF+  +  D+ G    D CIL HSN++C++TLA+ H L    N  +++++ +Q   N +RL N+V GK K+G QF++ + + L ++    G+  TI   IRG+LLE+N+ +L +P LL +   TEG++ +++PK EE   + + LLS+ EYE
Sbjct:   15 VDRYFKRWYKSDVKGKPCEDHCILQHSNRICIITLAECHPLLQ--NGKTIKTISYQISANCSRLQNKVSGKSKRGAQFLTEH-APLCRISSTDGEEYTIYSCIRGRLLEVNENILQNPELLKEKPSTEGYIAVVLPKFEESKTVTEGLLSQQEYE 166          
BLAST of Protein Abitram vs. Ensembl Xenopus
Match: mtmr9 (myotubularin related protein 9 [Source:Xenbase;Acc:XB-GENE-1000525])

HSP 1 Score: 85.1149 bits (209), Expect = 7.210e-20
Identity = 58/207 (28.02%), Postives = 97/207 (46.86%), Query Frame = 3
Query:   84 LEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESS----------------------------------------------------LLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
            ++ YF+  +  D+ G    D CIL HSN++C++TLA+ H L    N  +++++ +Q   N +RL N+V GK K+G  FI   +++                                                    L ++    G+  TI   IRG+LLE+N+ +L +P LL +   TEG++ +++PK EE   + + LLS+ EYE
Sbjct:   15 VDRYFKRWYKSDVKGKPCEDHCILQHSNRICIITLAECHPLLQ--NGKTIKTISYQISANCSRLQNKVSGKSKRGRPFIFQQDNARPHSASITTSWLRRRRIRVLKWPVCSPDLSPIENIWHIIQRKGAQFLTEHAPLCRISSTDGEEYTIYSCIRGRLLEVNENILQNPELLKEKPSTEGYIAVVLPKFEESKTVTEGLLSQQEYE 219          
BLAST of Protein Abitram vs. Ensembl Mouse
Match: Abitram (actin binding transcription modulator [Source:MGI Symbol;Acc:MGI:2677850])

HSP 1 Score: 102.064 bits (253), Expect = 7.225e-27
Identity = 55/156 (35.26%), Postives = 94/156 (60.26%), Query Frame = 3
Query:   81 FLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
             ++ YF   +  D+ G    D CIL HSN++CV+TLA SH +    +  +++ + +Q   N +RL N+V GK K+G QF++   + L K+    G+  TI   +RG+L+E+N+ +L  P LL +   TEG++ +++PK EE   + + LL++ +YE
Sbjct:   27 LVDRYFTRWYKADVKGKPCEDHCILQHSNRICVITLAGSHPVLQ--SGKAIQRISYQISNNCSRLENKVSGKFKRGAQFLT-ELAPLCKIYCSDGEEYTISSCVRGRLMEVNENILHQPSLLQEKPSTEGYIAVVLPKFEESKSVTEGLLTQQQYE 179          
BLAST of Protein Abitram vs. Ensembl Mouse
Match: Abitram (actin binding transcription modulator [Source:MGI Symbol;Acc:MGI:2677850])

HSP 1 Score: 53.9138 bits (128), Expect = 1.785e-9
Identity = 24/69 (34.78%), Postives = 40/69 (57.97%), Query Frame = 3
Query:   81 FLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEV 287
             ++ YF   +  D+ G    D CIL HSN++CV+TLA SH +    +  +++ + +Q   N +RL N+V
Sbjct:   25 LVDRYFTRWYKADVKGKPCEDHCILQHSNRICVITLAGSHPVLQ--SGKAIQRISYQISNNCSRLENKV 91          
BLAST of Protein Abitram vs. UniProt/SwissProt
Match: sp|Q6GR35|ABITM_XENLA (Protein Abitram OS=Xenopus laevis OX=8355 GN=abitram PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.867e-29
Identity = 62/155 (40.00%), Postives = 97/155 (62.58%), Query Frame = 3
Query:   84 LEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
            ++ YF   +  DI G    D CIL HSN++C++TLA+ H L    NE +++S+ +Q   N +RL N+V GK K+G QF++   + L ++    G+  TI   IRG+LLE+N+ +L +P LL +   TEG++ +++PK EE   I + LLS+ EYE
Sbjct:   14 VDRYFTRWYKPDIKGKPCEDHCILQHSNRICIITLAECHPLLQ--NEKTIKSISYQISANCSRLQNKVSGKSKRGAQFLT-ELAPLCRISSTDGEEYTIYSCIRGRLLEVNENILQNPGLLKEKPSTEGYIAVVLPKFEESKTITEGLLSQREYE 165          
BLAST of Protein Abitram vs. UniProt/SwissProt
Match: sp|Q5ZHW7|ABITM_CHICK (Protein Abitram OS=Gallus gallus OX=9031 GN=ABITRAM PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.003e-28
Identity = 57/153 (37.25%), Postives = 95/153 (62.09%), Query Frame = 3
Query:   90 HYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
             YF   +  D+ G    D C+L HSN++CV+TLA++H L       ++ S+++Q  PN +RL N+V GK K+G QF++   + L ++    G+  TI   IRG+L+E+N+ +LS+P LL +   TEG++ +++PK EE   + + LL+  EY+
Sbjct:   11 RYFTRWYKADVKGRPCEDFCVLQHSNRICVITLAEAHPLLQP--GKTITSINYQISPNCSRLQNKVSGKSKRGAQFLT-ELAPLCRIASSDGEEYTIYSFIRGRLIEVNENILSNPALLQEKPSTEGYIAVVLPKFEESKSVTQGLLTPEEYK 160          
BLAST of Protein Abitram vs. UniProt/SwissProt
Match: sp|Q28G67|ABITM_XENTR (Protein Abitram OS=Xenopus tropicalis OX=8364 GN=abitram PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.542e-28
Identity = 58/155 (37.42%), Postives = 98/155 (63.23%), Query Frame = 3
Query:   84 LEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
            ++ YF+  +  D+ G    D CIL HSN++C++TLA+ H L    N  +++++ +Q   N +RL N+V GK K+G QF++ + + L ++    G+  TI   IRG+LLE+N+ +L +P LL +   TEG++ +++PK EE   + + LLS+ EYE
Sbjct:   15 VDRYFKRWYKSDVKGKPCEDHCILQHSNRICIITLAECHPLLQ--NGKTIKTISYQISANCSRLQNKVSGKSKRGAQFLTEH-APLCRISSTDGEEYTIYSCIRGRLLEVNENILQNPELLKEKPSTEGYIAVVLPKFEESKTVTEGLLSQQEYE 166          
BLAST of Protein Abitram vs. UniProt/SwissProt
Match: sp|Q29S16|ABITM_BOVIN (Protein Abitram OS=Bos taurus OX=9913 GN=ABITRAM PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 5.687e-27
Identity = 57/156 (36.54%), Postives = 95/156 (60.90%), Query Frame = 3
Query:   81 FLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
             ++ YF   +  D+ G    D CIL HSN++CV+TLA SH +    +  +++S+ +Q   N +RL N+V GK K+G QF++   + L K+    G+  TI   +RG+L+E+N+ +L  P +L +   TEG++ +++PK EE   I + LL++ EYE
Sbjct:   21 LVDRYFTRWYKADVKGKPCEDHCILQHSNRICVITLAGSHPVLQ--SGKTIKSISYQISTNCSRLQNKVSGKFKRGAQFLT-ELAPLCKIYCSDGEEYTISSCVRGRLMEVNENILHKPSILQEKPSTEGYIAVVLPKFEESKSITEGLLTQKEYE 173          
BLAST of Protein Abitram vs. UniProt/SwissProt
Match: sp|Q1LU93|ABITM_DANRE (Protein Abitram OS=Danio rerio OX=7955 GN=abitram PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.315e-26
Identity = 60/161 (37.27%), Postives = 100/161 (62.11%), Query Frame = 3
Query:   66 KESYHFLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
            K++   ++ YF   +  D+ G    D CIL HSN++CV+TLA+SH +F   N   ++++++Q     +RL N+V GK K+GGQF++   + L ++        TI   IRG+LLE+N+ +L+ P LL++   TEG++ +I+PK EE   + + LL+R +YE
Sbjct:    7 KKAPSVIDRYFTRWYRTDLKGKPCEDHCILQHSNRICVITLAESHPIFQ--NGRKIKNINYQISDGCSRLKNKVSGKSKRGGQFLTEF-APLCRITCTDEQEFTIFSCIRGRLLEVNEVILNKPDLLMEKPSTEGYIAVILPKFEESKSVTEGLLTREQYE 164          
BLAST of Protein Abitram vs. TrEMBL
Match: W4YPB9 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 3.242e-28
Identity = 71/156 (45.51%), Postives = 97/156 (62.18%), Query Frame = 3
Query:   81 FLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLF-DKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEY 545
            FLE YF   + ID +G    D CIL HSNK+CV+T+A  H +  DK+    VE VDFQ   NTNR++N+V GK KKG Q + S ES L KV    G   TI   I+GKL+E+N+ L S P LL++   TEG++ II+ ++ ++D   + L+S  EY
Sbjct:   23 FLERYFTAKYQIDTNGKTAEDFCILQHSNKICVITVAGGHPIVRDKMK---VEKVDFQVTANTNRMDNKVIGKNKKGAQNLQS-ESILCKVHCSGGKSYTIYSCIKGKLVEVNEILFSHPQLLVEKPNTEGYVAIILVRLSDYDSQFQRLISEDEY 174          
BLAST of Protein Abitram vs. TrEMBL
Match: A0A098M1G1 (UPF0436 protein C9orf6-like OS=Hypsiglena sp. JMG-2014 OX=1550645 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 7.428e-28
Identity = 62/154 (40.26%), Postives = 96/154 (62.34%), Query Frame = 3
Query:   87 EHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
            E YF   +  D+ G    D CIL HSN++CV+T+A +H L  K  E  ++S+ +Q   N +RL N+V GK K+G QF++   + L +++   G+  TI   IRGKL+E+N+ +L +P LL +   TEG+  +++PK EE  K+ + LL+R EYE
Sbjct:    9 ERYFTRWYKPDVKGNQCEDHCILQHSNRICVITIADAHPLLQK--EKPIKSISYQISANCSRLQNKVSGKSKRGAQFLT-ELAPLCRILCSDGEEYTIYSCIRGKLIEVNENILENPSLLQEKPSTEGYXAVVLPKFEESKKVTQGLLTREEYE 159          
BLAST of Protein Abitram vs. TrEMBL
Match: A0A493SX37 (Actin binding transcription modulator OS=Anas platyrhynchos platyrhynchos OX=8840 GN=ABITRAM PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 7.969e-28
Identity = 59/152 (38.82%), Postives = 98/152 (64.47%), Query Frame = 3
Query:   93 YFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
            YF   +  D+ G    D C+L HSN++CV+TLA++H L    N  +++S+++Q  PN +RL N+V GK K+G QF++   + L ++    G+  TI   IRG+L+E+N+ +LS+P +L +   TEG++ +++PK EE   I + LL++ EYE
Sbjct:   14 YFTRWYKPDVKGRPCEDFCVLQHSNRICVITLAEAHPLLQ--NGKTIKSINYQISPNCSRLQNKVSGKSKRGAQFLTE-LAPLCRISSTDGEEYTIYSCIRGRLIEVNENILSNPAILQEKPSTEGYIAVVLPKFEESKSITQGLLTQEEYE 162          
BLAST of Protein Abitram vs. TrEMBL
Match: A0A0B8RZG8 (UPF0436 protein C9orf6-like OS=Boiga irregularis OX=92519 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.168e-27
Identity = 62/154 (40.26%), Postives = 97/154 (62.99%), Query Frame = 3
Query:   87 EHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
            E YF   +  D+ G    D CIL HSN++CV+T+A +H L  K  E  ++S+ +Q   N +RL N+V GK K+G QF++   + L +++   G+  TI   IRGKL+E+N+ +L +P LL +   TEG++ +++PK EE  K+ + LL+R EYE
Sbjct:    9 ERYFTRWYKPDVKGNQCEDHCILQHSNRICVITIADAHPLLQK--EKPIKSISYQISANCSRLQNKVSGKSKRGAQFLT-ELAPLCRILCLDGEEYTIYSCIRGKLIEVNENILENPSLLKEKPSTEGYIAVVLPKFEESKKVTQGLLTREEYE 159          
BLAST of Protein Abitram vs. TrEMBL
Match: A0A3P9AJU0 (Actin binding transcription modulator OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.259e-27
Identity = 62/156 (39.74%), Postives = 99/156 (63.46%), Query Frame = 3
Query:   81 FLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
             ++ Y+   +  DI G N  D C+L HSN++CV+TLA+SH +    N ++++S+++Q     +RL N+V GK K+GGQF++   + L ++    G   TI   IRG+LLE+N+ +L  P LL++   TEG++ +I+PK+EE   +   LLSR EYE
Sbjct:   12 VIDRYYTRWYKTDIKGKNCEDQCVLQHSNRICVITLAESHPILQ--NGNTIKSINYQISAGCSRLQNKVSGKSKRGGQFLTE-LAPLCRITCTEGVEYTIYSCIRGRLLEVNEGILERPELLLEKPSTEGYIAVILPKLEESKTVTNGLLSREEYE 164          
BLAST of Protein Abitram vs. Ensembl Cavefish
Match: abitram (actin binding transcription modulator [Source:NCBI gene;Acc:560419])

HSP 1 Score: 93.5893 bits (231), Expect = 7.172e-24
Identity = 55/161 (34.16%), Postives = 97/161 (60.25%), Query Frame = 3
Query:   66 KESYHFLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
            K +    + Y+   +  D+ G    D CIL HSN++C++TLA++H +    N   +++++++     +RLNN+V GK K+GGQF++   + L ++        T+   IRG+LLE+N+ +L  P LL++   T+G++ +I+PK+EE   I   LL+R +YE
Sbjct:   10 KTAPSVTDRYYTRWYKTDMKGKPCEDHCILQHSNRICLITLAETHPILQ--NGRKIKNINYKISDGCSRLNNKVSGKSKRGGQFLTEF-APLCRITCTDNMEYTVFSCIRGRLLEVNEDILKHPDLLLEKPSTDGYIAVILPKLEESKSITNGLLTREQYE 167          
BLAST of Protein Abitram vs. Ensembl Nematostella
Match: EDO33701 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRF3])

HSP 1 Score: 97.0561 bits (240), Expect = 2.159e-25
Identity = 57/159 (35.85%), Postives = 97/159 (61.01%), Query Frame = 3
Query:   84 LEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYEIQRD 560
            ++ YF  G++ D++G    D C+L+HSNK+CVVT++  H L  +  + ++ S++FQ     NRL+N V GK KKG Q++  +++ L +V   +G   T+   I+GKL+E+N+ LL  P L+     T+GF+ +++PK+ E ++    LLS   Y +  D
Sbjct:   19 VDRYFSRGYMTDVNGRCGEDQCVLLHSNKICVVTVSPEHPLVKE--KCAITSINFQISSKINRLDNHVSGKSKKGAQWMMPDDA-LCEVTCSNGTTYTLNSCIKGKLVEINQELLKTPELIKLKPETDGFIAVVLPKLTEVNEYFDKLLSPESYRLLLD 174          
BLAST of Protein Abitram vs. Ensembl Medaka
Match: abitram (actin binding transcription modulator [Source:NCBI gene;Acc:101170601])

HSP 1 Score: 103.219 bits (256), Expect = 1.558e-27
Identity = 60/160 (37.50%), Postives = 100/160 (62.50%), Query Frame = 3
Query:   69 ESYHFLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYE 548
            E    ++ Y+   +  D+ G    D CIL HSN++CVVTLA++H +    N  +++++++Q     +RLNN+V GK K+GGQF++ + + L ++        TI   IRG+LLE+N+ +L  P LL++   TEG++ +I+PK EE   + ++LLSR E+E
Sbjct:   12 EPPSIIDRYYTRWYRADMKGQPCEDHCILQHSNRICVVTLAETHPVLQ--NGRTIKTINYQISNGCSRLNNKVSGKSKRGGQFLT-DFAPLCRITCTDETKYTIYSCIRGRLLEVNENILERPNLLLEKPSTEGYIAVILPKFEESKSVTENLLSRKEFE 168          
BLAST of Protein Abitram vs. Planmine SMEST
Match: SMESG000068818.1 (SMESG000068818.1)

HSP 1 Score: 335.109 bits (858), Expect = 5.296e-119
Identity = 174/174 (100.00%), Postives = 174/174 (100.00%), Query Frame = 3
Query:   48 DNYLPAKESYHFLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVXXXXXXXXQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYEIQRDIVK 569
            DNYLPAKESYHFLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVKGKGKKGGQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYEIQRDIVK
Sbjct:    4 DNYLPAKESYHFLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTLAKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVKGKGKKGGQFISSNESSLLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIMPKVEEWDKIKKSLLSRSEYEIQRDIVK 177          
The following BLAST results are available for this feature:
BLAST of Protein Abitram vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ABITRAM8.866e-2735.26actin binding transcription modulator [Source:HGNC... [more]
ABITRAM9.789e-1733.59actin binding transcription modulator [Source:HGNC... [more]
ABITRAM1.541e-936.23actin binding transcription modulator [Source:HGNC... [more]
back to top
BLAST of Protein Abitram vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein Abitram vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG92881.257e-1735.34gene:FBgn0260464 transcript:FBtr0082829[more]
back to top
BLAST of Protein Abitram vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
abitram1.742e-2737.27actin binding transcription modulator [Source:NCBI... [more]
back to top
BLAST of Protein Abitram vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mtmr94.798e-2937.42myotubularin related protein 9 [Source:Xenbase;Acc... [more]
mtmr97.210e-2028.02myotubularin related protein 9 [Source:Xenbase;Acc... [more]
back to top
BLAST of Protein Abitram vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Abitram7.225e-2735.26actin binding transcription modulator [Source:MGI ... [more]
Abitram1.785e-934.78actin binding transcription modulator [Source:MGI ... [more]
back to top
BLAST of Protein Abitram vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6GR35|ABITM_XENLA2.867e-2940.00Protein Abitram OS=Xenopus laevis OX=8355 GN=abitr... [more]
sp|Q5ZHW7|ABITM_CHICK1.003e-2837.25Protein Abitram OS=Gallus gallus OX=9031 GN=ABITRA... [more]
sp|Q28G67|ABITM_XENTR2.542e-2837.42Protein Abitram OS=Xenopus tropicalis OX=8364 GN=a... [more]
sp|Q29S16|ABITM_BOVIN5.687e-2736.54Protein Abitram OS=Bos taurus OX=9913 GN=ABITRAM P... [more]
sp|Q1LU93|ABITM_DANRE1.315e-2637.27Protein Abitram OS=Danio rerio OX=7955 GN=abitram ... [more]
back to top
BLAST of Protein Abitram vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W4YPB93.242e-2845.51Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A098M1G17.428e-2840.26UPF0436 protein C9orf6-like OS=Hypsiglena sp. JMG-... [more]
A0A493SX377.969e-2838.82Actin binding transcription modulator OS=Anas plat... [more]
A0A0B8RZG81.168e-2740.26UPF0436 protein C9orf6-like OS=Boiga irregularis O... [more]
A0A3P9AJU03.259e-2739.74Actin binding transcription modulator OS=Esox luci... [more]
back to top
BLAST of Protein Abitram vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
abitram7.172e-2434.16actin binding transcription modulator [Source:NCBI... [more]
back to top
BLAST of Protein Abitram vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein Abitram vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein Abitram vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO337012.159e-2535.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein Abitram vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
abitram1.558e-2737.50actin binding transcription modulator [Source:NCBI... [more]
back to top
BLAST of Protein Abitram vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000068818.15.296e-119100.00SMESG000068818.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007479 ID=SMED30007479|Name=Protein Abitram|organism=Schmidtea mediterranea sexual|type=transcript|length=585bp
CGAAATTTCAAAAATCTTTTTTTAAACTGAAATAATAAATGTCTAAAGAT
AATTATCTTCCAGCTAAAGAATCATATCATTTTCTAGAACATTATTTTGA
AACTGGGTTTTTAATAGATATTGATGGAATTAATAAAAATGATTTATGCA
TATTAATGCATTCAAATAAGGTTTGTGTGGTAACTTTAGCTAAGTCTCAC
TATTTATTCGACAAACTGAATGAAGATTCCGTTGAATCAGTTGATTTTCA
ATCAGGACCAAATACTAACAGGTTAAATAATGAAGTTAAAGGCAAAGGAA
AGAAAGGTGGTCAATTTATATCATCCAACGAATCCTCTTTATTAAAAGTT
GTGATGAAAAGTGGTGATATTGTGACAATACCGTGTGGAATACGCGGTAA
ACTGTTGGAAATGAACAAACGTTTATTGTCAGATCCTTTGCTATTAATTA
AGTCAACATTAACCGAAGGATTTCTCTGCATAATTATGCCGAAAGTAGAA
GAATGGGATAAAATTAAAAAGTCTCTTTTGTCGCGATCTGAATATGAAAT
TCAGCGAGATATTGTTAAATAAAATTTGTCTTGTT
back to top

protein sequence of SMED30007479-orf-1

>SMED30007479-orf-1 ID=SMED30007479-orf-1|Name=SMED30007479-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=178bp
MSKDNYLPAKESYHFLEHYFETGFLIDIDGINKNDLCILMHSNKVCVVTL
AKSHYLFDKLNEDSVESVDFQSGPNTNRLNNEVKGKGKKGGQFISSNESS
LLKVVMKSGDIVTIPCGIRGKLLEMNKRLLSDPLLLIKSTLTEGFLCIIM
PKVEEWDKIKKSLLSRSEYEIQRDIVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0030027lamellipodium
GO:0030425dendrite
GO:0030426growth cone
GO:0032433filopodium tip
GO:0042995cell projection
GO:0005634nucleus
GO:0016607nuclear speck
Vocabulary: biological process
TermDefinition
GO:0030833regulation of actin filament polymerization
GO:0048813dendrite morphogenesis
GO:0051489regulation of filopodium assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR039169Abitram
IPR011053Single_hybrid_motif
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.40.50.100coord: 30..172
e-value: 1.2E-7
score: 33.3
IPR039169Protein AbitramPANTHERPTHR13651UNCHARACTERIZEDcoord: 10..173
IPR011053Single hybrid motifSUPERFAMILYSSF51230Single hybrid motifcoord: 34..170