cAMP-dependent protein kinase type I-alpha regulatory subunit

Overview
NamecAMP-dependent protein kinase type I-alpha regulatory subunit
Smed IDSMED30007477
Length (bp)1990
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cAMP-dependent protein kinase type I-alpha regulatory subunit (SMED30007477) t-SNE clustered cells

Violin plots show distribution of expression levels for cAMP-dependent protein kinase type I-alpha regulatory subunit (SMED30007477) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP-dependent protein kinase type I-alpha regulatory subunit (SMED30007477) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP-dependent protein kinase type I-alpha regulatory subunit (SMED30007477) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007477

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007477SMESG000069771.1 Contig2071newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007477SMESG000005937.1 Contig2071newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30007477SMESG000069771.1 dd_Smed_v4_11269_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30007477SMESG000069771.1 dd_Smed_v4_11269_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 87.0409 bits (214), Expect = 1.460e-17
Identity = 59/232 (25.43%), Postives = 117/232 (50.43%), Query Frame = 1
Query:  817 LTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSV--VLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEH-IKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGL 1503
            +TF+  DF A +E     +A +I++   S RT  +I++V  +L + ++   ++E P+ +  A V    +E++  ++VII++G    +FYFI  G   V++ +  + S          L KG+ FGE+ +++   R ++++C+   E L V REDF    ++     + ++  +F R + +   W  + L +    +     F  G ++ +D     +I  I  GSC+V++ L
Sbjct:   70 VTFDTMDFIA-EEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNYAE-PLQLLLAKVMR--FERFGRRRVIIKKGQKGNSFYFIYLGT--VAITKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWSDEKL-WQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLL 294          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 87.8113 bits (216), Expect = 1.957e-17
Identity = 59/232 (25.43%), Postives = 117/232 (50.43%), Query Frame = 1
Query:  817 LTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSV--VLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEH-IKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGL 1503
            +TF+  DF A +E     +A +I++   S RT  +I++V  +L + ++   ++E P+ +  A V    +E++  ++VII++G    +FYFI  G   V++ +  + S          L KG+ FGE+ +++   R ++++C+   E L V REDF    ++     + ++  +F R + +   W  + L +    +     F  G ++ +D     +I  I  GSC+V++ L
Sbjct:   70 VTFDTMDFIA-EEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNYAE-PLQLLLAKVMR--FERFGRRRVIIKKGQKGNSFYFIYLGT--VAITKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWSDEKL-WQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLL 294          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 87.8113 bits (216), Expect = 2.122e-17
Identity = 59/232 (25.43%), Postives = 117/232 (50.43%), Query Frame = 1
Query:  817 LTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSV--VLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEH-IKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGL 1503
            +TF+  DF A +E     +A +I++   S RT  +I++V  +L + ++   ++E P+ +  A V    +E++  ++VII++G    +FYFI  G   V++ +  + S          L KG+ FGE+ +++   R ++++C+   E L V REDF    ++     + ++  +F R + +   W  + L +    +     F  G ++ +D     +I  I  GSC+V++ L
Sbjct:   70 VTFDTMDFIA-EEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNYAE-PLQLLLAKVMR--FERFGRRRVIIKKGQKGNSFYFIYLGT--VAITKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWSDEKL-WQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLL 294          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: PRKAR1A (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9388])

HSP 1 Score: 67.3958 bits (163), Expect = 1.599e-11
Identity = 41/106 (38.68%), Postives = 55/106 (51.89%), Query Frame = 1
Query: 1036 QVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            + +I+QG    NFY I  G+T V V   NN    S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FL  V+ILE
Sbjct:  162 ETVIQQGDEGDNFYVIDQGETDVYV---NNEWATSVGE-------GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 257          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: PRKAR1A (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9388])

HSP 1 Score: 66.6254 bits (161), Expect = 3.337e-11
Identity = 53/161 (32.92%), Postives = 73/161 (45.34%), Query Frame = 1
Query: 1036 QVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEG---WP----IDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            + +I+QG    NFY I  G+T V V   NN    S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FL  V+ILE    W      DAL   +P       F  G  +       +  +II  GS  V++
Sbjct:  162 ETVIQQGDEGDNFYVIDQGETDVYV---NNEWATSVGE-------GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADAL---EP-----VQFEDGQKIVVQGEPGDEFFIILEGSAAVLQ 304          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 62.7734 bits (151), Expect = 2.643e-10
Identity = 50/161 (31.06%), Postives = 69/161 (42.86%), Query Frame = 1
Query: 1036 QVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTI---LEGWP----IDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            + II QG    NFY I  G   V V            E V  + +G SFGELAL+YG  R+A+VI   +V+L ++ R  +  I M   T     + +FL  V I   L+ W      DAL   D        F  GT +       +  +II  G   V++
Sbjct:  115 ETIIEQGEEGDNFYVIDKGTVDVYVNH----------EYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCD--------FEPGTHVVEQGQPGDEFFIILEGEANVLQ 257          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 62.3882 bits (150), Expect = 4.466e-10
Identity = 50/161 (31.06%), Postives = 69/161 (42.86%), Query Frame = 1
Query: 1036 QVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTI---LEGWP----IDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            + II QG    NFY I  G   V V            E V  + +G SFGELAL+YG  R+A+VI   +V+L ++ R  +  I M   T     + +FL  V I   L+ W      DAL   D        F  GT +       +  +II  G   V++
Sbjct:  147 ETIIEQGEEGDNFYVIDKGTVDVYVNH----------EYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCD--------FEPGTHVVEQGQPGDEFFIILEGEANVLQ 289          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 62.003 bits (149), Expect = 6.061e-10
Identity = 50/161 (31.06%), Postives = 69/161 (42.86%), Query Frame = 1
Query: 1036 QVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTI---LEGWP----IDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            + II QG    NFY I  G   V V            E V  + +G SFGELAL+YG  R+A+VI   +V+L ++ R  +  I M   T     + +FL  V I   L+ W      DAL   D        F  GT +       +  +II  G   V++
Sbjct:  157 ETIIEQGEEGDNFYVIDKGTVDVYVNH----------EYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCD--------FEPGTHVVEQGQPGDEFFIILEGEANVLQ 299          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0446099)

HSP 1 Score: 67.0106 bits (162), Expect = 4.177e-11
Identity = 63/274 (22.99%), Postives = 118/274 (43.07%), Query Frame = 1
Query: 1021 KYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFS 1842
            KY  K +II++G      Y +  G+  V V+R+        G+ ++ L      GELA++Y  +R+A++  I    L ++ R+ F  I M      + E+  FL++V I +    D L      +   T+++RG  + R  +  +  +II  G  +V                        +KQ D  +   K I     +L   D FG +++  + L   + +   +DG  C+ I++  F Q +      K RY+ +   E + + E+F++ +
Sbjct:  194 KYPAKNLIIKEGDVGSIVYVMEDGR--VEVSRE--------GKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTL-IKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVT-----------------------IKQQDTQE--EKFI----RMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKINEEFRDIN 427          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0473363)

HSP 1 Score: 66.6254 bits (161), Expect = 4.422e-11
Identity = 63/274 (22.99%), Postives = 118/274 (43.07%), Query Frame = 1
Query: 1021 KYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFS 1842
            KY  K +II++G      Y +  G+  V V+R+        G+ ++ L      GELA++Y  +R+A++  I    L ++ R+ F  I M      + E+  FL++V I +    D L      +   T+++RG  + R  +  +  +II  G  +V                        +KQ D  +   K I     +L   D FG +++  + L   + +   +DG  C+ I++  F Q +      K RY+ +   E + + E+F++ +
Sbjct:   20 KYPAKNLIIKEGDVGSIVYVMEDGR--VEVSRE--------GKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTL-IKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVT-----------------------IKQQDTQE--EKFI----RMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKINEEFRDIN 253          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0473364)

HSP 1 Score: 66.6254 bits (161), Expect = 4.422e-11
Identity = 63/274 (22.99%), Postives = 118/274 (43.07%), Query Frame = 1
Query: 1021 KYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFS 1842
            KY  K +II++G      Y +  G+  V V+R+        G+ ++ L      GELA++Y  +R+A++  I    L ++ R+ F  I M      + E+  FL++V I +    D L      +   T+++RG  + R  +  +  +II  G  +V                        +KQ D  +   K I     +L   D FG +++  + L   + +   +DG  C+ I++  F Q +      K RY+ +   E + + E+F++ +
Sbjct:   20 KYPAKNLIIKEGDVGSIVYVMEDGR--VEVSRE--------GKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTL-IKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVT-----------------------IKQQDTQE--EKFI----RMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKINEEFRDIN 253          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089310)

HSP 1 Score: 66.6254 bits (161), Expect = 5.730e-11
Identity = 63/274 (22.99%), Postives = 118/274 (43.07%), Query Frame = 1
Query: 1021 KYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFS 1842
            KY  K +II++G      Y +  G+  V V+R+        G+ ++ L      GELA++Y  +R+A++  I    L ++ R+ F  I M      + E+  FL++V I +    D L      +   T+++RG  + R  +  +  +II  G  +V                        +KQ D  +   K I     +L   D FG +++  + L   + +   +DG  C+ I++  F Q +      K RY+ +   E + + E+F++ +
Sbjct:  540 KYPAKNLIIKEGDVGSIVYVMEDGR--VEVSRE--------GKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTL-IKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVT-----------------------IKQQDTQE--EKFI----RMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKINEEFRDIN 773          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089312)

HSP 1 Score: 66.6254 bits (161), Expect = 5.730e-11
Identity = 63/274 (22.99%), Postives = 118/274 (43.07%), Query Frame = 1
Query: 1021 KYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFS 1842
            KY  K +II++G      Y +  G+  V V+R+        G+ ++ L      GELA++Y  +R+A++  I    L ++ R+ F  I M      + E+  FL++V I +    D L      +   T+++RG  + R  +  +  +II  G  +V                        +KQ D  +   K I     +L   D FG +++  + L   + +   +DG  C+ I++  F Q +      K RY+ +   E + + E+F++ +
Sbjct:  540 KYPAKNLIIKEGDVGSIVYVMEDGR--VEVSRE--------GKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTL-IKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVT-----------------------IKQQDTQE--EKFI----RMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKINEEFRDIN 773          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 68.9366 bits (167), Expect = 1.297e-11
Identity = 62/252 (24.60%), Postives = 107/252 (42.46%), Query Frame = 1
Query: 1015 YEK-YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRI--CLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVS--DGAECVAINKSFFCQNM 1755
            YE+ Y   + +I+QG    + + +  GK  V            + + +  +    +FGELA++Y   R+ASV   +NV+  ++ RE F  I    A     ++  FLR+V++L   P D L     +I  CL  Y+ +G  + R+       YII  G  KV                          Q+ ++    ++I    N L   D FG +++  +   D  S  +++  DG EC+ I++  F Q +
Sbjct:  192 YERTYQQGEYVIKQGEPGNHLFVLADGKLDVY----------QHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKL----TKIVDCLEEYYNKGDYIIREGEEGNTFYIIANGKIKVT-------------------------QSTQDHEEPQII----NTLGKGDYFGEKALISD---DVRSANIIAEEDGVECLVIDRETFSQTV 397          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkar1ab (protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) b [Source:ZFIN;Acc:ZDB-GENE-050417-238])

HSP 1 Score: 66.2402 bits (160), Expect = 4.294e-11
Identity = 41/110 (37.27%), Postives = 56/110 (50.91%), Query Frame = 1
Query: 1024 YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            Y   +++I+QG    NFY I  G+  V V   NN    S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FL  V+ILE
Sbjct:  156 YIAGEIVIQQGDEGDNFYVIDQGEMDVYV---NNEWATSIGE-------GGSFGELALIYGTPRAATVRAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 255          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 67.0106 bits (162), Expect = 5.600e-11
Identity = 67/281 (23.84%), Postives = 118/281 (41.99%), Query Frame = 1
Query: 1015 YEK-YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRI--CL-FTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVS--DGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNF 1839
            YE+ Y   + +I+QG    + + +  GK  V            + + +  +    +FGELA++Y   R+ASV   +NV+  ++ RE F  I    A     ++  FLR+V++L   P D L     +I  CL   Y+ +G  + R+       YII  G  KV +  +                          D+    I   +N L   D FG +++  +   D  S  +++  DG EC+ I++  F Q +      +L+  +Q + +     +K +NF
Sbjct:  187 YERTYQQGEYVIKQGEPGNHLFVLADGKLDVY----------QHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKL----TKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQ--------------------------DHEEPQI---INTLGKGDYFGEKALISD---DVRSANIIAEEDGVECLVIDRETFSQTV--GTFDELKKYLQSYVDSLARDDKKRNF 419          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 65.4698 bits (158), Expect = 1.643e-10
Identity = 62/253 (24.51%), Postives = 107/253 (42.29%), Query Frame = 1
Query: 1015 YEK-YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRI--CL-FTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVS--DGAECVAINKSFFCQNM 1755
            YE+ Y   + +I+QG    + + +  GK  V            + + +  +    +FGELA++Y   R+ASV   +NV+  ++ RE F  I    A     ++  FLR+V++L   P D L     +I  CL   Y+ +G  + R+       YII  G  KV                          Q+ ++    ++I    N L   D FG +++  +   D  S  +++  DG EC+ I++  F Q +
Sbjct:  192 YERTYQQGEYVIKQGEPGNHLFVLADGKLDVY----------QHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKL----TKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVT-------------------------QSTQDHEEPQII----NTLGKGDYFGEKALISD---DVRSANIIAEEDGVECLVIDRETFSQTV 398          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 65.4698 bits (158), Expect = 1.695e-10
Identity = 62/253 (24.51%), Postives = 107/253 (42.29%), Query Frame = 1
Query: 1015 YEK-YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRI--CL-FTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVS--DGAECVAINKSFFCQNM 1755
            YE+ Y   + +I+QG    + + +  GK  V            + + +  +    +FGELA++Y   R+ASV   +NV+  ++ RE F  I    A     ++  FLR+V++L   P D L     +I  CL   Y+ +G  + R+       YII  G  KV                          Q+ ++    ++I    N L   D FG +++  +   D  S  +++  DG EC+ I++  F Q +
Sbjct:  187 YERTYQQGEYVIKQGEPGNHLFVLADGKLDVY----------QHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKL----TKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVT-------------------------QSTQDHEEPQII----NTLGKGDYFGEKALISD---DVRSANIIAEEDGVECLVIDRETFSQTV 393          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: bmp4 (bone morphogenetic protein 4 [Source:Xenbase;Acc:XB-GENE-483058])

HSP 1 Score: 80.4925 bits (197), Expect = 1.238e-15
Identity = 58/219 (26.48%), Postives = 103/219 (47.03%), Query Frame = 1
Query:  901 SLRTPHQ--------IRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEH-IKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK--GLKQSPGKL 1524
            +LR P Q        IRS+++ +     +F  +   MQ  L    +Y ++   +VI+R+GH   +FYF+ SG  +++V +  + S          L KG SFGE+AL+   +R+A+V+C+   E L V R +F E  ++     E ++  +  R++ +   W   +L       C         V+ +D+   + I  +  G C+V++   L Q P  L
Sbjct:   13 ALRRPEQRSEQDIRFIRSMMMGIL----SFRRYSSQMQLMLARVVYYRRFGRGRVIVRKGHRGDSFYFVFSG--VIAVTQDVDGSSALLDPEPILLHKGASFGEVALLKDLRRNATVVCMEETEFLVVDRMEFFENKLDQELQKELKYRFQHFRSLDLFSSWSDKSLETLADH-CKAEECHHSQVMVKDTHETKNIIFVTKGRCEVLRLVHLSQCPSFL 224          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: prkar1a (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:NCBI gene;Acc:594933])

HSP 1 Score: 63.5438 bits (153), Expect = 2.911e-10
Identity = 40/110 (36.36%), Postives = 55/110 (50.00%), Query Frame = 1
Query: 1024 YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            Y   + +I+QG    NFY +  G+  V V   NN    S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FL  V+ILE
Sbjct:  119 YIAGETVIQQGDEGDNFYVVDQGEMDVYV---NNDWMTSIGE-------GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 218          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: prkar1a (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:NCBI gene;Acc:594933])

HSP 1 Score: 63.1586 bits (152), Expect = 3.440e-10
Identity = 40/110 (36.36%), Postives = 55/110 (50.00%), Query Frame = 1
Query: 1024 YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            Y   + +I+QG    NFY +  G+  V V   NN    S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FL  V+ILE
Sbjct:  129 YIAGETVIQQGDEGDNFYVVDQGEMDVYV---NNDWMTSIGE-------GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 228          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: prkar1a (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:NCBI gene;Acc:594933])

HSP 1 Score: 62.7734 bits (151), Expect = 6.111e-10
Identity = 40/110 (36.36%), Postives = 55/110 (50.00%), Query Frame = 1
Query: 1024 YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            Y   + +I+QG    NFY +  G+  V V   NN    S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FL  V+ILE
Sbjct:  166 YIAGETVIQQGDEGDNFYVVDQGEMDVYV---NNDWMTSIGE-------GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 265          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: prkar1a (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:NCBI gene;Acc:594933])

HSP 1 Score: 62.7734 bits (151), Expect = 6.684e-10
Identity = 40/110 (36.36%), Postives = 55/110 (50.00%), Query Frame = 1
Query: 1024 YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            Y   + +I+QG    NFY +  G+  V V   NN    S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FL  V+ILE
Sbjct:  149 YIAGETVIQQGDEGDNFYVVDQGEMDVYV---NNDWMTSIGE-------GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 248          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Cnbd2 (cyclic nucleotide binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1918123])

HSP 1 Score: 93.2041 bits (230), Expect = 3.130e-19
Identity = 64/230 (27.83%), Postives = 112/230 (48.70%), Query Frame = 1
Query:  817 LTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEH-IKFLRNVTILEGWPIDAL--PYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            ++F   DF A +E      A  I +   S RT  +I+ +   L + ++ +  +  S+Q  L     +E++  ++VI+++G    +FYFI  G   V++    + S          L +G SFGE+ L+    RSA+V+C+   E L V REDF+   +      E ++   F RN+ I + W  + L       RI  F+Y   G ++ +D  N  +I  IC G+C++++
Sbjct:  160 ISFVTEDF-AAQEGHFPPRAISITQKKPSWRTHQEIQDLCNIL-QALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLG--TVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSY---GQMVSKDFMNSAFITFICQGNCEILR 382          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Cnbd2 (cyclic nucleotide binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1918123])

HSP 1 Score: 89.7373 bits (221), Expect = 1.571e-18
Identity = 63/230 (27.39%), Postives = 112/230 (48.70%), Query Frame = 1
Query:  817 LTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEH-IKFLRNVTILEGWPIDALP--YDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            ++F   DF A +E      A  I +   S RT  +I+ +   + + ++ +  +  S+Q  L     +E++  ++VI+++G    +FYFI  G   V++    + S          L +G SFGE+ L+    RSA+V+C+   E L V REDF+   +      E ++   F RN+ I + W  + L       RI  F+Y   G ++ +D  N  +I  IC G+C++++
Sbjct:   43 ISFVTEDF-AAQEGHFPPRAISITQKKPSWRTHQEIQDLC-NILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLG--TVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSY---GQMVSKDFMNSAFITFICQGNCEILR 265          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Cnbd2 (cyclic nucleotide binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1918123])

HSP 1 Score: 87.4261 bits (215), Expect = 1.620e-17
Identity = 56/202 (27.72%), Postives = 101/202 (50.00%), Query Frame = 1
Query:  901 SLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEH-IKFLRNVTILEGWPIDAL--PYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            S RT  +I+ +   + + ++ +  +  S+Q  L     +E++  ++VI+++G    +FYFI  G   V++    + S          L +G SFGE+ L+    RSA+V+C+   E L V REDF+   +      E ++   F RN+ I + W  + L       RI  F+Y   G ++ +D  N  +I  IC G+C++++
Sbjct:   58 SWRTHQEIQDLC-NILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLG--TVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSY---GQMVSKDFMNSAFITFICQGNCEILR 253          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Prkar1a (protein kinase, cAMP dependent regulatory, type I, alpha [Source:MGI Symbol;Acc:MGI:104878])

HSP 1 Score: 64.3142 bits (155), Expect = 1.686e-10
Identity = 40/106 (37.74%), Postives = 54/106 (50.94%), Query Frame = 1
Query: 1036 QVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            + +I+QG    NFY I  G+  V V   NN    S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FL  V+ILE
Sbjct:  162 ETVIQQGDEGDNFYVIDQGEMDVYV---NNEWATSVGE-------GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 257          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Prkar1a (protein kinase, cAMP dependent regulatory, type I, alpha [Source:MGI Symbol;Acc:MGI:104878])

HSP 1 Score: 64.3142 bits (155), Expect = 1.686e-10
Identity = 40/106 (37.74%), Postives = 54/106 (50.94%), Query Frame = 1
Query: 1036 QVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            + +I+QG    NFY I  G+  V V   NN    S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FL  V+ILE
Sbjct:  162 ETVIQQGDEGDNFYVIDQGEMDVYV---NNEWATSVGE-------GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 257          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|Q9D5U8|CNBD2_MOUSE (Cyclic nucleotide-binding domain-containing protein 2 OS=Mus musculus OX=10090 GN=Cnbd2 PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 2.190e-18
Identity = 64/230 (27.83%), Postives = 112/230 (48.70%), Query Frame = 1
Query:  817 LTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEH-IKFLRNVTILEGWPIDAL--PYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            ++F   DF A +E      A  I +   S RT  +I+ +   L + ++ +  +  S+Q  L     +E++  ++VI+++G    +FYFI  G   V++    + S          L +G SFGE+ L+    RSA+V+C+   E L V REDF+   +      E ++   F RN+ I + W  + L       RI  F+Y   G ++ +D  N  +I  IC G+C++++
Sbjct:  160 ISFVTEDF-AAQEGHFPPRAISITQKKPSWRTHQEIQDLCNIL-QALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLG--TVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSY---GQMVSKDFMNSAFITFICQGNCEILR 382          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|Q96M20|CNBD2_HUMAN (Cyclic nucleotide-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CNBD2 PE=2 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 1.019e-16
Identity = 59/232 (25.43%), Postives = 117/232 (50.43%), Query Frame = 1
Query:  817 LTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSV--VLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEH-IKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGL 1503
            +TF+  DF A +E     +A +I++   S RT  +I++V  +L + ++   ++E P+ +  A V    +E++  ++VII++G    +FYFI  G   V++ +  + S          L KG+ FGE+ +++   R ++++C+   E L V REDF    ++     + ++  +F R + +   W  + L +    +     F  G ++ +D     +I  I  GSC+V++ L
Sbjct:   70 VTFDTMDFIA-EEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNYAE-PLQLLLAKVMR--FERFGRRRVIIKKGQKGNSFYFIYLGT--VAITKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWSDEKL-WQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLL 294          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|Q95JR6|CNBD2_MACFA (Cyclic nucleotide-binding domain-containing protein 2 OS=Macaca fascicularis OX=9541 GN=CNBD2 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.910e-16
Identity = 84/346 (24.28%), Postives = 152/346 (43.93%), Query Frame = 1
Query:  817 LTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSV--VLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGES--YGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEH-IKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGL-------------------KQSPGKLYKLRYNPLKI--EGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAF------------ELLGDKSSVTLVSDGAECVAINKSF 1740
            +TF+  DF A +E     +A +I++   S RT  +I++V  +L + ++   ++E P+ +  A V    +E++  ++VII++G    +FYFI  G    +VA  N+  G S         L+KG+ FGE  + +   R ++++C+   E L V REDF    ++     + ++  +F R + +   W  + L +    +     F  G ++ +D     +I  I  GSC+V++ L                      P K +   Y+P++   E  +K     D  S      L +L+ K  +GL+  +F            ++LG K     V    +C  IN  F
Sbjct:   70 VTFDTMDFIA-EEGHFPPKAIQIMQKKPSWRTEDEIQTVCNILQVLDSYRNYAE-PLQLLLAKVMR--FERFGRRRVIIKKGQKGNSFYFIYLG----TVAITNDEDGSSAFLDPHPKLLQKGSCFGETDIQHASLRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMDLFASWSDEKL-WQLVNMSKIERFSYGQLISKDFGESSFIMFISKGSCEVLRLLDLGASPSYHRWVWQHLELIDDRPLKTHLREYSPMERFKEFQIKSYPLQDFSS------LKLLHLKKAWGLQGTSFSRKIGTSGDTLPKMLGPKIQSRPVQ-SIKCAMINTKF 399          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|Q5REL1|KAP0_PONAB (cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Pongo abelii OX=9601 GN=PRKAR1A PE=2 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 2.420e-10
Identity = 41/106 (38.68%), Postives = 55/106 (51.89%), Query Frame = 1
Query: 1036 QVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            + +I+QG    NFY I  G+T V V   NN    S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FL  V+ILE
Sbjct:  162 ETVIQQGDEGDNFYVIDQGETDVYV---NNEWATSVGE-------GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 257          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|P10644|KAP0_HUMAN (cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.420e-10
Identity = 41/106 (38.68%), Postives = 55/106 (51.89%), Query Frame = 1
Query: 1036 QVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            + +I+QG    NFY I  G+T V V   NN    S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FL  V+ILE
Sbjct:  162 ETVIQQGDEGDNFYVIDQGETDVYV---NNEWATSVGE-------GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 257          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A267FBU3 (Cyclic nucleotide-binding domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018331g1 PE=4 SV=1)

HSP 1 Score: 447.973 bits (1151), Expect = 1.686e-143
Identity = 239/544 (43.93%), Postives = 331/544 (60.85%), Query Frame = 1
Query:  442 QISGGKSSGETPKKSTFALKFAVADFSKKLLDNEGMNISTFS---EDNEEQPD----------------------------LTSTSNFVSDYSQKYSMKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDN--------------------------------GSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFSDWSSFQKEYTTNFL 1884
            Q + G + G+ P      LK A+ADF++K+ DNEG  ISTFS   E ++  PD                            L   +  +  + +KY  K +TP++++ RA+KT+NLL+KA TT  EQT+KN+++ +TF+DI S +    + S   +L F +S ++A KE TL+ EA +IL+ H  LRT   + + +++L   VEAFSEFP +M+++LV  GWYEK+N  QVIIRQGH A NFYFIISG T VSVA K   +GE + +TVAFL+KG SFGELAL+YGGKRSA+V C + VELL+V+REDFI+IFMNL +  EPEHI FLR +T L GWPID LPYD+P++C+F YFR+G VLCRDS++ + + I+ +G C V+K L+     + +LR      +    + D +D                                  S  +YIQL VL  +DTFGLE +AF + G  + VTLVS GAEC+ INK FF ++M E Y + LR EIQ FP  + L EK Q++ +W ++ KE   NF+
Sbjct:  288 QATAGPAGGKKP-----GLKMAMADFTRKIEDNEGTEISTFSFLGEKDKPAPDEEEEVGQDSAADVGAPAFGAPIDLSRESLRQAAKQLHQHKKKY--KNMTPLNRMRRAVKTVNLLIKACTTKEEQTRKNQQRMMTFSDIASSL---AQDSQSDELNFQLSYYKAKKEMTLSPEAQEILRLHPFLRTKEMLHTAMVSLQTAVEAFSEFPTNMKQSLVKVGWYEKFNANQVIIRQGHNALNFYFIISGTTAVSVALKK-PTGEPFNKTVAFLRKGESFGELALLYGGKRSATVYCKDEVELLAVSREDFIDIFMNLESEDEPEHISFLREITTLNGWPIDQLPYDNPKVCMFAYFRKGIVLCRDSNSADSVLIVKSGHCLVMKDLQPCASTIPRLRSRQRMCDSYPVEQDTDDQRYLEFMQRDCLPEPKSGDRGGVGQSLPRVVARPSGKLYIQLKVLQRRDTFGLEPIAFRVFGGTTGVTLVSMGAECILINKEFFLKHMTEKYYQLLRREIQMFPTLESLNEKLQSYYNWDAY-KETLVNFV 819          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A267GLV4 (Cyclic nucleotide-binding domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018331g2 PE=4 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 6.428e-143
Identity = 238/544 (43.75%), Postives = 331/544 (60.85%), Query Frame = 1
Query:  442 QISGGKSSGETPKKSTFALKFAVADFSKKLLDNEGMNISTFS---EDNEEQPD----------------------------LTSTSNFVSDYSQKYSMKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDN--------------------------------GSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFSDWSSFQKEYTTNFL 1884
            Q + G + G+ P      LK A+ADF++K+ DNEG  ISTFS   E ++  PD                            L   +  +  + +KY  K +TP++++ RA+KT+NLL+KA TT  EQT+KN+++ +TF+DI S +    + S   +L F +S ++A KE TL+ EA +IL+ H  LRT   + + +++L   VEAFSEFP +M+++LV  GWYEK+N  QVIIRQGH A NFYFIISG T VSVA K   +GE + +TVAFL+KG SFGELAL+YGGKRSA+V C + VELL+V+REDFI+IFMNL +  EPEHI FLR++  L GWPID LPYD+P++C+F YFR+G VLCRDS++ + + I+ +G C V+K L+     + +LR      +    + D +D                                  S  +YIQL VL  +DTFGLE +AF + G  + VTLVS GAEC+ INK FF ++M E Y + LR EIQ FP  + L EK Q++ +W ++ KE   NF+
Sbjct:  288 QAAAGPAGGKKP-----GLKMAMADFTRKIEDNEGTEISTFSFLGEKDKPAPDEEEEVGQDSAADVGAPAFGAPIDLSRESLRQAAKQLHQHKKKY--KNMTPLNRMRRAVKTVNLLIKACTTKEEQTRKNQQRMMTFSDIASSL---AQDSQSDELNFQLSYYKAKKEMTLSPEAQEILRLHPFLRTKEMLHTAMVSLQTAVEAFSEFPTNMKQSLVKVGWYEKFNANQVIIRQGHNALNFYFIISGTTAVSVALKK-PTGEPFNKTVAFLRKGESFGELALLYGGKRSATVYCKDEVELLAVSREDFIDIFMNLESEDEPEHISFLRDIPTLNGWPIDQLPYDNPKVCMFAYFRKGIVLCRDSNSADSVLIVKSGHCLVMKDLQPCASTIPRLRSRQRMCDSYPVEQDTDDQRYLEFMQRDCLPEPKSGDRGGVGQSLPRVVARPSGKLYIQLKVLQRRDTFGLEPIAFRVFGGTTGVTLVSMGAECILINKEFFLKHMTEKYYQLLRREIQMFPTLESLNEKLQSYYNWDAY-KETLVNFV 819          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A267GJ56 (Cyclic nucleotide-binding domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018331g3 PE=4 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 1.614e-142
Identity = 238/544 (43.75%), Postives = 330/544 (60.66%), Query Frame = 1
Query:  442 QISGGKSSGETPKKSTFALKFAVADFSKKLLDNEGMNISTFS---EDNEEQPD----------------------------LTSTSNFVSDYSQKYSMKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDN--------------------------------GSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFSDWSSFQKEYTTNFL 1884
            Q + G + G+ P      LK A+ADF++K+ DNEG  ISTFS   E ++  PD                            L   +  +  + +KY  K +TP++++ RA+KT+NLL+KA TT  EQT+KN+++ +TF+DI S +    + S   +L F +S ++A KE TL+ EA +IL+ H  LRT   + + +++L   VEAFSEFP +M+++LV  GWYEK+N  QVIIRQGH A NFYFIISG T VSVA K   +GE + +TVAFL+KG SFGELAL+YGGKRSA+V C + VELL+V+REDFI+IFMNL +  EPEHI FLR +  L GWPID LPYD+P++C+F YFR+G VLCRDS++ + + I+ +G C V+K L+     + +LR      +    + D +D                                  S  +YIQL VL  +DTFGLE +AF + G  + VTLVS GAEC+ INK FF ++M E Y + LR EIQ FP  + L EK Q++ +W ++ KE   NF+
Sbjct:  288 QAAAGPAGGKKP-----GLKMAMADFTRKIEDNEGTEISTFSFLGEKDKPAPDEEEEVGQDSAADVGAPAFGAPIDLSRESLRQAAKQLHQHKKKY--KNMTPLNRMRRAVKTVNLLIKACTTKEEQTRKNQQRMMTFSDIASSL---AQDSQSDELNFQLSYYKAKKEMTLSPEAQEILRLHPFLRTKEMLHTAMVSLQTAVEAFSEFPTNMKQSLVKVGWYEKFNANQVIIRQGHNALNFYFIISGTTAVSVALKK-PTGEPFNKTVAFLRKGESFGELALLYGGKRSATVYCKDEVELLAVSREDFIDIFMNLESEDEPEHISFLREIPTLNGWPIDQLPYDNPKVCMFAYFRKGIVLCRDSNSADSVLIVKSGHCLVMKDLQPCASTIPRLRSRQRMCDSYPVEQDTDDQRYLEFMQRDCLPEPKSGDRGGVGQSLPRVVARPSGKLYIQLKVLQRRDTFGLEPIAFRVFGGTTGVTLVSMGAECILINKEFFLKHMTEKYYQLLRREIQMFPTLESLNEKLQSYYNWDAY-KETLVNFV 819          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A4E0QZQ6 (Kinesin heavy chain OS=Fasciola hepatica OX=6192 GN=D915_005000 PE=4 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 2.033e-103
Identity = 174/441 (39.46%), Postives = 259/441 (58.73%), Query Frame = 1
Query:  673 RAIKTINLLLKATTT-----SAEQTKKN--EKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKI----------------EGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFSDWSSFQKEYTTNFLC------GRHSSLR 1908
            R I    LLL+AT        AE+   N  +K   TF ++Q D+E +   +AL    FN  DF   +EKTL  +  +IL      R+   +    + L  T EAFSEFP++MQ  +V + WYE++  ++VIIRQG  A NFYFIISG  +VSV+R++ SSGE + E+VA L+ G SFGEL+L+YGGKRSA+++C   VE+L ++R DFI +FMN +  T+ EH+ FLR   ++     +AL   D  + LFTYFRR   +C+DS+  EWIY+I  G CK++K ++  P KL  +R  P K+                  + +  D++D   +  ++ L +L +   FGLE++AFE LG  +SV LVSDGAEC+AI+K FFC++ P  ++  +R ++QPFP+E+ L  K   + DW  ++++     L        R +S+R
Sbjct:    5 RRILLAGLLLRATVNIIRPEMAEEDNTNLVQKAKKTFVEMQKDIEEEWSANALG---FNKHDFLFKREKTLPFDVVRILTVPSPYRSESMLHLARVGLIATTEAFSEFPLTMQTLMVKYSWYERFENRRVIIRQGQTAINFYFIISGSMVVSVSRQDKSSGEPFEESVAILRPGQSFGELSLIYGGKRSATIVCNTKVEVLVMSRADFIRVFMNSSDATKAEHMVFLRQHPMIPDTVTEALTGADSNVFLFTYFRRDMTICQDSNTSEWIYLIKAGQCKIVKDVRLCPTKLKPVRRRPRKLTQRDDQGGKSISSMMKSSVAQSGDQDDESKEKYFVILKLLEANSIFGLETIAFESLGGTTSVALVSDGAECIAISKKFFCKHCPTVFMNWIRRQVQPFPDEKSLETKLAIYRDWRIYREQAIEECLVASDQIQARQTSMR 442          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A4Z2DPW9 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma japonicum OX=6182 GN=EWB00_010064 PE=4 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 2.244e-94
Identity = 203/537 (37.80%), Postives = 287/537 (53.45%), Query Frame = 1
Query:  493 ALKFAVADFSKKLLDNEGMNISTFS---EDNEEQPDLTSTSNFVS--------------DYSQKYSMK-ILTP---------------------------------ISKLIRAIKTIN---------LLLKAT------TTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKG--LKQS-------PGKLYKLRYNPL----KIEGLVKQNDKNDNGSKM-IYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFSDWSSFQK 1863
            +L+  + D  KK+ DNE M I TFS   E+N E+  +   SN  S              D+ Q++S   IL P                                 I   I+ I+ IN         LLL+AT          +  K   K   TF ++Q ++E K    + + L F+   F+  +EK L  +A KIL      RT   I S  +A+  T+EAFSEFPI+MQ+A++   WYEKY  +++IIRQG    NFYFIISG  +VSV+R++  +GE Y ETVAFLK G SFGELAL+YGGKRSA++IC   VELL +++++F +IFM    N E EH+ FLR + ++    +D L   D  I LFTYFRR   +C DS+   WIYI+ TG C+++K   L+Q        P    +  +N +    K E   +++ K  N + + ++I+L +L     FGLES+AFE  G  +SV+LVS+GAECVAINK FF +N P ++L  LR ++QPFP    L  K   +  W  ++K
Sbjct:  115 SLRLTLTDIMKKIEDNECMGIHTFSYLDENNVEKLPIGKESNIHSTSAITRPTSTSPTVDFHQRHSQTGILLPSSQISTSSSPSSLSEDLNNSNETIDEINEPSKFIVSSIKRIQPINAFKRIIIAGLLLRATLNLIRPIQELKDAKLRSKSAQTFVELQKNIEVKL---SCEHLGFDKFAFKINREKHLTYDAVKILTLPSKYRTESMIHSATVAVIATIEAFSEFPIAMQKAIIGKAWYEKYEARRMIIRQGQPPLNFYFIISGSVVVSVSRRDKQTGEPYEETVAFLKAGQSFGELALIYGGKRSATIICKTLVELLVMSQDEFNKIFMQNTNNNEIEHVAFLRTIPLIPNEVVDKLCQADDTILLFTYFRRNVTICIDSNQSNWIYIVKTGQCRILKDVELRQEHLKSTDRPKTSCQYHFNSMENKKKSELDHQKSTKQLNNTNVKVFIELKILEPNSVFGLESIAFEPFGGTTSVSLVSNGAECVAINKQFFVENCPTNFLNWLRSKVQPFPSVDELESKLNTYRQWKIYRK 648          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: ENSAMXT00000002114.2 (cGMP-dependent protein kinase 2-like [Source:NCBI gene;Acc:103041230])

HSP 1 Score: 65.855 bits (159), Expect = 9.877e-11
Identity = 47/182 (25.82%), Postives = 82/182 (45.05%), Query Frame = 1
Query:  976 PISMQEALVCHGWYEK-YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWP-------IDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            P   +E + C   YEK Y   Q++I++G      Y +  G  ++ V +         G+ +  ++ G +FGELA++Y  KR+A+V  +    + ++ R+ F  I M        E+  FLR+V++L+  P       +D L  D        YF +G  + R+       +II  G   V +
Sbjct:  183 PQHTREMVDC--MYEKVYTANQLVIQEGEPGNYLYVLAEG--LLEVIQN--------GKLLGQMRPGTAFGELAILYNCKRTATVKAVTQSHIWALDRQTFQSIMMRSTQARHEEYFSFLRSVSLLKDLPEEKLAKIVDCLEID--------YFDKGEYIIREGEEGNTFFIIAKGEVSVTQ 344          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: prkar1ab (cAMP-dependent protein kinase type I-alpha regulatory subunit [Source:NCBI gene;Acc:103038385])

HSP 1 Score: 64.6994 bits (156), Expect = 1.211e-10
Identity = 40/110 (36.36%), Postives = 55/110 (50.00%), Query Frame = 1
Query: 1024 YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            Y   +++I+QG    NFY I  G+  V V   NN    S GE       G SFGELAL+YG  R+A+V    N +L  + R+ +  I M         + +FL  V+ILE
Sbjct:  156 YIAGEIVIQQGDEGDNFYVIDQGEMDVYV---NNEWATSIGE-------GGSFGELALIYGTPRAATVRAKTNAKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 255          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: prkar1aa (cAMP-dependent protein kinase type I-alpha regulatory subunit [Source:NCBI gene;Acc:103047413])

HSP 1 Score: 63.929 bits (154), Expect = 1.728e-10
Identity = 41/110 (37.27%), Postives = 56/110 (50.91%), Query Frame = 1
Query: 1024 YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            Y   + +I+QG    NFY I  G+  V V   NN+   S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FL  V+ILE
Sbjct:  156 YIAGETVIQQGDEGDNFYVIDQGEMDVYV---NNAWVTSIGE-------GGSFGELALIYGTPRAATVRAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 255          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 63.929 bits (154), Expect = 3.970e-10
Identity = 63/253 (24.90%), Postives = 105/253 (41.50%), Query Frame = 1
Query: 1015 YEK-YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRI--CL-FTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSD--GAECVAINKSFFCQNM 1755
            YE+ Y   + +I+QG    + + +  G   + V + N        + +  +    +FGELA++Y   R+ASV   + V    + RE F  I    A     +H  FLR+V++L   P D L     +I  CL   Y+ +G  + R+       YII  G  KV                          Q+ K+    ++I    N L   D FG +++   +  D  S  +++D  G EC+ I++  F Q +
Sbjct:  192 YERTYQQGEFVIKQGEPGNHLFVLADGN--IDVYQNN--------KLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLT----KIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVT-------------------------QSTKDHEEPQVI----NTLQKGDYFGEKAL---ISDDVRSANIIADEDGVECLVIDRETFTQTV 398          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 63.5438 bits (153), Expect = 4.836e-10
Identity = 64/253 (25.30%), Postives = 105/253 (41.50%), Query Frame = 1
Query: 1015 YEK-YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRI--CL-FTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSD--GAECVAINKSFFCQNM 1755
            YE+ Y   + +I+QG    + + +  G   V    +NN       + +  +    +FGELA++Y   R+ASV   + V    + RE F  I    A     +H  FLR+V++L   P D L     +I  CL   Y+ +G  + R+       YII  G  KV                          Q+ K+    ++I    N L   D FG +++   +  D  S  +++D  G EC+ I++  F Q +
Sbjct:  192 YERTYQQGEFVIKQGEPGNHLFVLADGNIDVY---QNN-------KLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLT----KIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVT-------------------------QSTKDHEEPQVI----NTLQKGDYFGEKAL---ISDDVRSANIIADEDGVECLVIDRETFTQTV 398          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005682.1 (pep scaffold:Pmarinus_7.0:GL476331:764222:769958:1 gene:ENSPMAG00000005146.1 transcript:ENSPMAT00000005682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 8.005e-21
Identity = 53/187 (28.34%), Postives = 93/187 (49.73%), Query Frame = 1
Query:  940 ALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEH-IKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
             L   + +F  +   +Q  L     YEK+  ++VI+++GH  + FYF+ SG  +V+V + N+ S          L+KG  FGE+AL+    R+A+++C+   ELL V +EDF    ++     E +H   + R++ +   W  ++L       C    F  G V+  D+S  + I  +  G C V++
Sbjct:   26 GLLRGLSSFRRYTAHLQLMLAGVVRYEKFGRRRVIVKKGHYGRRFYFVFSG--LVAVTKDNDGSSAFIDPEPILLRKGAGFGEIALLKDLSRNATIVCMEETELLVVDKEDFFAYKLDQELRKEFQHRYNYFRSLELFSTWSDESLETMADH-CKIEEFNHGQVVTGDTSETKNIIFVIKGCCDVLR 209          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001825.1 (pep scaffold:Pmarinus_7.0:GL485714:520:7294:-1 gene:ENSPMAG00000001656.1 transcript:ENSPMAT00000001825.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 1.169e-9
Identity = 31/108 (28.70%), Postives = 53/108 (49.07%), Query Frame = 1
Query: 1015 YEK-YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLR 1335
            YE+ Y+P+Q +IR+G A  + Y + +           +   +  G  +  +  G  FGELA++Y  KR+A+V  +  V +  + R  F  I +        EH++FLR
Sbjct:  197 YERAYSPEQAVIREGEAGNHLYVLAAA----------SLDCQQRGTCLGHMHPGTVFGELAILYNCKRTATVKAVTAVRVWVLDRLTFQAIVIREEQARHQEHVRFLR 294          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005026.1 (pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 gene:ENSPMAG00000004571.1 transcript:ENSPMAT00000005026.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 1.458e-6
Identity = 24/68 (35.29%), Postives = 38/68 (55.88%), Query Frame = 1
Query: 1147 ETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTIL 1350
            E V  + +G SFGELAL+YG  R+A+V    +++L  + R+ +  I M         + +FL  V+IL
Sbjct:   28 ELVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSIL 95          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001198.1 (pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 gene:ENSPMAG00000001068.1 transcript:ENSPMAT00000001198.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 1.756e-6
Identity = 42/163 (25.77%), Postives = 74/163 (45.40%), Query Frame = 1
Query: 1036 QVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALP--YDDPRICL-FTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSP 1515
            + II +G +++     + G   VS            GE++  L+ G  FGELA++Y   R+A+V  + +V LL ++R  F  + M  +       IKFL+    L+  P + L   +D    C+  + F  G  +  +       Y+I  G  +V + ++ SP
Sbjct:   37 ETIIAEGDSSRRLKVDVEGLLDVS----------KQGESLCTLQPGALFGELAILYDCTRTATVKALTDVRLLYLSRHAFRSVLMRESQLRRKLIIKFLKTAKTLKNLPDEQLSKMFD----CMEESAFADGEAIVNEGEVGHIFYVILRGQVRVSQEVEGSP 185          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Yeast
Match: BCY1 (Regulatory subunit of the cyclic AMP-dependent protein kinase (PKA); PKA is a component of a signaling pathway that controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000001295])

HSP 1 Score: 53.5286 bits (127), Expect = 6.041e-8
Identity = 50/172 (29.07%), Postives = 78/172 (45.35%), Query Frame = 1
Query:  997 LVCHGWYEKYNPK-QVIIRQGHAAQNFYFIISGKTMVSV-ARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRI--CLFT-YFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            LV +   EK  PK   II+QG     FY +  G     V   K NSSG            G+SFGELALMY   R+A+V+  ++  L ++ R  F +I +  +      +   L+++ +L+        YD  ++   L T  ++ G  + R+    E  Y+I  G+  V K
Sbjct:  195 LVINCLEEKSVPKGATIIKQGDQGDYFYVVEKGTVDFYVNDNKVNSSG-----------PGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLGSSFKKRLMYDDLLKSMPVLKSLTT----YDRAKLADALDTKIYQPGETIIREGDQGENFYLIEYGAVDVSK 351          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO48124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK87])

HSP 1 Score: 207.223 bits (526), Expect = 8.879e-59
Identity = 111/302 (36.75%), Postives = 185/302 (61.26%), Query Frame = 1
Query:  631 KYSMKILTPISKLIRAIKTINLLLKATTTSAE-QTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFM---NLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKL 1524
            KY  K L P+  L R I+ + +         E +T++++  +  FT   +D E K     L    F+ S ++A ++  ++ E   IL++ +  RT  Q   V+ +L  ++ AF+E+P  +Q  L+  GWYE ++ K+ I+RQG   Q FYF++SG  +V+V  ++    +++  TV FL++G+SFGELA+++  +R ++VI    +ELL ++REDFI+IFM    +   T+P+H  FLR++  L+GWPI+ L   +P+ CLF +FR G+VL +DS++ +WIYII  GSC+V+K LK+   +L
Sbjct:   75 KYFDKNLPPVELLRRCIRLVQMFASLCQYKFEKETEESDVAHTVFTQYINDDEDKPMDGGL---AFDASFYKANRKMRVSAEVKNILQSPQEQRTEQQCAKVLFSL-RSIRAFAEYPQRIQHKLINVGWYESHSSKRAILRQGQIPQAFYFVLSGSAVVTVLGEH----DTFARTVHFLRRGDSFGELAILHDTQRQSTVISREPIELLVISREDFIDIFMLAGGIKNITDPDHQIFLRSLEFLKGWPIELLA-TNPKKCLFHFFRSGSVLVKDSNHTDWIYIIKWGSCQVLKKLKEVKSRL 367          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO37972 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE96])

HSP 1 Score: 164.466 bits (415), Expect = 2.209e-47
Identity = 79/173 (45.66%), Postives = 117/173 (67.63%), Query Frame = 1
Query:  817 LTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLR 1335
            + F+ + ++A++E  L+ +A +IL      RT  Q++  ++AL  +V AF E+P+ MQ+  V  GWYE +  K+VIIRQGH A+NFYFI+SG  +V++   +  +GE    TVA L KG+SFGELAL++   RSA+V+C  +V LL+V REDF +IFM+     EP+HI+FLR
Sbjct:    2 MAFDPNYYKAVREIKLSQDAVQILSMSPGTRTDEQLQGALVALKASVPAFGEYPLKMQQQPVKVGWYESFEAKRVIIRQGHPAENFYFILSGTALVTLLFVDPVTGEQRSNTVAVLGKGSSFGELALLHHKTRSATVLCKEDVALLAVGREDFRDIFMSYEDGKEPDHIQFLR 174          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO49748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFM7])

HSP 1 Score: 113.62 bits (283), Expect = 2.223e-29
Identity = 59/156 (37.82%), Postives = 98/156 (62.82%), Query Frame = 1
Query:  871 EAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATN-TEPEHIKFLR 1335
            E   IL      R   Q+++V+ AL +T+ +F+E P+ MQE++    W++     ++I++QGH A+NFYFI+SG   V V+  + +SG+ +  +VA L++G SFG+LA++    R+A+V+    + LL ++RED+  IFM  + +  EP HIKF R
Sbjct:    6 EVKSILSLRPEERNTEQLQTVLYAL-QTMSSFAELPLHMQESVCKVAWHQSLPANKIIVKQGHLAENFYFIMSGSVTV-VSENDPTSGQVFA-SVATLRRGASFGDLAILKNCTRTATVVSKVPIHLLVISREDYQRIFMGRSQDGMEPSHIKFCR 158          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO32932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN2])

HSP 1 Score: 95.5153 bits (236), Expect = 3.730e-23
Identity = 49/155 (31.61%), Postives = 91/155 (58.71%), Query Frame = 1
Query:  871 EAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLR 1335
            E   +LK     R+  ++  +VL + + ++ F  +P+ ++  L    +Y+ Y   +VII+QGH   +FYFI+SG  +V    ++ ++GE + + ++ +  G+SFGELALM+  +R+A++IC    E L V ++DF E++     N+    I+F+R
Sbjct:    1 EVKNVLKKLSYNRSVEEV-DMVLQIVKRMKGFQRYPMYVKRELAKVLYYDVYEQDRVIIKQGHIGVSFYFIVSGSVVVQRVEEDRTTGEKHNQIISEMTGGDSFGELALMHDIRRTATIICKERSEFLRVDKDDFNEVY---PVNSSSILIRFIR 151          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO32940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN1])

HSP 1 Score: 81.6481 bits (200), Expect = 3.589e-18
Identity = 45/154 (29.22%), Postives = 85/154 (55.19%), Query Frame = 1
Query:  871 EAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAA-QNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKF 1329
            +A  + K    LRT   I+ V+  + + ++AF ++ +  +  L    +YE++   +V+++QGH    + YFI+SG  +V VA ++ ++G+     V  +  G+SFGELAL++  KR+A++IC    E L + +  F E+   L++      + F
Sbjct:    4 KAKNLFKKPPWLRTSEDIK-VIGGVVDKLKAFKKYSVLERRGLAKVVYYEQFEDGRVVVQQGHKGISSLYFILSGAVLVQVAEEDKTTGKITEHIVGEMFAGDSFGELALLHDIKRTATIICKGRAEFLRLDKPGFDEVRRQLSSTASYPFLPF 156          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:101158535])

HSP 1 Score: 70.4774 bits (171), Expect = 3.245e-12
Identity = 62/253 (24.51%), Postives = 106/253 (41.90%), Query Frame = 1
Query: 1015 YEK-YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRI--CL-FTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSD--GAECVAINKSFFCQNM 1755
            YE+ Y   + +I+QG    + + +  GK  V            + + + ++    +FGELA++Y   R+ASV  +N V+  ++ RE F  I    A     ++  FLR+V++L   P D L     +I  CL   Y+ +G  + R+       YII  G  KV                             +     K+  I +N L   D FG +++  +   D  S  +++D  G EC+ I++  F Q +
Sbjct:  193 YERNYQQGECVIKQGEPGNHLFVLAEGKLEVF----------QHNKLLTWITVWTTFGELAILYNCTRTASVRAVNKVKTWALDREAFQNIMRRTAETRHEQYRNFLRSVSLLANLPDDKL----SKIVDCLEVEYYDKGEYIIREGEEGSTFYIIAQGKVKVT----------------------------QTTEAHKLPQI-INALQKGDYFGEKALVSD---DVRSANIIADDNGVECLVIDRETFDQTV 399          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: ENSORLT00000001298.2 (cGMP-dependent protein kinase 2 [Source:NCBI gene;Acc:101165996])

HSP 1 Score: 70.0922 bits (170), Expect = 4.429e-12
Identity = 52/178 (29.21%), Postives = 85/178 (47.75%), Query Frame = 1
Query:  976 PISMQEALVCHGWYEK-YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRI--CL-FTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            P  M+E + C   YEK Y+  Q++I++G A    Y +  G  ++ V +     GE        +  G +FGELA++Y  KR+A+V  +    + ++ R+ F  I M        E+  FLR+V++L+  P + L     RI  CL   YF +G  + R+       +II  G   V +
Sbjct:  182 PQHMREMVDC--MYEKVYSEGQLVIQEGDAGNYLYVLAEG--LLEVIQNGKLLGE--------MHPGTAFGELAILYNCKRTATVKAVLQSHIWTLERQTFQTIMMQTTQARHQEYFTFLRSVSLLKQLPEEKL----GRIVDCLEVEYFEKGEYIIREGEEGNTFFIIAKGQVTVTQ 343          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: ENSORLT00000001302.2 (cGMP-dependent protein kinase 2 [Source:NCBI gene;Acc:101165996])

HSP 1 Score: 70.0922 bits (170), Expect = 5.343e-12
Identity = 52/178 (29.21%), Postives = 85/178 (47.75%), Query Frame = 1
Query:  976 PISMQEALVCHGWYEK-YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRI--CL-FTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            P  M+E + C   YEK Y+  Q++I++G A    Y +  G  ++ V +     GE        +  G +FGELA++Y  KR+A+V  +    + ++ R+ F  I M        E+  FLR+V++L+  P + L     RI  CL   YF +G  + R+       +II  G   V +
Sbjct:  182 PQHMREMVDC--MYEKVYSEGQLVIQEGDAGNYLYVLAEG--LLEVIQNGKLLGE--------MHPGTAFGELAILYNCKRTATVKAVLQSHIWTLERQTFQTIMMQTTQARHQEYFTFLRSVSLLKQLPEEKL----GRIVDCLEVEYFEKGEYIIREGEEGNTFFIIAKGQVTVTQ 343          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: prkar1ab (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:NCBI gene;Acc:101156203])

HSP 1 Score: 65.0846 bits (157), Expect = 8.778e-11
Identity = 42/110 (38.18%), Postives = 55/110 (50.00%), Query Frame = 1
Query: 1024 YNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            Y   + +I QG    NFY I  G+  V V   NN    S GE       G SFGELAL+YG  R+A+V    NV+L  + R+ +  I M         + +FLR V+ILE
Sbjct:  157 YIAGETVILQGDEGDNFYVIDQGEMDVYV---NNEWVTSIGE-------GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLRKVSILE 256          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta [Source:NCBI gene;Acc:101155602])

HSP 1 Score: 61.2326 bits (147), Expect = 1.147e-9
Identity = 36/106 (33.96%), Postives = 54/106 (50.94%), Query Frame = 1
Query: 1036 QVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILE 1353
            + +I+QG    NFY I  G+  V V           GE V  + +G SFGELAL+YG  R+A+V    +++L  + R+ +  I M         + +FL  V+ILE
Sbjct:  161 ETVIQQGDEGDNFYVIDQGEVDVYVN----------GELVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILE 256          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000069771.1 (SMESG000069771.1)

HSP 1 Score: 1236.48 bits (3198), Expect = 0.000e+0
Identity = 620/623 (99.52%), Postives = 622/623 (99.84%), Query Frame = 1
Query:   40 MSLVLYDINGKRVDYDAVHSNWRAQRNYLDRVFLTDSESTVPRNEIQIINKLLQKYENPPDIEIGKEISNXXXXXXXXXXXXXXXXXXXXCFTEISPKQSTELLNSNLDFQQKSSNGKELSSSATEKVIGNPLDQISGGKSSGETPKKSTFALKFAVADFSKKLLDNEGMNISTFSEDNEEQPDLTSTSNFVSDYSQKYSMKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFSDWSSFQKEYTTNFLCGRHSSLR 1908
            MSLVLYDINGKRVD+DAVHSNWRAQRNYLDRVFLTDSESTVPRNEIQIINKLLQKYENPPDIEIGKEI+NLAARRLKSKSSRKTKKKLVKCFTEISPKQSTELLNSNLDFQQKSSNGKELSSSATEKVIGNPLDQISGGKSSGETPKKSTFALKFAVADFSKKLLDNEGMNISTFSEDNEEQPDLTSTSNFVSDYSQKYSMKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKD FGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFSDWSSFQKEYTTNFLCGRHSSLR
Sbjct:    1 MSLVLYDINGKRVDHDAVHSNWRAQRNYLDRVFLTDSESTVPRNEIQIINKLLQKYENPPDIEIGKEIANLAARRLKSKSSRKTKKKLVKCFTEISPKQSTELLNSNLDFQQKSSNGKELSSSATEKVIGNPLDQISGGKSSGETPKKSTFALKFAVADFSKKLLDNEGMNISTFSEDNEEQPDLTSTSNFVSDYSQKYSMKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDIFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFSDWSSFQKEYTTNFLCGRHSSLR 623          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000069771.1 (SMESG000069771.1)

HSP 1 Score: 1147.88 bits (2968), Expect = 0.000e+0
Identity = 580/583 (99.49%), Postives = 582/583 (99.83%), Query Frame = 1
Query:   40 MSLVLYDINGKRVDYDAVHSNWRAQRNYLDRVFLTDSESTVPRNEIQIINKLLQKYENPPDIEIGKEISNXXXXXXXXXXXXXXXXXXXXCFTEISPKQSTELLNSNLDFQQKSSNGKELSSSATEKVIGNPLDQISGGKSSGETPKKSTFALKFAVADFSKKLLDNEGMNISTFSEDNEEQPDLTSTSNFVSDYSQKYSMKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYE 1788
            MSLVLYDINGKRVD+DAVHSNWRAQRNYLDRVFLTDSESTVPRNEIQIINKLLQKYENPPDIEIGKEI+NLAARRLKSKSSRKTKKKLVKCFTEISPKQSTELLNSNLDFQQKSSNGKELSSSATEKVIGNPLDQISGGKSSGETPKKSTFALKFAVADFSKKLLDNEGMNISTFSEDNEEQPDLTSTSNFVSDYSQKYSMKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKD FGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYE
Sbjct:    1 MSLVLYDINGKRVDHDAVHSNWRAQRNYLDRVFLTDSESTVPRNEIQIINKLLQKYENPPDIEIGKEIANLAARRLKSKSSRKTKKKLVKCFTEISPKQSTELLNSNLDFQQKSSNGKELSSSATEKVIGNPLDQISGGKSSGETPKKSTFALKFAVADFSKKLLDNEGMNISTFSEDNEEQPDLTSTSNFVSDYSQKYSMKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDIFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYE 583          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000078298.1 (SMESG000078298.1)

HSP 1 Score: 429.869 bits (1104), Expect = 3.125e-142
Identity = 233/538 (43.31%), Postives = 327/538 (60.78%), Query Frame = 1
Query:  430 NPLDQISGGKSSGETPKKSTFALKFAVADFSKKLLDNEGMNISTFSEDNEEQPDL----------------TSTSNFVSDY-----------SQKYSMKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQ-SDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKND--------------------------------NGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFSDWSSFQK 1863
            N L+ +  G       KK  + L+  VADF+KK+ DNEGM ISTFS + E +                   +S S   +D+            +++ +K  TPI K +  I+   LL+K   TS++QT++N KK+LTF D Q ++++ K+      +  F++S F+A KE  L+ +A +I++ +   R+   + S  LA+  TVEAFSEFP++MQ +L+  GWYEK+  K++IIRQGH+A NFYFIISG T VSVAR N ++GE+Y ETVAFLKKGNSFGELALM+GGKRSA+V C  +VELL+V+REDFI+IFM+ ++N EP+HI+ LR + +L  WPID LPYDDP ICLFTYFRRGTVLC DS++  W+YI+ +G+C++IK ++ +  +         + E L  Q D ND                                NG    YIQL +L+    FGLE +AFE +G  + VTLVSDGAE VAI ++FF ++M   Y   LR E+QPFP  + L  K +NF  W+ +++
Sbjct:  118 NKLNVVDKGPQEKNADKK-VYKLQIGVADFAKKVKDNEGMGISTFSNEQETEDGENEENENSLNRKRKIMKSSLSTLRTDHYVKMLAIATTKRKEFLLKQRTPIEKFLHGIRIAMLLMKTCRTSSQQTERNNKKFLTFADYQVAEVDKKS------NGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQE---------QKEKLKHQRDSNDYFTFLTQSFTHSTKSHSKHEIPPPEIRPSKEFNGK--YYIQLKILSVGSVFGLEPMAFEFVGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPTIENLKGKLKNFYQWADYKE 637          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000046966.1 (SMESG000046966.1)

HSP 1 Score: 191.815 bits (486), Expect = 1.518e-52
Identity = 139/464 (29.96%), Postives = 229/464 (49.35%), Query Frame = 1
Query:  658 ISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGE--TVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLAT-NTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSP--GKLYK------------------LRYNPLKIEG-----------------LVKQND----KNDNGSKM--------------IYIQLNVLNSKDTFGLESVAFE-----LLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFSDWSSFQ 1860
            IS+   AIK I   L+      + T + +++YL   D  S+ +      + K L FN   F+A KE  L  E  KIL  H   RT  QI +V+  L+  + AF+E+P+ +++ L    ++ K +P++VIIRQGH A+ FYFIISG  +V++     +S + YG+  TV  L KG SFGELAL++   R+ASV+  ++++LL++ R DF  IFM ++  N  PEH+ F++++ I      D L    P   L  +++   V+  +    EW+YI+ +GSC V+K L Q P   KL +                    + P+ + G                 ++K  D    KN+  S                ++I++  L +KD +GL SV F         + +SV LVS+ AE V ++K F  Q   +  ++ +R  +  +P E++  E ++   +W  ++
Sbjct:  153 ISRFTWAIKMIIAWLRYLNHIIKITHRQQQQYLYSIDTFSETDVFDSTDSNK-LRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLS-ALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTI-----TSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQL-VKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKEL-QVPIESKLTRENTLTLNDIKCKLQCFDQYHFIPMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDSNKTSLNQKENSRNYISVFIKVADLIAKDIYGLSSVIFTSEDKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIRIEWEKYK 607          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000076149.1 (SMESG000076149.1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.104e-11
Identity = 57/206 (27.67%), Postives = 101/206 (49.03%), Query Frame = 1
Query:  886 LKTHKSLRTPHQIRSVVLALTETVEAFSE-FPISMQ-EALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIK 1497
            L T+   RT  +IR ++  + +TVEAF++ FP  M+ E   C G YE Y   +V+I Q +  Q  Y I+ GK  +    K    GE + +++ FL    +            +A  +    +E+L++ +ED++   ++  +N EP    FL+N+ I + + I    +    I +  YFR   V+  D SN  + Y++ +G+  V +
Sbjct:  242 LTTNPRFRTKSEIRQIIWFM-QTVEAFTDLFPKEMEIELARCIG-YEIYEDNRVVILQDNVPQKLYHILMGKLELIYVYKL-MQGEVH-KSMGFLTHNQTNNLTDFQNNSPSAAYFVARGQLEVLTLHKEDYLH--LSSQSNLEPIRT-FLKNLIIFKSFDISESTFQKKMIKI-QYFRNEKVITADPSNDPFFYVVKSGTVAVTR 439          
The following BLAST results are available for this feature:
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNBD21.460e-1725.43cyclic nucleotide binding domain containing 2 [Sou... [more]
CNBD21.957e-1725.43cyclic nucleotide binding domain containing 2 [Sou... [more]
CNBD22.122e-1725.43cyclic nucleotide binding domain containing 2 [Sou... [more]
PRKAR1A1.599e-1138.68protein kinase cAMP-dependent type I regulatory su... [more]
PRKAR1A3.337e-1132.92protein kinase cAMP-dependent type I regulatory su... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kin-22.643e-1031.06cAMP-dependent protein kinase regulatory subunit ... [more]
kin-24.466e-1031.06cAMP-dependent protein kinase regulatory subunit ... [more]
kin-26.061e-1031.06cAMP-dependent protein kinase regulatory subunit ... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
for4.177e-1122.99gene:FBgn0000721 transcript:FBtr0446099[more]
for4.422e-1122.99gene:FBgn0000721 transcript:FBtr0473363[more]
for4.422e-1122.99gene:FBgn0000721 transcript:FBtr0473364[more]
for5.730e-1122.99gene:FBgn0000721 transcript:FBtr0089310[more]
for5.730e-1122.99gene:FBgn0000721 transcript:FBtr0089312[more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg21.297e-1124.60protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
prkar1ab4.294e-1137.27protein kinase, cAMP-dependent, regulatory, type I... [more]
prkg25.600e-1123.84protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
prkg21.643e-1024.51protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
prkg21.695e-1024.51protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bmp41.238e-1526.48bone morphogenetic protein 4 [Source:Xenbase;Acc:X... [more]
prkar1a2.911e-1036.36protein kinase cAMP-dependent type I regulatory su... [more]
prkar1a3.440e-1036.36protein kinase cAMP-dependent type I regulatory su... [more]
prkar1a6.111e-1036.36protein kinase cAMP-dependent type I regulatory su... [more]
prkar1a6.684e-1036.36protein kinase cAMP-dependent type I regulatory su... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnbd23.130e-1927.83cyclic nucleotide binding domain containing 2 [Sou... [more]
Cnbd21.571e-1827.39cyclic nucleotide binding domain containing 2 [Sou... [more]
Cnbd21.620e-1727.72cyclic nucleotide binding domain containing 2 [Sou... [more]
Prkar1a1.686e-1037.74protein kinase, cAMP dependent regulatory, type I,... [more]
Prkar1a1.686e-1037.74protein kinase, cAMP dependent regulatory, type I,... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D5U8|CNBD2_MOUSE2.190e-1827.83Cyclic nucleotide-binding domain-containing protei... [more]
sp|Q96M20|CNBD2_HUMAN1.019e-1625.43Cyclic nucleotide-binding domain-containing protei... [more]
sp|Q95JR6|CNBD2_MACFA5.910e-1624.28Cyclic nucleotide-binding domain-containing protei... [more]
sp|Q5REL1|KAP0_PONAB2.420e-1038.68cAMP-dependent protein kinase type I-alpha regulat... [more]
sp|P10644|KAP0_HUMAN2.420e-1038.68cAMP-dependent protein kinase type I-alpha regulat... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FBU31.686e-14343.93Cyclic nucleotide-binding domain-containing protei... [more]
A0A267GLV46.428e-14343.75Cyclic nucleotide-binding domain-containing protei... [more]
A0A267GJ561.614e-14243.75Cyclic nucleotide-binding domain-containing protei... [more]
A0A4E0QZQ62.033e-10339.46Kinesin heavy chain OS=Fasciola hepatica OX=6192 G... [more]
A0A4Z2DPW92.244e-9437.80Cyclic nucleotide-binding domain-containing protei... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000002114.29.877e-1125.82cGMP-dependent protein kinase 2-like [Source:NCBI ... [more]
prkar1ab1.211e-1036.36cAMP-dependent protein kinase type I-alpha regulat... [more]
prkar1aa1.728e-1037.27cAMP-dependent protein kinase type I-alpha regulat... [more]
prkg23.970e-1024.90protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
prkg24.836e-1025.30protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000005682.18.005e-2128.34pep scaffold:Pmarinus_7.0:GL476331:764222:769958:1... [more]
ENSPMAT00000001825.11.169e-928.70pep scaffold:Pmarinus_7.0:GL485714:520:7294:-1 gen... [more]
ENSPMAT00000005026.11.458e-635.29pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 ge... [more]
ENSPMAT00000001198.11.756e-625.77pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 g... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BCY16.041e-829.07Regulatory subunit of the cyclic AMP-dependent pro... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481248.879e-5936.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379722.209e-4745.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497482.223e-2937.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329323.730e-2331.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329403.589e-1829.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg23.245e-1224.51protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
ENSORLT00000001298.24.429e-1229.21cGMP-dependent protein kinase 2 [Source:NCBI gene;... [more]
ENSORLT00000001302.25.343e-1229.21cGMP-dependent protein kinase 2 [Source:NCBI gene;... [more]
prkar1ab8.778e-1138.18protein kinase cAMP-dependent type I regulatory su... [more]
prkar1b1.147e-933.96protein kinase cAMP-dependent type I regulatory su... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069771.10.000e+099.52SMESG000069771.1[more]
SMESG000069771.10.000e+099.49SMESG000069771.1[more]
SMESG000078298.13.125e-14243.31SMESG000078298.1[more]
SMESG000046966.11.518e-5229.96SMESG000046966.1[more]
SMESG000076149.11.104e-1127.67SMESG000076149.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007477 ID=SMED30007477|Name=cAMP-dependent protein kinase type I-alpha regulatory subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1990bp
CTTTAGCAGTACTTCAATTTATTTTATAGTTTTAAAGTTATGTCGCTAGT
GCTGTATGACATCAACGGCAAACGAGTGGATTACGATGCAGTTCATTCAA
ATTGGAGAGCCCAACGCAACTATCTCGACCGAGTATTTCTCACGGATTCA
GAATCAACGGTTCCTAGGAATGAAATCCAAATTATCAACAAACTGTTACA
AAAATATGAAAATCCACCTGACATCGAAATCGGCAAAGAAATTTCAAATC
TCGCCGCTCGTCGATTGAAATCGAAAAGCTCGCGGAAAACAAAAAAGAAA
CTTGTAAAATGTTTCACTGAGATTTCACCAAAACAATCTACTGAGTTGTT
GAATTCCAATCTAGATTTTCAACAGAAATCATCGAATGGAAAAGAATTAA
GCTCTTCTGCGACAGAAAAAGTCATCGGAAATCCACTTGATCAAATCTCT
GGCGGGAAATCGAGCGGCGAAACGCCGAAAAAGTCAACATTTGCATTGAA
ATTTGCGGTGGCAGATTTTTCTAAGAAACTACTCGACAATGAAGGAATGA
ATATTTCTACGTTTAGTGAAGACAATGAAGAACAGCCAGACTTGACTTCA
ACTTCTAATTTCGTCAGTGATTACTCCCAAAAATATAGCATGAAGATCTT
AACGCCAATAAGCAAGTTGATCCGAGCTATCAAAACAATTAATCTATTAT
TGAAAGCTACAACTACAAGTGCAGAACAAACTAAAAAGAATGAGAAAAAG
TATCTGACTTTTACCGATATCCAAAGCGACATGGAATCAAAGACAAGAAT
TTCGGCGTTGAAAGATCTAACTTTTAATGTTTCGGATTTTCGAGCGCTTA
AAGAAAAAACTCTAAATATTGAGGCGGCCAAAATTTTGAAAACTCACAAA
TCATTAAGAACTCCTCATCAGATTCGTTCAGTTGTTTTAGCATTAACAGA
GACCGTCGAGGCATTTAGTGAGTTTCCCATATCAATGCAAGAAGCATTGG
TCTGTCATGGATGGTACGAAAAATATAATCCGAAGCAAGTCATTATCAGG
CAGGGTCACGCTGCTCAGAATTTTTATTTCATTATATCAGGCAAAACTAT
GGTTTCTGTGGCGAGAAAAAATAATTCGTCCGGGGAGTCTTACGGTGAGA
CAGTTGCATTTTTAAAAAAAGGCAACAGTTTTGGGGAACTAGCACTGATG
TATGGCGGCAAACGTTCCGCGAGTGTAATATGCATAAACAATGTCGAACT
TCTGTCAGTTACTCGAGAAGATTTTATAGAGATATTTATGAATTTGGCAA
CTAATACGGAACCAGAGCATATAAAATTCTTGAGAAATGTTACTATTCTT
GAAGGTTGGCCTATTGATGCCTTACCATACGACGATCCGAGGATCTGCTT
ATTCACATATTTTAGAAGGGGGACAGTGCTATGTAGGGATAGCAGCAATT
TGGAATGGATTTACATTATTTGTACCGGATCCTGCAAAGTCATTAAAGGA
CTGAAGCAATCTCCTGGAAAGCTCTATAAATTGCGATACAATCCATTAAA
AATAGAAGGATTAGTGAAACAAAATGACAAAAATGATAATGGGTCAAAAA
TGATTTATATTCAACTAAACGTTCTGAATTCAAAGGATACATTTGGGTTA
GAATCTGTAGCATTTGAATTGCTGGGGGACAAATCATCCGTAACTTTGGT
GTCAGATGGGGCAGAATGTGTTGCCATCAACAAGTCATTTTTTTGTCAAA
ACATGCCGGAATCATACTTGCGGAAACTCCGATATGAGATTCAACCGTTT
CCTGAAGAGCAAGTTCTTGCAGAAAAATTTCAAAATTTTTCCGACTGGAG
TTCATTTCAGAAAGAGTACACTACAAATTTCCTTTGTGGCAGGCACTCCT
CTCTTAGATGATATATTATTGGTGCAAATGTGATATCGATCTGTTATTGG
TGCAAATGTGATATTGATTTGTTATTGGTGCAAATGTGAT
back to top

protein sequence of SMED30007477-orf-1

>SMED30007477-orf-1 ID=SMED30007477-orf-1|Name=SMED30007477-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=624bp
MSLVLYDINGKRVDYDAVHSNWRAQRNYLDRVFLTDSESTVPRNEIQIIN
KLLQKYENPPDIEIGKEISNLAARRLKSKSSRKTKKKLVKCFTEISPKQS
TELLNSNLDFQQKSSNGKELSSSATEKVIGNPLDQISGGKSSGETPKKST
FALKFAVADFSKKLLDNEGMNISTFSEDNEEQPDLTSTSNFVSDYSQKYS
MKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMES
KTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVL
ALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIIS
GKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICIN
NVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDP
RICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRY
NPLKIEGLVKQNDKNDNGSKMIYIQLNVLNSKDTFGLESVAFELLGDKSS
VTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNF
SDWSSFQKEYTTNFLCGRHSSLR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0001772immunological synapse
GO:0005930axoneme
GO:0016020membrane
GO:0031588nucleotide-activated protein kinase complex
GO:0032991macromolecular complex
GO:0044853plasma membrane raft
GO:0000790nuclear chromatin
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005952cAMP-dependent protein kinase complex
Vocabulary: molecular function
TermDefinition
GO:0019904protein domain specific binding
GO:0031625ubiquitin protein ligase binding
GO:0034236protein kinase A catalytic subunit binding
GO:0000166nucleotide binding
GO:0004862cAMP-dependent protein kinase inhibitor activity
GO:0008603cAMP-dependent protein kinase regulator activity
GO:0030552cAMP binding
GO:0042802identical protein binding
Vocabulary: biological process
TermDefinition
GO:0046007negative regulation of activated T cell proliferation
GO:2000480negative regulation of cAMP-dependent protein kinase activity
GO:0001932regulation of protein phosphorylation
GO:0045762positive regulation of adenylate cyclase activity
GO:0045859regulation of protein kinase activity
GO:0046580negative regulation of Ras protein signal transduction
GO:0046827positive regulation of protein export from nucleus
GO:0051447negative regulation of meiotic cell cycle
GO:0071901negative regulation of protein serine/threonine kinase activity
GO:0097271protein localization to bud neck
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 308..431
e-value: 3.6E-8
score: 43.2
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 328..417
e-value: 1.5E-18
score: 66.7
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 308..433
score: 23.29
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 308..418
e-value: 1.1521E-21
score: 88.5369
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 277..422
e-value: 2.2E-31
score: 110.4
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 423..584
e-value: 5.2E-9
score: 37.7
NoneNo IPR availablePANTHERPTHR23011UNCHARACTERIZEDcoord: 256..507
coord: 525..613
NoneNo IPR availablePANTHERPTHR23011:SF31coord: 256..507
coord: 525..613
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 381..398
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 276..418
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 426..572