Coiled-coil domain-containing protein 180

Overview
NameCoiled-coil domain-containing protein 180
Smed IDSMED30007470
Length (bp)4373
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain-containing protein 180 (SMED30007470) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 180 (SMED30007470) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain-containing protein 180 (SMED30007470) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 180 (SMED30007470) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007470

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007470SMESG000039547.1 SmedASXL_016793SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30007470SMESG000039547.1 dd_Smed_v4_12302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007470SMESG000039547.1 dd_Smed_v4_12302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007470SMESG000039547.1 dd_Smed_v6_12302_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007470SMESG000039547.1 dd_Smed_v4_12302_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30007470SMESG000039547.1 dd_Smed_v4_12302_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30007470SMESG000039547.1 dd_Smed_v4_12302_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Human
Match: CCDC180 (coiled-coil domain containing 180 [Source:HGNC Symbol;Acc:HGNC:29303])

HSP 1 Score: 228.024 bits (580), Expect = 1.444e-59
Identity = 211/805 (26.21%), Postives = 364/805 (45.22%), Query Frame = 3
Query: 1818 ISAEEEHPKLNNDIFDS------------SRLEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRNDQKTYIQISVLESVVKSF-----------NCVHDRCIYLDCIKTQSXXXXX-------XXXXXXXDGTNQNKVQFSAITVLSKGGRQPSEDQGLKTIKSLLQIQNSYIGNQ--DNQIEKLNKCKDKGVSQSDNKMTQNGNXXXXXXXXXXXXXXDPK--------PINEKSKLV--------------NKNQRLEKKYLVFGDETPETTQTFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSIL-------LEKMLSECVQCLEEAETIQLKNIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTSDDIREILLTDK 4046
            +  EEEH + ++  F +             ++ I     L++ K +   F   ++KW      N    VA KI+E + EL+L  HLH+PR ++IE D+HNVR+ EL++H E++   C G+  +L      +   + +  ++ + F+ KI   E  FL  T + KL+ +      +   Y++  + ++R FR+ +E  L KLR +N +FI+  +LFS GGNFS +EI+    ++EK   RI+ VE  IM ++E +E +  D      N FE KF    VD+ F++K+ R    +Q+KIK +V+ SNSQ+  +  +++ L+++     + R + KT +    L S V+++           NC  DR    + + T +  K +        ++    +    + V   + T LS+ G+   ED  +  I+ LLQ+ N+       D    +  +      S+  ++    G V     + S    S PK        P N   K V               K  ++E+KY V GD+ P   + F   I     E  + +L  AE +YR K  R VT    + ++FDQ AE+I  K+  Y  QA  Y+  CL E   Q+   E ++   P+V + ++        +K  +   +   + E  Q +    L  +K +   KL  + G P    E+ S+  +E  RQ E   +I  + E   E     G+ F+  +   TE++LL +D ++T  D+Q++  +        LIR  +   S   ++ K +       W      E+ + +K
Sbjct:  789 VPLEEEHCRKSHSTFSAMFINDTSSAKFIEQVTIPSRLILEIKKQLRAGFFEHLEKWFDQCSLNTRVTVATKINELDSELELHLHLHQPRAQQIEKDIHNVRAAELLLHQEQLDSHCAGVTETLKKKRLMFCQFQEEQNVRSKNFRLKIYDMEHIFLNATRSQKLVTLSNTLHQELLSYVDVTQVSLRSFRQYLEESLGKLRYSNIEFIKHCRLFSEGGNFSPKEINSLCSRLEKEAARIELVESVIMLNMEKLENEYLDQANDVINKFESKFHNLSVDLIFIEKIQRLLTNLQVKIKCQVAKSNSQTNGLNFSLQQLQNKIKTCQESRGE-KTTVTTEELLSFVQTWKEKLSQRIQYLNCSLDRVSMTELVFTNTILKDQEEDSDILTSSEALEEEAKLDVVTPESFTQLSRVGKPLIEDPAVDVIRKLLQLPNTKWPTHHCDKDPSQTGRGAWACGSRGSSEAGAGGAVCSPPVLCSCPGPSSPKGFKRHRCQPENSGKKAVPSASATSAGSFTPHPKPNKMERKYRVLGDKPPPAAEDFKGIILTLLWESSENLLTVAEEFYR-KEKRPVTRPDCMCDTFDQCAENISKKILEYQSQANKYHNSCLIELRIQIRRFEELL---PQVCWLVMENFKEHHWKKFFTSVKEIRGQFEEQQKR----LEKRKDKNAQKLHLNLGHPVHFQEMESLHLSEEERQEELDSMIRMNKEKLEECTRRNGQVFITNLATFTEKFLLQLDEVVTIDDVQVARMEPPKQKLSMLIRRKLAGLSLKEESEKPLIERGSRKWPGIKPTEVTIQNK 1584          

HSP 2 Score: 68.9366 bits (167), Expect = 8.418e-11
Identity = 94/490 (19.18%), Postives = 212/490 (43.27%), Query Frame = 3
Query:  336 KNILDLPDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTESLINVSCQNLNSDLLESDAEMEIRF-QIINPSNLDNLIRENFQRLNNEREIAFDKQKQLIENNIKKILLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLNKHLDVIKSKIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLK---IIIEMQPEVCNEKTIENWISFLISMRNE---FNEGCDNFLKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYF 1784
            + +  L D I   K ++    +  E ++  +      F + +  + K+ E LI  +       L ESD EM   F ++ N +NL++   +    L ++       +KQ I+   + +   E  R   L+++L K +  I +  +    EV+R++N   + +N +++ N+++L  L   L+   + +   ++      ++ W+       L      + +E+I  P  +      L  ++   +V LQ   LK    I ++ P   ++  +  W S L S+  E   ++  C   ++  YEK     Q+ +  +   K  +L  K + ++ E   +++     ++G      E+DL  ++   E   +  + +   + K+ + +  +W+ H+ +L   E  +  ++      H  ++   E  L+ ++D++RQ S ++ L   L+K    L  +K+ Y  F    +  + +YP+++  ++  +   +  YF
Sbjct:  107 REVRGLMDTIVPEKISTSTFQRQAEHKRKSYESALASFQEEIAQVGKEMEPLIVDTGGLFLKKLTESDEEMNRLFLKVENDTNLEDYTIQALLELWDKVAGRLLLRKQEIKELDEALHSLEFSRTDKLKSVLKKYAEVIEKTSYLMRPEVYRLINEEAMVMNYALLGNRKALAQLFVNLMESTLQQELDSRHRWQGLVDTWKALKKEALLQSFSEFMASESIHTPPAV---TKELEVMLKTQNV-LQQRRLKHLCTICDLLPPSYSKTQLTEWHSSLNSLNKELDTYHVDCMMRIRLLYEK---TWQECLMHVQNCKKQLLDWKAFTEE-EAETLVNQFFFQMVGALQGKVEEDLELLDKSFETLADQTEWQSSHLFKYFQEVVQLWEAHQSELLVQELELEKRMEQHRQKHSLESQVQEAHLDRLLDQLRQQSDKETLAFHLEKVKDYLKNMKSRYECFHTLLTKEVMEYPAIMLKELNSYSSALSQYF 588          
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Human
Match: CCDC180 (coiled-coil domain containing 180 [Source:HGNC Symbol;Acc:HGNC:29303])

HSP 1 Score: 227.254 bits (578), Expect = 2.578e-59
Identity = 211/805 (26.21%), Postives = 364/805 (45.22%), Query Frame = 3
Query: 1818 ISAEEEHPKLNNDIFDS------------SRLEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRNDQKTYIQISVLESVVKSF-----------NCVHDRCIYLDCIKTQSXXXXX-------XXXXXXXDGTNQNKVQFSAITVLSKGGRQPSEDQGLKTIKSLLQIQNSYIGNQ--DNQIEKLNKCKDKGVSQSDNKMTQNGNXXXXXXXXXXXXXXDPK--------PINEKSKLV--------------NKNQRLEKKYLVFGDETPETTQTFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSIL-------LEKMLSECVQCLEEAETIQLKNIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTSDDIREILLTDK 4046
            +  EEEH + ++  F +             ++ I     L++ K +   F   ++KW      N    VA KI+E + EL+L  HLH+PR ++IE D+HNVR+ EL++H E++   C G+  +L      +   + +  ++ + F+ KI   E  FL  T + KL+ +      +   Y++  + ++R FR+ +E  L KLR +N +FI+  +LFS GGNFS +EI+    ++EK   RI+ VE  IM ++E +E +  D      N FE KF    VD+ F++K+ R    +Q+KIK +V+ SNSQ+  +  +++ L+++     + R + KT +    L S V+++           NC  DR    + + T +  K +        ++    +    + V   + T LS+ G+   ED  +  I+ LLQ+ N+       D    +  +      S+  ++    G V     + S    S PK        P N   K V               K  ++E+KY V GD+ P   + F   I     E  + +L  AE +YR K  R VT    + ++FDQ AE+I  K+  Y  QA  Y+  CL E   Q+   E ++   P+V + ++        +K  +   +   + E  Q +    L  +K +   KL  + G P    E+ S+  +E  RQ E   +I  + E   E     G+ F+  +   TE++LL +D ++T  D+Q++  +        LIR  +   S   ++ K +       W      E+ + +K
Sbjct:  833 VPLEEEHCRKSHSTFSAMFINDTSSAKFIEQVTIPSRLILEIKKQLRAGFFEHLEKWFDQCSLNTRVTVATKINELDSELELHLHLHQPRAQQIEKDIHNVRAAELLLHQEQLDSHCAGVTETLKKKRLMFCQFQEEQNVRSKNFRLKIYDMEHIFLNATRSQKLVTLSNTLHQELLSYVDVTQVSLRSFRQYLEESLGKLRYSNIEFIKHCRLFSEGGNFSPKEINSLCSRLEKEAARIELVESVIMLNMEKLENEYLDQANDVINKFESKFHNLSVDLIFIEKIQRLLTNLQVKIKCQVAKSNSQTNGLNFSLQQLQNKIKTCQESRGE-KTTVTTEELLSFVQTWKEKLSQRIQYLNCSLDRVSMTELVFTNTILKDQEEDSDILTSSEALEEEAKLDVVTPESFTQLSRVGKPLIEDPAVDVIRKLLQLPNTKWPTHHCDKDPSQTGRGAWACGSRGSSEAGAGGAVCSPPVLCSCPGPSSPKGFKRHRCQPENSGKKAVPSASATSAGSFTPHPKPNKMERKYRVLGDKPPPAAEDFKGIILTLLWESSENLLTVAEEFYR-KEKRPVTRPDCMCDTFDQCAENISKKILEYQSQANKYHNSCLIELRIQIRRFEELL---PQVCWLVMENFKEHHWKKFFTSVKEIRGQFEEQQKR----LEKRKDKNAQKLHLNLGHPVHFQEMESLHLSEEERQEELDSMIRMNKEKLEECTRRNGQVFITNLATFTEKFLLQLDEVVTIDDVQVARMEPPKQKLSMLIRRKLAGLSLKEESEKPLIERGSRKWPGIKPTEVTIQNK 1628          

HSP 2 Score: 68.5514 bits (166), Expect = 9.604e-11
Identity = 94/490 (19.18%), Postives = 212/490 (43.27%), Query Frame = 3
Query:  336 KNILDLPDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTESLINVSCQNLNSDLLESDAEMEIRF-QIINPSNLDNLIRENFQRLNNEREIAFDKQKQLIENNIKKILLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLNKHLDVIKSKIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLK---IIIEMQPEVCNEKTIENWISFLISMRNE---FNEGCDNFLKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYF 1784
            + +  L D I   K ++    +  E ++  +      F + +  + K+ E LI  +       L ESD EM   F ++ N +NL++   +    L ++       +KQ I+   + +   E  R   L+++L K +  I +  +    EV+R++N   + +N +++ N+++L  L   L+   + +   ++      ++ W+       L      + +E+I  P  +      L  ++   +V LQ   LK    I ++ P   ++  +  W S L S+  E   ++  C   ++  YEK     Q+ +  +   K  +L  K + ++ E   +++     ++G      E+DL  ++   E   +  + +   + K+ + +  +W+ H+ +L   E  +  ++      H  ++   E  L+ ++D++RQ S ++ L   L+K    L  +K+ Y  F    +  + +YP+++  ++  +   +  YF
Sbjct:  151 REVRGLMDTIVPEKISTSTFQRQAEHKRKSYESALASFQEEIAQVGKEMEPLIVDTGGLFLKKLTESDEEMNRLFLKVENDTNLEDYTIQALLELWDKVAGRLLLRKQEIKELDEALHSLEFSRTDKLKSVLKKYAEVIEKTSYLMRPEVYRLINEEAMVMNYALLGNRKALAQLFVNLMESTLQQELDSRHRWQGLVDTWKALKKEALLQSFSEFMASESIHTPPAV---TKELEVMLKTQNV-LQQRRLKHLCTICDLLPPSYSKTQLTEWHSSLNSLNKELDTYHVDCMMRIRLLYEK---TWQECLMHVQNCKKQLLDWKAFTEE-EAETLVNQFFFQMVGALQGKVEEDLELLDKSFETLADQTEWQSSHLFKYFQEVVQLWEAHQSELLVQELELEKRMEQHRQKHSLESQVQEAHLDRLLDQLRQQSDKETLAFHLEKVKDYLKNMKSRYECFHTLLTKEVMEYPAIMLKELNSYSSALSQYF 632          
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Zebrafish
Match: ccdc180 (coiled-coil domain containing 180 [Source:ZFIN;Acc:ZDB-GENE-130530-582])

HSP 1 Score: 248.44 bits (633), Expect = 6.270e-67
Identity = 195/696 (28.02%), Postives = 336/696 (48.28%), Query Frame = 3
Query: 1899 LDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRNDQKTYIQISVLESVVKSFNCVHDRCIYLDCIKTQSXXXXXXXX----XXXXDGTNQNKVQFSAITVLSKGGRQPS-------EDQGLKTIKSLLQIQNSYIGNQDN--------QIEKLNKCKDKGVSQSDNKMTQNGNXXXXXXXXXXXXXXDPKPINEKS----KLVNKNQRLEKKYLVFGDETPETTQT--FLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSILLEKMLSECVQCLEEAETIQLKNIEILSLKKT-----QYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQIS 3893
            ++++K V   F + +++   I+  N + +V  K ++   E  LR  LH+ R  RIE D+++VR+ EL  H ERV + C+GI+  L     D   L+       E F+ +I   E+ F+  T++ KL  +    +   ++ ++ ++ + RDFR+ +E +++ LR++N   +RSFKLFS GGNF+ +EI+ F  ++EK +KRID  EG ++  +E  E +  D        F EKF FH  D+ F++K+ + F   +++IK+E   SN Q ++I   +++L+    E  +   D+K    + +          +  RC YLDC    S    +P             ++++ Q +  +   +G   PS       +D  +  IKSLL++  +    +DN           +LN     G  +S   ++Q+G        +        + IN +S    K + K  R +KKYL+FG    E   +  F + I     +  D +L  AE +Y+ K  R +T S  LQE+FDQ AE+I  +L  Y  QA DY+  CL+EF +QL  +E  ++  PE++FS L ++ L E  Q +     IQ+++   L  +++     ++  +LR     P+   EL ++ E E  RQ    E I  + +     V     + V       E  L   DN++T  ++Q+ 
Sbjct:  283 VEVLKEVRQTFFSTLEERFHIILTNTTAIVEAKKEKLKAEFNLRVQLHQTRAARIEMDIYSVRAAELAHHRERVDQHCRGIQQVLENSQTDLQELQVQLNKLTEDFQMQIYKREKDFIVGTSSEKLNRLWNSLQSSLDKLISVIQISQRDFRQKIEFRMEGLRESNVQIMRSFKLFSEGGNFTPQEIEVFQSQLEKMDKRIDTAEGAVIQDMEDRESKCLDQAKDIFRRFGEKFSFHANDLKFLEKMQQIFTNTRVQIKSEALKSNMQKKMIDSMLRDLKQMTAEYYQPCPDKKIVTVVEITSLTTSLMEELKKRCQYLDCFLDASMAAPRPETPFQGAFAVAARSRSRTQETTGSPEREGLLHPSRIGASFLDDAAVGVIKSLLKVGKAQNLKEDNCDSAEQRASSARLNSPHGSG-RRSGKSLSQSG--------IETVRRKSVESINIQSSISVKRLPKLNRFDKKYLIFGSNPEEQKNSVCFKTSITGILWKANDILLMVAEEFYK-KERRPITRSEQLQETFDQCAEEIQKRLLVYQSQAHDYHNSCLQEFQQQLKAIEEFLSCVPEILFSKLRDQHLEELTQSM-----IQIQHRFKLVQQRSEQNRREHSGQLRVRLSHPACERELKALVEAEEQRQRHHREAIQHTRQELQACVIKNAEESVTAFARLAEALLFQFDNLITIHEVQVG 963          
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Xenopus
Match: ENSXETT00000013429.1 (coiled-coil domain containing 180 [Source:NCBI gene;Acc:100492567])

HSP 1 Score: 263.462 bits (672), Expect = 1.019e-70
Identity = 193/662 (29.15%), Postives = 328/662 (49.55%), Query Frame = 3
Query: 1842 KLNNDIFDSSRLEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRNDQKTYIQISVLESVVKSFNCVHDRCIYLDCIKTQSXXXXXXXXXXXXDGTNQN--------KVQFSA---ITVLSKGGRQPSEDQGLKTIKSLLQIQNSYIGNQD----NQIEKLNKCKDKGVSQSDNKMTQNGNXXXXXXXXXXXXXXDP-KPINEKS-KLVNKNQRLEKKYLVFGDETPETTQTFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSI----LLEKMLSECVQCLEE-AETIQLKNIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVI 3758
             LN+DI     + I + Q + + K V   F   ++ W      +A  +V+ K +EFN EL LR+HLHEPR +RIE D+HNVR+ ELI+HSERV + C G+  SL  +  + + L  + K +   F+ KI + E  FL    + KL+ + +      + +++ ++ +MR++R++VE  L  LR TNSDFI+SF+LFS GGNFS +E++ F +K+ KA+  I   EG IM  LE +E    +   +    FE+KF     D  F++ + +    +Q+KIK  V +SN Q++ I  +++ L+ +    +    D++T     +   V      +  R +YL C+   S    +          +++        K  F+    +   S+ G+   +D  +  IK++ + +      QD    +  ++      +  + + +  +Q+G           S   +P + +   S + + K  R +KKY +FG+   E +  F   +     E  D +LY AE +Y+ K  R +  +  LQE+F++ A+ ++FKL+ Y +QA +Y   CL EF  QL   E ++N  P ++        L+K+L+   Q  ++ AE +Q  +    +LK     S LR + G P     L  +C+ E  RQ EE E I
Sbjct:  732 PLNHDI-----MVIPEQQLIVIRKSVRLGFFEHLETWFGETLSSAQGIVSAKKEEFNSELALRYHLHEPRSQRIEMDIHNVRAAELILHSERVDRHCDGVSHSLEQLKRESSVLIENMKQQTLGFRSKIRAMESMFLGANKSDKLVALTQSLPSILDSHVSGVQTSMRNYRQHVEEMLGTLRDTNSDFIKSFRLFSEGGNFSPDEVEVFRKKLHKASDTIASFEGSIMVDLEGLESVCLEQATEIVKKFEDKFNMLTTDAIFLENIQKLLTNLQVKIKALVVSSNFQTQQINSSLEQLQQKTDACAHPNMDKETVTAEELYSFVQIPMGQLAKRSLYLSCLLEPSQILSETPLQGPIATASRSDTPLRQDAKGTFTTPDNLLTPSRVGKLALDDPAVSVIKNITRTKRVMDSQQDSDRASSYQRPGTVSHQAAAIAPHPPSQSGKPHLKKKKPPSSNGENPGQSVQAPSVRKLTKPSRFDKKYQLFGENRVE-SDNFKGILTCILWESNDTLLYLAEEFYKKKDRRNIGRTDLLQETFEECADTLVFKLQSYEKQALEYQNNCLLEFREQLQTFERLVNEVPPLVIESHRRQHLDKLLAATDQIRKQFAEDLQRWDQAKETLK-----SVLRPNLGHPDSEQALGELCQQEELRQREEAEGI 1382          

HSP 2 Score: 132.494 bits (332), Expect = 2.719e-30
Identity = 129/570 (22.63%), Postives = 257/570 (45.09%), Query Frame = 3
Query:  171 LSCDKVNRQLFDSEVQLINALQNIKFKGKE---AIKNSNYMNIKG---------SNSTNFDIV------------DLDEKNILDLPDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTE-SLINVSCQNLNSDLLESDAEMEIRFQ---IINPSNLDNLIRENFQRLNNEREIAFDKQKQLIENNIKKILLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIW---QKKMLNKHLDVIKSKIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLKIIIEMQPEVCNEKTIENWISFLISMRNEFNEGCDNFLKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYFS 1787
            +   +V RQLFD+EVQL+ +L   + +  +   A+   N   I+          S+  + D +            D+  + +  L D I   K ++ ++ +I   R  +     +  ++ L  I+K+ E S++ V  ++L   + ESDA +E+ FQ   I N S     I E +  +  E      + +Q I+     +L  E +R   +  +L K ++ +  I H  PS+V R ++   + +N +I+ N  +L  L   LL   + +    +    +    W   Q++++ K   V     E E   +P ++K+ +  L   +S L  + +   L +     P  C    +  W   L ++ ++       FL+K  E  E+  QK     +  K  +++  I   + E  ++I     P+  + H  F+++  + E ++  + +   ++ + + KFL+++ +IW+  ER L K E+ + L++      +   +   E  L+ ++D++RQDS+++ L+  L K L+ L+ IK  Y  F   Q   +  YP+LV +++  +   + NYF 
Sbjct:   10 VPSGRVYRQLFDAEVQLVRSLGEARARAVQHGGAVDTGNIPPIRSRDNNTALPESHHQSTDKMTPPARKKQESEDDIAAREVRGLSDVIVPEKKDTGILERIAANRLERHEVALSNLHRELAEISKEMELSVLEVG-KHLQQKISESDANIELLFQKLEIGNDSTTTKEINETWDAVTQESA----RTRQCIKRTESTLLALEENRAKRISEVLKKYTSLLKDICHLMPSDVDRFIHNEAMMINQAILANHRALARLSVNLLEANLKRENTQRFQWQDLKKAWECYQREIIMKEFRVFA---EKEMEHIPTSVKVLVDQLTTQLSSLK-ERRLQILGLARSFVPPTCTRTGVMEWYESLAALNSQAESINKQFLEKLQELREEFCQKFEVKAESCKEQLVSVDICTPE-EAEDIITKELSPVTAQIHMKFKEEQEKWEKLLVHSSKLTILQTQKLLKFLEDVVDIWQTLERGLSKQENAVQLRMEQCRYKYDSDSKAKEANLDKILDRLRQDSTKETLRSTLGKALASLETIKAGYKTFHLDQVAVIDSYPALVLAELASYSCALSNYFG 569          
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Xenopus
Match: ENSXETT00000013488.1 (coiled-coil domain containing 180 [Source:NCBI gene;Acc:100492567])

HSP 1 Score: 263.077 bits (671), Expect = 1.236e-70
Identity = 193/662 (29.15%), Postives = 328/662 (49.55%), Query Frame = 3
Query: 1842 KLNNDIFDSSRLEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRNDQKTYIQISVLESVVKSFNCVHDRCIYLDCIKTQSXXXXXXXXXXXXDGTNQN--------KVQFSA---ITVLSKGGRQPSEDQGLKTIKSLLQIQNSYIGNQD----NQIEKLNKCKDKGVSQSDNKMTQNGNXXXXXXXXXXXXXXDP-KPINEKS-KLVNKNQRLEKKYLVFGDETPETTQTFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSI----LLEKMLSECVQCLEE-AETIQLKNIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVI 3758
             LN+DI     + I + Q + + K V   F   ++ W      +A  +V+ K +EFN EL LR+HLHEPR +RIE D+HNVR+ ELI+HSERV + C G+  SL  +  + + L  + K +   F+ KI + E  FL    + KL+ + +      + +++ ++ +MR++R++VE  L  LR TNSDFI+SF+LFS GGNFS +E++ F +K+ KA+  I   EG IM  LE +E    +   +    FE+KF     D  F++ + +    +Q+KIK  V +SN Q++ I  +++ L+ +    +    D++T     +   V      +  R +YL C+   S    +          +++        K  F+    +   S+ G+   +D  +  IK++ + +      QD    +  ++      +  + + +  +Q+G           S   +P + +   S + + K  R +KKY +FG+   E +  F   +     E  D +LY AE +Y+ K  R +  +  LQE+F++ A+ ++FKL+ Y +QA +Y   CL EF  QL   E ++N  P ++        L+K+L+   Q  ++ AE +Q  +    +LK     S LR + G P     L  +C+ E  RQ EE E I
Sbjct:  732 PLNHDI-----MVIPEQQLIVIRKSVRLGFFEHLETWFGETLSSAQGIVSAKKEEFNSELALRYHLHEPRSQRIEMDIHNVRAAELILHSERVDRHCDGVSHSLEQLKRESSVLIENMKQQTLGFRSKIRAMESMFLGANKSDKLVALTQSLPSILDSHVSGVQTSMRNYRQHVEEMLGTLRDTNSDFIKSFRLFSEGGNFSPDEVEVFRKKLHKASDTIASFEGSIMVDLEGLESVCLEQATEIVKKFEDKFNMLTTDAIFLENIQKLLTNLQVKIKALVVSSNFQTQQINSSLEQLQQKTDACAHPNMDKETVTAEELYSFVQIPMGQLAKRSLYLSCLLEPSQILSETPLQGPIATASRSDTPLRQDAKGTFTTPDNLLTPSRVGKLALDDPAVSVIKNITRTKRVMDSQQDSDRASSYQRPGTVSHQAAAIAPHPPSQSGKPHLKKKKPPSSNGENPGQSVQAPSVRKLTKPSRFDKKYQLFGENRVE-SDNFKGILTCILWESNDTLLYLAEEFYKKKDRRNIGRTDLLQETFEECADTLVFKLQSYEKQALEYQNNCLLEFREQLQTFERLVNEVPPLVIESHRRQHLDKLLAATDQIRKQFAEDLQRWDQAKETLK-----SVLRPNLGHPDSEQALGELCQQEELRQREEAEGI 1382          

HSP 2 Score: 132.109 bits (331), Expect = 4.003e-30
Identity = 129/570 (22.63%), Postives = 257/570 (45.09%), Query Frame = 3
Query:  171 LSCDKVNRQLFDSEVQLINALQNIKFKGKE---AIKNSNYMNIKG---------SNSTNFDIV------------DLDEKNILDLPDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTE-SLINVSCQNLNSDLLESDAEMEIRFQ---IINPSNLDNLIRENFQRLNNEREIAFDKQKQLIENNIKKILLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIW---QKKMLNKHLDVIKSKIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLKIIIEMQPEVCNEKTIENWISFLISMRNEFNEGCDNFLKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYFS 1787
            +   +V RQLFD+EVQL+ +L   + +  +   A+   N   I+          S+  + D +            D+  + +  L D I   K ++ ++ +I   R  +     +  ++ L  I+K+ E S++ V  ++L   + ESDA +E+ FQ   I N S     I E +  +  E      + +Q I+     +L  E +R   +  +L K ++ +  I H  PS+V R ++   + +N +I+ N  +L  L   LL   + +    +    +    W   Q++++ K   V     E E   +P ++K+ +  L   +S L  + +   L +     P  C    +  W   L ++ ++       FL+K  E  E+  QK     +  K  +++  I   + E  ++I     P+  + H  F+++  + E ++  + +   ++ + + KFL+++ +IW+  ER L K E+ + L++      +   +   E  L+ ++D++RQDS+++ L+  L K L+ L+ IK  Y  F   Q   +  YP+LV +++  +   + NYF 
Sbjct:   10 VPSGRVYRQLFDAEVQLVRSLGEARARAVQHGGAVDTGNIPPIRSRDNNTALPESHHQSTDKMTPPARKKQESEDDIAAREVRGLSDVIVPEKKDTGILERIAANRLERHEVALSNLHRELAEISKEMELSVLEVG-KHLQQKISESDANIELLFQKLEIGNDSTTTKEINETWDAVTQESA----RTRQCIKRTESTLLALEENRAKRISEVLKKYTSLLKDICHLMPSDVDRFIHNEAMMINQAILANHRALARLSVNLLEANLKRENTQRFQWQDLKKAWECYQREIIMKEFRVFA---EKEMEHIPTSVKVLVDQLTTQLSSLK-ERRLQILGLARSFVPPTCTRTGVMEWYESLAALNSQAESINKQFLEKLQELREEFCQKFEVKAESCKEQLVSVDICTPE-EAEDIITKELSPVTAQIHMKFKEEQEKWEKLLVHSSKLTILQTQKLLKFLEDVVDIWQTLERGLSKQENAVQLRMEQCRYKYDSDSKAKEANLDKILDRLRQDSTKETLRSTLGKALASLETIKAGYKTFHLDQVAVIDSYPALVLAELASYSCALSNYFG 569          
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Mouse
Match: Ccdc180 (coiled-coil domain containing 180 [Source:MGI Symbol;Acc:MGI:2685871])

HSP 1 Score: 238.039 bits (606), Expect = 8.205e-63
Identity = 228/897 (25.42%), Postives = 407/897 (45.37%), Query Frame = 3
Query: 1695 FNQQSNTMKKYPSLVESDVKKFEEKIINYFSN-----YFSMENVGNISAEEEHPKLNNDIFDS------SRLEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRNDQKTYIQISVLESV----------VKSFNCVHDRC-----IYLDCI--KTQSXXXXXXXXXXXXDGTNQNKVQFSAITVLSKGGRQPSEDQGLKTIKSLLQIQNSYIGNQDNQIEKLNKCKDKGVSQSDNKMTQNGNXXXXXXXXXXXXXXDPKPINEKSKLVNKNQRLEKKYLVFGDETPETTQTFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSI---LLEKMLSECVQCLEEAETIQLKNIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTSDDIREILLTDKNHKKFGDEALSKSLINAKHTSCHDTAILERAKTVKEFKRFYFEKL----EHHR--ILKDRRSEELDNYKTFWNESIKSLQN 4271
            + Q++  M +  S  ESD   +EE  + +F+      YF+  +V +       P  ++++ +S       ++ I     L + KG+   F   ++KW      NA  +VA K+DE + EL+LR HLH+PR +++E D+HNVR+ EL++H ER+   C G+  +L      +   + +  ++   F+ KI   E  FL  T + KL+++ K    +   Y++ ++ ++R FR+ +E  L KLR TN DF++  +LFS GGNFS EE++    ++EK   RI+ VE  IM  +E +E +  D      N FE KF     D+ F++K+ R    +Q+ IK + + SNSQ+  +  +++ L+ +       R D+       +L  V          +K  NC  D       ++ D I   T+    +  +     +      V   +    ++ GR   ED  +  ++ +LQI         +Q +    C DK  SQ+  K             ++ +  +    +    K +    R++KKY V G++     + F   I     E  + ++   E +YR K  R VT    + ESFDQ A+ I  K+  Y +QA++Y+  CL E   Q+   E ++   P+V + +     E+   +    L+E +    +  + L L+K +   KL  + G P+  S++ S+   E  RQ E   +I ++ E   E      R F+  +   TE++L+ +D ++T  DIQ+  ++        LIR  + + S   ++ K +       W      EI + +K   +      + S+   K T  H  AI  R     ++   + ++L    +H R  +L+ +R      +K  W  S+ ++Q 
Sbjct:  789 YYQETYFMGQAESREESDEIPYEE--MEFFTTTSGNTYFAFLSVEDEQQIHSRPHSHHNLLNSFCTKYIEQVSIPQKLILKVKKGLRAGFFEHLEKWFDQCVLNARIIVASKVDELDSELELRLHLHKPRLEQVEKDIHNVRAAELLLHQERLDSHCAGVIETLKKERLMFCQFQEEQAVRSRNFRRKIYDMEHIFLNATRSQKLVSLTKTLHRELLSYVDVIQVSLRSFRQYLEESLGKLRYTNIDFVKHCRLFSEGGNFSPEEVETLCHRLEKEATRIEFVESLIMIHMEKMETEYLDQANDVINKFESKFHNLSSDLIFVEKIQRLMTNLQVNIKCQEAKSNSQAEGLNSSLEQLQQKIQTCQDHRGDKDIVTTDDLLAFVRSWKEKLSQRIKYLNCSLDMVSITQEVFTDTILADTEVESDMHMSMEALEEDVKVGLVTPESFAQPTRMGRPMIEDPAVDVVRRILQI---------SQAKSTCPC-DKDRSQTALKRRYRAE-KALKKALASASVTSAGSMTRHPKYI----RVDKKYQVLGEKPTSQAEDFKGIILNLLWESNEHLMVVVEDFYR-KEKRPVTRPECMYESFDQCADHISRKILEYHRQADEYHNSCLLELRAQVRRFEELL---PQVCWLVTENYKEQHWGKFCASLKEVQEQFEQQQKQLELEKDENARKLHPNLGHPTYISQMESLQMAEELRQQELNRMIHENQEKMEEFAKKYARFFISNLASFTERFLMQLDEVITIDDIQVPRSEPPKQKVSILIRRKLAMLSLEEESEKPLIERGSRKWPGIKPNEITIQNKILTR-----RTPSITTNKTTLGHLAAIEARDAVYLKYLALFDKELKGIQDHFRKLLLESQR------WKESWKRSLSTIQT 1653          
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Mouse
Match: Ccdc180 (coiled-coil domain containing 180 [Source:MGI Symbol;Acc:MGI:2685871])

HSP 1 Score: 120.553 bits (301), Expect = 9.459e-27
Identity = 157/644 (24.38%), Postives = 276/644 (42.86%), Query Frame = 3
Query: 2421 LFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRNDQKTYIQISVLESV----------VKSFNCVHDRC-----IYLDCI--KTQSXXXXXXXXXXXXDGTNQNKVQFSAITVLSKGGRQPSEDQGLKTIKSLLQIQNSYIGNQDNQIEKLNKCKDKGVSQSDNKMTQNGNXXXXXXXXXXXXXXDPKPINEKSKLVNKNQRLEKKYLVFGDETPETTQTFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSI---LLEKMLSECVQCLEEAETIQLKNIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTSDDIREILLTDKNHKKFGDEALSKSLINAKHTSCHDTAILERAKTVKEFKRFYFEKL----EHHR--ILKDRRSEELDNYKTFWNESIKSLQN 4271
            LFS GGNFS EE++    ++EK   RI+ VE  IM  +E +E +  D      N FE KF     D+ F++K+ R    +Q+ IK + + SNSQ+  +  +++ L+ +       R D+       +L  V          +K  NC  D       ++ D I   T+    +  +     +      V   +    ++ GR   ED  +  ++ +LQI         +Q +    C DK  SQ+  K       +   ++ S SV      +    K +    R++KKY V G++     + F   I     E  + ++   E +YR K  R VT    + ESFDQ A+ I  K+  Y +QA++Y+  CL E   Q+   E ++   P+V + +     E+   +    L+E +    +  + L L+K +   KL  + G P+  S++ S+   E  RQ E   +I ++ E   E      R F+  +   TE++L+ +D ++T  DIQ+  ++        LIR  + + S   ++ K +       W      EI + +K   +      + S+   K T  H  AI  R     ++   + ++L    +H R  +L+ +R      +K  W  S+ ++Q 
Sbjct:  855 LFSEGGNFSPEEVETLCHRLEKEATRIEFVESLIMIHMEKMETEYLDQANDVINKFESKFHNLSSDLIFVEKIQRLMTNLQVNIKCQEAKSNSQAEGLNSSLEQLQQKIQTCQDHRGDKDIVTTDDLLAFVRSWKEKLSQRIKYLNCSLDMVSITQEVFTDTILADTEVESDMHMSMEALEEDVKVGLVTPESFAQPTRMGRPMIEDPAVDVVRRILQI---------SQAKSTCPC-DKDRSQTALKRRYRAEKALKKALASASVT-SAGSMTRHPKYI----RVDKKYQVLGEKPTSQAEDFKGIILNLLWESNEHLMVVVEDFYR-KEKRPVTRPECMYESFDQCADHISRKILEYHRQADEYHNSCLLELRAQVRRFEELL---PQVCWLVTENYKEQHWGKFCASLKEVQEQFEQQQKQLELEKDENARKLHPNLGHPTYISQMESLQMAEELRQQELNRMIHENQEKMEEFAKKYARFFISNLASFTERFLMQLDEVITIDDIQVPRSEPPKQKVSILIRRKLAMLSLEEESEKPLIERGSRKWPGIKPNEITIQNKILTR-----RTPSITTNKTTLGHLAAIEARDAVYLKYLALFDKELKGIQDHFRKLLLESQR------WKESWKRSLSTIQT 1468          
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Mouse
Match: Ccdc180 (coiled-coil domain containing 180 [Source:MGI Symbol;Acc:MGI:2685871])

HSP 1 Score: 95.9005 bits (237), Expect = 2.360e-20
Identity = 61/212 (28.77%), Postives = 108/212 (50.94%), Query Frame = 3
Query: 1695 FNQQSNTMKKYPSLVESDVKKFEEKIINYFSN-----YFSMENVGNISAEEEHPKLNNDIFDS------SRLEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMF 2297
            + Q++  M +  S  ESD   +EE  + +F+      YF+  +V +       P  ++++ +S       ++ I     L + KG+   F   ++KW      NA  +VA K+DE + EL+LR HLH+PR +++E D+HNVR+ EL++H ER+   C G+  +L      +   + +  ++   F+ KI   E  FL  T + KL+++ K  
Sbjct:  162 YYQETYFMGQAESREESDEIPYEE--MEFFTTTSGNTYFAFLSVEDEQQIHSRPHSHHNLLNSFCTKYIEQVSIPQKLILKVKKGLRAGFFEHLEKWFDQCVLNARIIVASKVDELDSELELRLHLHKPRLEQVEKDIHNVRAAELLLHQERLDSHCAGVIETLKKERLMFCQFQEEQAVRSRNFRRKIYDMEHIFLNATRSQKLVSLTKTL 371          
BLAST of Coiled-coil domain-containing protein 180 vs. UniProt/SwissProt
Match: sp|Q9P1Z9|CC180_HUMAN (Coiled-coil domain-containing protein 180 OS=Homo sapiens OX=9606 GN=CCDC180 PE=2 SV=3)

HSP 1 Score: 227.254 bits (578), Expect = 1.238e-58
Identity = 211/805 (26.21%), Postives = 364/805 (45.22%), Query Frame = 3
Query: 1818 ISAEEEHPKLNNDIFDS------------SRLEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRNDQKTYIQISVLESVVKSF-----------NCVHDRCIYLDCIKTQSXXXXX-------XXXXXXXDGTNQNKVQFSAITVLSKGGRQPSEDQGLKTIKSLLQIQNSYIGNQ--DNQIEKLNKCKDKGVSQSDNKMTQNGNXXXXXXXXXXXXXXDPK--------PINEKSKLV--------------NKNQRLEKKYLVFGDETPETTQTFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSIL-------LEKMLSECVQCLEEAETIQLKNIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTSDDIREILLTDK 4046
            +  EEEH + ++  F +             ++ I     L++ K +   F   ++KW      N    VA KI+E + EL+L  HLH+PR ++IE D+HNVR+ EL++H E++   C G+  +L      +   + +  ++ + F+ KI   E  FL  T + KL+ +      +   Y++  + ++R FR+ +E  L KLR +N +FI+  +LFS GGNFS +EI+    ++EK   RI+ VE  IM ++E +E +  D      N FE KF    VD+ F++K+ R    +Q+KIK +V+ SNSQ+  +  +++ L+++     + R + KT +    L S V+++           NC  DR    + + T +  K +        ++    +    + V   + T LS+ G+   ED  +  I+ LLQ+ N+       D    +  +      S+  ++    G V     + S    S PK        P N   K V               K  ++E+KY V GD+ P   + F   I     E  + +L  AE +YR K  R VT    + ++FDQ AE+I  K+  Y  QA  Y+  CL E   Q+   E ++   P+V + ++        +K  +   +   + E  Q +    L  +K +   KL  + G P    E+ S+  +E  RQ E   +I  + E   E     G+ F+  +   TE++LL +D ++T  D+Q++  +        LIR  +   S   ++ K +       W      E+ + +K
Sbjct:  833 VPLEEEHCRKSHSTFSAMFINDTSSAKFIEQVTIPSRLILEIKKQLRAGFFEHLEKWFDQCSLNTRVTVATKINELDSELELHLHLHQPRAQQIEKDIHNVRAAELLLHQEQLDSHCAGVTETLKKKRLMFCQFQEEQNVRSKNFRLKIYDMEHIFLNATRSQKLVTLSNTLHQELLSYVDVTQVSLRSFRQYLEESLGKLRYSNIEFIKHCRLFSEGGNFSPKEINSLCSRLEKEAARIELVESVIMLNMEKLENEYLDQANDVINKFESKFHNLSVDLIFIEKIQRLLTNLQVKIKCQVAKSNSQTNGLNFSLQQLQNKIKTCQESRGE-KTTVTTEELLSFVQTWKEKLSQRIQYLNCSLDRVSMTELVFTNTILKDQEEDSDILTSSEALEEEAKLDVVTPESFTQLSRVGKPLIEDPAVDVIRKLLQLPNTKWPTHHCDKDPSQTGRGAWACGSRGSSEAGAGGAVCSPPVLCSCPGPSSPKGFKRHRCQPENSGKKAVPSASATSAGSFTPHPKPNKMERKYRVLGDKPPPAAEDFKGIILTLLWESSENLLTVAEEFYR-KEKRPVTRPDCMCDTFDQCAENISKKILEYQSQANKYHNSCLIELRIQIRRFEELL---PQVCWLVMENFKEHHWKKFFTSVKEIRGQFEEQQKR----LEKRKDKNAQKLHLNLGHPVHFQEMESLHLSEEERQEELDSMIRMNKEKLEECTRRNGQVFITNLATFTEKFLLQLDEVVTIDDVQVARMEPPKQKLSMLIRRKLAGLSLKEESEKPLIERGSRKWPGIKPTEVTIQNK 1628          

HSP 2 Score: 68.5514 bits (166), Expect = 4.612e-10
Identity = 94/490 (19.18%), Postives = 212/490 (43.27%), Query Frame = 3
Query:  336 KNILDLPDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTESLINVSCQNLNSDLLESDAEMEIRF-QIINPSNLDNLIRENFQRLNNEREIAFDKQKQLIENNIKKILLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLNKHLDVIKSKIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLK---IIIEMQPEVCNEKTIENWISFLISMRNE---FNEGCDNFLKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYF 1784
            + +  L D I   K ++    +  E ++  +      F + +  + K+ E LI  +       L ESD EM   F ++ N +NL++   +    L ++       +KQ I+   + +   E  R   L+++L K +  I +  +    EV+R++N   + +N +++ N+++L  L   L+   + +   ++      ++ W+       L      + +E+I  P  +      L  ++   +V LQ   LK    I ++ P   ++  +  W S L S+  E   ++  C   ++  YEK     Q+ +  +   K  +L  K + ++ E   +++     ++G      E+DL  ++   E   +  + +   + K+ + +  +W+ H+ +L   E  +  ++      H  ++   E  L+ ++D++RQ S ++ L   L+K    L  +K+ Y  F    +  + +YP+++  ++  +   +  YF
Sbjct:  151 REVRGLMDTIVPEKISTSTFQRQAEHKRKSYESALASFQEEIAQVGKEMEPLIVDTGGLFLKKLTESDEEMNRLFLKVENDTNLEDYTIQALLELWDKVAGRLLLRKQEIKELDEALHSLEFSRTDKLKSVLKKYAEVIEKTSYLMRPEVYRLINEEAMVMNYALLGNRKALAQLFVNLMESTLQQELDSRHRWQGLVDTWKALKKEALLQSFSEFMASESIHTPPAV---TKELEVMLKTQNV-LQQRRLKHLCTICDLLPPSYSKTQLTEWHSSLNSLNKELDTYHVDCMMRIRLLYEK---TWQECLMHVQNCKKQLLDWKAFTEE-EAETLVNQFFFQMVGALQGKVEEDLELLDKSFETLADQTEWQSSHLFKYFQEVVQLWEAHQSELLVQELELEKRMEQHRQKHSLESQVQEAHLDRLLDQLRQQSDKETLAFHLEKVKDYLKNMKSRYECFHTLLTKEVMEYPAIMLKELNSYSSALSQYF 632          
BLAST of Coiled-coil domain-containing protein 180 vs. TrEMBL
Match: A0A1S3JHJ7 (coiled-coil domain-containing protein 180 OS=Lingula unguis OX=7574 GN=LOC106172963 PE=4 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 2.909e-115
Identity = 246/793 (31.02%), Postives = 446/793 (56.24%), Query Frame = 3
Query: 1869 SRLEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNL--RHEFLEQSKLRNDQKTYIQISVLESVVKSFNCVHDRCIYLDCIKTQSXXXXXXXXXXXXDGTNQNKVQFS---AITVLSKGGRQPSEDQGLKTIKSLLQIQNSYI-----GNQDNQI---EKLNKCKDKGVSQSDNKM-TQNGNXXXXXXXXXXXXXXDPKPINE----KSKLVNKNQRLEKKYLVFGDETPETTQT-FLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSILLEKMLSECVQCLEEAETIQLKNIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTSDDIREILLTDKNHKKFGDEALSKSLINAKHTSCHDTAILERAKTVKEFKRFYFEKLEH 4187
            + ++++++   ++ KG+  NF + +++W++   E +  +VA KI+E N EL LR HLH+PR +R E DVHNVR+ EL++HSERV++ CKGI  SL  + + +A +  +H     KF+E I + E  F+  T ++KL+ ++   +++ +++M+ +RA++R FR++++  L  LRQ+N+ FI+SFKLFS GGNF  EEID++ +K+EK +++ID  EG IM+ LE +E ++ D   +  + FE++FK H+ D+ FM+K+ R     Q+KIK EV++SN+Q++ + + + +L  R +  E+  L  +Q +  Q++   S+   F   H R  YL+ +K  +  + +   ++        +V F+    +  +SK G+QP+ED  + TIK++L+ Q + +      + D ++   E+  K   +  +Q    M  ++     S    + +  SDP   ++    +S   +   +++K++L+FG++  E  ++ FL KI+   +E LDG+L  AELYYR KG R VT    LQE+F+Q AE ++ KL+ Y++QA++Y+ +CL+EF  QL  LE +I   P ++ + + +  + +  Q  +E +    + +E  + KK ++ + LR   G P +  ++ S+C+ E +R+ + ++ +   +    +       +F+  +  A+EQ LL  DN+LT  D++      +   T +LIR          +  KN     K +W      E++  DK  K      L+ S+  AK T  H  A+  R +  +++K+  FEK  H
Sbjct:  706 ASVDVSEEFLAEVKKGIRMNFLDHLEEWSEEAMERSRSVVAAKIEELNSELDLRLHLHQPRTRRAELDVHNVRAAELVMHSERVTRHCKGINHSLTELKQQFAKMTHEHDKLASKFREGIEALEVVFINATKSAKLVALQNRLQEELDKFMSVIRASLRQFRQHLDDTLAMLRQSNAKFIKSFKLFSDGGNFCPEEIDEYRKKLEKMSQKIDAAEGFIMADLEGMESKRLDQATKVASEFEDRFKNHMFDLIFMEKIARWLTNTQVKIKAEVADSNTQAQRLAQFLNDLDRRIDACEKPNLDKEQVSPTQLN--NSLKAIFEAFHSRSQYLNSLKDPNTIRPQSATMQGAPALG-ARVGFAVDTGVPAISKAGKQPAEDPSISTIKNILKTQKTKLRFGPDADLDGEVTEKERQTKSMSRPPTQGTAIMEAKSVGTKHSRKGTATTATSDPTRRSQSAVRRSTYGSNKMKIDKRFLIFGEKDEEGEESHFLGKIRHTLREALDGLLTTAELYYRQKGSRPVTRPQALQETFEQCAEIVVQKLESYYKQADEYHNQCLQEFRSQLTHLEQLIARVPPLVINEIAKTHIQKAHQVRKEIDEAFQQQLEKWNSKKYEHKNLLRPTLGHPHQHHQMKSLCDEEESRRTDYIQGVQGHHSKQQQSSVEHAEEFIAQLASASEQLLLQFDNLLTVDDVEKGRVDPKKYPTSELIRRRAAGVPLEDEEDKNALPRGKGTWQGIVKNELVCGDKPDKP----KLTASVNTAKTTLGHSAAVTARDQAYQDYKK-QFEKTLH 1490          

HSP 2 Score: 156.377 bits (394), Expect = 2.121e-34
Identity = 129/594 (21.72%), Postives = 274/594 (46.13%), Query Frame = 3
Query:  165 RILSCDKVNRQLFDSEVQLINALQNI-------------KFKGKEAIKNSNYMN-------------IKG-------------SNSTNFDIVDLDE-------KNILDLPDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTESLINVSCQNLNSDLLESDAEMEIRFQIINPSNLDNLIRENFQRLNNEREIAFDKQKQLIENNIKKI----LLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLNKHLDVIKSKIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLKIII---EMQPEVCNEKTIENWISFLISMRNEFNEGCDNFLKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYFS 1787
            R++   K+ RQ+FDS+VQL N L+               +  G   +K   ++              I+G                T F    L E       + +  LPD + + K  S++I +I + R+ +  +   + +Q LG+I    E  I  + + L S L E+D E+++    I     D  +        +E   A   Q  L    I+++       E DR+  +R +  + +  + +I H    ++ R+M+     +N S++ N+ S  DL  +L+   I++ +K       ++  W+   + +  +  ++ + +E +  P   +  +    +L+      L +  L++I    E++P    +  + +W   ++++  + +     +L++ + + E++ Q  + +++  +  +++  +  ++ + + VI+   LPL+G     FE++L +++  +E+  + L I +K + KF +   ++W +HE  L K E  +  K+ S    H  QN   E  L++++D+MRQD++E  LKE LKK + +LDKI+  Y +F  +Q   ++ YP +V+ ++  ++  +  +FS
Sbjct:    9 RVVPSGKIYRQIFDSQVQLANVLEKTSEERTKKGVKIVERPGGIPVVKEKRHITEGTGILSQRQKTWIEGFPNDYSTENPVLYKQVTEFTNQKLAEPESSVVGREVRGLPDIVVAAKPGSDIIQRIADSRRERHERALEDMHQELGVITADLEPSIIEAGEKLMSMLKENDQEIDLLMSRIES---DENLLTLTLTELHEIWDAIQSQTSLRRGGIEELDSTLSEVEDDRMERIRKVFSEYAETLEKISHLMAPDLSRLMDMESQAINQSVLSNRRSYADLFGRLMTTDIEREKKQHTLWTRRVQDWRTLNIQQANEKFQNFMSSEAVVRPQGAQKVL----ELMKTEQGSLNERRLRLISSLKELKPPASTKTAVYHWNEKVVALSEQIDALNQGYLERLHSEYEEVCQLCLEEVEKARKKLISSGVCSEQ-KATEVIEESFLPLVGDRQKLFEQELEDMDKQLEEHNDMLMIHLKSLFKFAQGAAHVWDVHEIGLAKQERSLQEKLESCRHQHDNQNQEKEGNLDIIMDRMRQDATETALKESLKKAMDMLDKIRNGYESFHEEQMAVVRSYPEMVKDELDNYDHTVCKFFS 594          
BLAST of Coiled-coil domain-containing protein 180 vs. TrEMBL
Match: R7VJ83 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_163477 PE=4 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 1.108e-100
Identity = 253/837 (30.23%), Postives = 420/837 (50.18%), Query Frame = 3
Query: 1926 NFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKL-INMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRNDQKTYIQISVLESVVKSFNCVHDRCIYLDCIKTQSXXXXXXXXXXXXDGT---------NQNKVQFSAITVLSKGGRQPSEDQGLKTIKSLLQIQNSYI-----GNQDN-----QIEKLNKCKDKGVSQSDNKMTQ----NGNXXXXXXXXXXXXXXDPKPINEKSKLVN--------KNQRLEKKYLVFGDETPETTQT-FLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSILLEKMLSECVQCLEEAETIQLKNIEILSLKKTQ-----YYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTSDDIREILLTDKNHKKFGDEALSK--------------------SLINAKHTSCHDTAILERAKTVKEFKRFYFEKLEHHRILKDRRSEELDNYKTFWNESIK 4259
            NF + ++ WN+   + A  +VA K +E + EL LR HLHEPR +R E DVHNVR+ EL++HSERV + CKGI+ +L  +   +  +   H     +FK++I + E  F+  T +S+  +N+++      +++M+ +RA++R FR++++  LQ LRQ+N+ FIRSFKLFS GGNF  EEI+++ +K+EK +++ID  EG IM+ LE +E ++ +   +    FE++FK H++D+ FM+K+ R     Q+KIK EV+ SN Q++ + + + +L  +         D+++     + + ++  F   H RC++LDC+K           +     +            +V F  I  ++K G+ P +D  + TIK++LQ Q + +      N D      Q    +K K    S+ D K  Q    N +     S    + AS+ K   + SK  N        K  ++++KY VFG+   E   T FL KI+   ++  DG+L AAELYYR KG R VT    L+E+FDQ A+ ++ KL+ YF QA+DY+ +CL+EF  QL  LE      P  + + LL++ +S       E E  +L+     S KK Q     + +++R   G P + +ELN +C  E  R+ + +  + +      E     G+ F++ +    E  LL  D+++   D+       +   T +L+R  M       D  KN     K +W      E+     +H     E+ SK                    S+  AK T  H   I  R +  K++K ++ + L+   I  +R +  +D  +  W +S +
Sbjct:  484 NFVDHLEDWNQHALQRAQNVVAAKTEELHSELDLRLHLHEPRPRRAELDVHNVRAAELVMHSERVVRHCKGIQQALGELKHRFNQMMEQHNHLAVQFKQEIEALEVIFINATKSSRFTMNLEQ------DKFMDVIRASLRQFRQHLDETLQMLRQSNASFIRSFKLFSDGGNFCPEEIEEYRKKLEKMSQKIDSSEGFIMADLEGMESKRLEQASKVAREFEDRFKHHMIDLLFMEKIARWLTNTQVKIKAEVAESNFQAQRLAQMLTDLLRKTDACQNPNLDKESVTPQQLKDFMLTVFELFHQRCLFLDCLKKAIVRPPSGGAIMQGPPSLGMTSAFYFAGQRVGFGGINSMNKPGKAPVDDSSIGTIKNILQTQKNRLRFGADANMDEPPHQPQYNMGSKVKLAEPSEVDKKSRQSQRSNTDSKSVRSSQRSANASETKATADTSKRGNSGYSVMRSKAMKIDRKYFVFGEMADEREDTYFLGKIRHILRDATDGLLAAAELYYRQKGPRTVTRPQALRETFDQCADVVVAKLQSYFAQADDYHNQCLQEFRSQLTSLEKQAVPIPGCIINDLLQREISSS-----EDERKRLQEEYWQSSKKLQEAKNLHQAEMRPSLGHPQQSNELNDLCGKEALRREDSIASLERQATQQKEAAEGHGQAFIETLASVCEHLLLQFDSMVCIDDVDKGRVDSKKHPTSELLRRKMAGLPLEDDEDKNALPRGKNTWQGIPRTEL----SSHGDAPKESASKKSLSGLAGRLDKGKTQDLTASVTTAKTTLGHSAVIEARNEAYKKYKEYFSKTLQ--SIADERTTHLVDEER--WTDSWR 1301          

HSP 2 Score: 120.939 bits (302), Expect = 1.341e-23
Identity = 84/364 (23.08%), Postives = 178/364 (48.90%), Query Frame = 3
Query:  771 PSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLNKHLDVIKSKIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLKIIIEMQPEVCNEKTIENWISFLISMRNEFNEGCDNFLKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYFSNYFSMENVGNISAEEEHPKLNNDIF 1862
            P ++ R+++     +N +++ N+ +  DL ++L+M  I++ +        +   W+        +  K  +E++ I  P         + +   +L+ +   L ++ ++EM+P    +  I  W   +I +  + ++   ++  K   K E++ Q  + +++ ++  ++   I  DK E   +++  C+PL+G+  + FE+ L E++   E     +   +K + KF +   +IW +HE  L K E  +   ++     H   N   E  L++M+D+MRQDS+E  L   LKK L ++D++K  Y +F   Q + +  YP +V +++KK++  +      YFS++  GN    +  P   ++IF
Sbjct:    2 PEDLSRMLDVESQLINQTVLSNRRAYGDLHSRLMMADIEREKNLHTQWVVRHEDWKHLHAELACNHFKEFMESDEITNPPQAAAVAKEMMEEQKRLNQERISL-IEELLEMKPPSSTKSFIYQWNQKIIDISKQIDDVNQDYFSKLCLKHEEVCQSCLAEVEKMRLDLVERGICTDK-EAPKILEQKCIPLVGQRQAEFEQKLEEMDKNFESENNIVLGSLKSLFKFSQGAAHIWDVHELGLAKQERKLQEDLDGCRQKHDNVNQDGEANLDIMMDRMRQDSTEGALGASLKKVLEMMDRLKQGYYSFHRDQIDLVSVYPKMVNAELKKYDSSVC----KYFSVKRKGNEVGWQHSPVRQSNIF 359          
BLAST of Coiled-coil domain-containing protein 180 vs. TrEMBL
Match: A0A210R130 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04407 PE=4 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 4.635e-100
Identity = 238/808 (29.46%), Postives = 411/808 (50.87%), Query Frame = 3
Query: 1875 LEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNL--RHEFLEQSKLRNDQKTYIQISVLESVVKSFNCVHDRCIYLDCIKTQSXXXXXXXXXXXXDGTNQNKVQFSAITVLSKGGRQPSEDQGLKTIKSLLQIQNSYI---------GNQDNQIEKLNKCKDKGVSQSDNKMTQNGNXXXXXXXXXXXXXXDPKPINEKSKLVNKNQRLEKKYLVFGDETPETTQT-FLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSILLEKMLSECVQCLEEAETIQLKNI-EILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTSDDIREILLTDKNHKKFGDEALSKSLINAKHTSCHDTAILERAKTVKEFKRFYFEKLEHHRILKDRRSEELDNYKTFWNESI 4256
            ++I D   LD+ + +  NF N +++W +   + +  +V  K +E N EL LR HLH+PR +R E DVHNVR+ EL++HSERV +  KGI+ +LN   + +  +  +H     KF+E I + E  F+  T +S+LI ++     +  ++M  +R ++R+FR  ++  LQ LR++N+ FI+SFK+FS GGNF  EEI+D+ +K+EK + +ID  EG IMS LE +E ++ +   +    FE++FK H++D+ FM+K+ R     Q+KIK EV++SNSQ++ + +++ ++  R +   +  L  +Q T  Q++  ES+ + F     R  YL+ IK  S             G     +     T +SK G+QP ED  +  IK++L+ Q S +         G      ++  + ++K  S          +   +         + PK +    +  +K+ + ++KYL+FG++  E  +   L  +K   +E LDG+L + E+YYR KG R VT    LQE+FDQ AE I  KL  YF QA++Y+ +CL+E+  QL  LE+ +   P ++   LL   + +C     +  T Q   I   L  ++ ++   LR   G P ++  + ++C+ E+ R  + +  + K  +   E+   C + F++I+  ++E  LL  DN L   D++      +   T +LIR           + K+     K  W      E+++     K       + S+  AK T  H + +  R     ++K  + + L+     + R     D +   WN++I
Sbjct:  689 IDIPDKLLLDVKRRIRINFLNQLEEWTEQAVQRSESVVIAKCEELNSELDLRLHLHKPRARRAELDVHNVRAAELVMHSERVQRHTKGIQQALNEQRQKFTKMTLEHNKLAGKFREDIEALETVFVNATKSSRLITLQNQLGVELEKFMGVIRTSLREFRTKLDETLQMLRESNARFIKSFKVFSDGGNFCPEEINDYRKKLEKMSDKIDSAEGSIMSDLEGMESKRLEQATKVALEFEDRFKSHMIDLIFMEKIARWLTNTQVKIKAEVASSNSQAQQLAQHLNDVDRRIDACARPNLDKEQITSSQLN--ESLKQVFEAFLARSAYLNAIKDPSPRPASALQGNPALGARVAFLSEVQPTPISKAGKQPLEDPSVGVIKNILKQQKSKLRFGIDAELDGEAIQMGQQQAEMREKMKSSLSTHTPSEKSKQTTRKSQQVLSDNAPKRVQSGLRRSSKSTKFDRKYLIFGEKDEEDEERHLLGVVKRTLREALDGLLTSGEMYYRQKGNRLVTRPQALQENFDQYAEVITQKLSSYFTQADEYHNQCLQEYRGQLTTLEHSVAHIPSLVIKDLLNDEIQKCT-LTRQTRTDQFTQILNKLEKRQKEHEHLLRPILGHPHQQDGMKNLCKKEVERHTDYVSAVEKHTKELQEVTVECAKTFLEILARSSENQLLQYDNQLVVDDVERGRIDAKKYPTSELIRRRNAGLPLEDSDDKDALPRGKTVWPGIPNNELVVGSPPAKS----QTTASVTTAKTTLGHSSVVKARDAAYHDYKVQFADTLQSIEDERQRLIHAEDRWMESWNKNI 1489          

HSP 2 Score: 154.836 bits (390), Expect = 5.987e-34
Identity = 130/594 (21.89%), Postives = 277/594 (46.63%), Query Frame = 3
Query:  150 TRDNARILSCDKVNRQLFDSEVQLINALQNIKFKGKE------------------------------------AIKNSNY-----MNIKGSNSTNFDIVDLD----EKNILDLPDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTESLINVSCQNLNSDLLESDAEM-EIRFQIINPSNLDNLIRENFQRLNNEREIAFDKQKQLIENNIKKILLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLNKHLDVIKSKIENETIKVPATIK---LCISNLNDLVSKLSVDLQDLFLKIIIEMQPEVCNEKTIENWISFLISMRNEFNEGCDNFLKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYF 1784
            T    RI+   KV RQ+FD++VQL   L  +K +  +                                       N  Y     ++ + S   N  I +LD    EK +  LP+++  TK  S++I++I   R+ +  +   + +Q L +IN   E  I      L   L ++D ++  I  +I    ++ +   +  + L  E +     +++ IE   +++   E DR+  ++ + +  S  + +I H  P +++R ++     +N +++ N+ +  DL  +L+   I++ +        +L  W+K   +  +   +  +++E +  P  ++   + +     +++K   DL D     + ++QP    +  +  W   ++++  E +      + K +++ EQ+ QK +  ID +K ++L + I      +  VID+  LPL+G+    FE++L+ ++  +E      + K++ + K+ +   ++W +HE  L K E  +  K+      H  QN   E  L++++D+MRQD+SE +L++ L K L  L+KIK +Y  F   Q++ +++YP++V+ ++  ++  +  +F
Sbjct:    4 TAPPVRIVPSGKVYRQMFDAQVQLTRTLTKLKQEDTQKTFDRQSTNVGIPLVRLKKDEVTHGLLTERQRTWADGFPNDPYVENPVLHKQYSEFVNATIRELDGTAAEKEVSGLPEDVVPTKQGSDIIDRIASSRRQRHEEAVEDMHQELSVINDNLEPRITECSDFLLEKLHDNDKDIARILAKISTDEDILSYSLDGLRALWEEVQGNSKVRQEWIEELDQQLTKAEDDRMDLIKEVFMNYSKTLEKIAHMMPPDLYRFLDQESQVINQTMLSNRRAYSDLYVRLMSTDIEREQSQHTIWKRRLEDWKKLKTDLSIQNFRDFMQSEDVVSPPGVQKVLMFMKAEQKILNKRRTDLIDQ----LSDLQPPASTKTAVYQWNKNIVAVTTEIDSVNQVHMAKLHDEYEQVCQKCLERIDSIKTSLLDDGIVT-STRVQQVIDDDLLPLVGERQRVFEQNLDTMDKALETHNNFSNEKLRSLFKYAQGSAHVWDVHEIGLAKQERALQEKLEVCRHQHDNQNQEKEANLDIIMDRMRQDASETSLRDSLSKALDKLEKIKAAYEVFHKDQASIVQQYPNMVKEELTNYDLAVCRFF 592          
BLAST of Coiled-coil domain-containing protein 180 vs. TrEMBL
Match: A0A2D0PN63 (coiled-coil domain-containing protein 180 OS=Ictalurus punctatus OX=7998 GN=ccdc180 PE=4 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 2.833e-98
Identity = 338/1406 (24.04%), Postives = 626/1406 (44.52%), Query Frame = 3
Query:  165 RILSCDKVNRQLFDSEVQLINAL-----QNIKFKG------------------------KEAIKNSNYMNIKGSNSTNFDIVDLDEKNILDLPDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTESLINVSCQNLNSDLLESDAEMEIRFQIINPSNLDNLIRENFQRLNNEREIAFDKQKQLIENNIKKILLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLNKHLDVIKSKIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLKIIIEMQPEVCNEKTIENWISFLISMRNEFNEGCDNFLKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKK------------------------------------YPSLV--ESDVKKFEEKI---INYFSNYFSMENVGNIS-AEEEHPKLNNDIFDSSRLEITDD----------QC----------------------LDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRNDQK-TYIQISVLESVVKSFNCVHDRCIYLDCIKTQSXXXXXX--------XXXXXXDGTNQNKVQFSAITVL---SKGGRQPSEDQGLKTIKSLLQIQNSYIGNQDNQIEKLNKCKDKGVSQSDNKMTQNGNXXXXXXXXXXXXXXDPKPINEKS-KLVNKNQRLEKKYLVFGDETPETTQ--TFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSILLEKMLSECVQCLEEAETIQLKNIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILKSYETNNEIVYSCGRK----FVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTS 4013
            R++   K+ RQ+FD++  L  +L     Q     G                        ++ ++N  +   K + S + D    D++    LPD + S K+ S++I +++E ++ +  +  T+  + L  ++   E+L+  + ++    L E D E+E   ++++  +L+ L  ++  ++       F  ++  I+   + ++ +E +R   +  +L K +  + +I +  P +VHR++N   + +N +++ N+ +L  L+  L+   + K     +    +L  W+K  +   +   K  + +  I+ P  ++   S +     K+  + +   L+ +  M P  C++ +   W S L S+  + +      L K +E  E   Q    +++  K  +    +  D  EI  +++   +PL+GK  +  E+ L  +E   E   +      K + +F +   N+W++H   L++ E  +   +     +++E+N   E  L+VM+DK+RQ+S+E+ L+  L++ L  L++IK  Y NF+ +  +T+++                                    YPSL    S +KK    +    N F N     +  ++S AEE     + ++ DS     T            QC                      ++L + V   F N +++ ++ V  +   ++  K ++   EL LR HLH+PR KRIE D+HNVR+ ELI+H +RV + CKGI  +L  +  D+  L+   +   E F+ KI S E+   T T +  L+ +    +    E+MN ++   R FR+NVEIK + LR+ N+  ++ FKLF  GGNF+ +EI+ + + +EK  KRID  +  +M  ++  E +  D   +  + FEEK +F  VD+ F++K+       Q++IK E   SN+  ++I   +  L+ +    ++   D   T   IS L S +     +  R  YLDC    S     P                  Q +V   A   L   S  G    ED+ ++ ++ LL+I  S              C+D  V   +         S +        +S P+ +N +S + + K  R +KK+ VFG +  E  +  TF   I     E  D +L AAE +Y+ K  R V+   ++QESF+  AED+  +L  Y  Q+ +Y++ C++EF +QL  +E ++   PE + + L ++ L +  + L        +  +    KK ++  KL      P+   ELN +   E  RQ E+     K+ E N   + +C +K    FV  +   TE  L  +DNI+TT +IQ    + +  +   L+R     + +     + +S     +W  
Sbjct:    5 RVVPSGKIYRQMFDAQAHLSLSLHERRRQRAAHAGCLSGDNTDTGSHQHPLRSQTEQCSEDTMRNQLFSGTKPALSVDQD----DQEETTGLPDRVVSEKSGSDIIERLMEKKQREHMEAVTQLQRDLIELSAGYETLLKETGEDFLLKLSEYDEEVE---RLMHGDDLEALSFQDLHKIWTSVSHEFAMRRNCIQELDELLVKYEIERAAMIAAVLRKYTMTLEKISYVMPGDVHRLINNEAMMMNQALLANRRALAKLRLNLMEKDLQKEVLYHMRWETKLQDWKKMKVVTAVSQFKDFMNSPEIQNPKNVQDTFSTMRT-KQKVYSEQRLKILEQVRNMTPPNCSKSSTAEWYSSLSSVNEQIDRMHTETLTKLHEYYENTWQDCSLEVERFKNELSTCGLTSD--EIQEIVNCEMVPLIGKCQTQEEERLAAMEKAREGLAKTAAFLSKSLFEFARGAANVWEMHSAGLQRKEQQLQNYLEEVRKNYEEKNQKKEARLDVMMDKLRQESTEEALQAALEQILKFLEEIKEGYVNFYKEGVDTVERYPVMVLEEIHAYSVAVSQYFSVKEIYSQDPEELQILYPSLTLRASRIKKSPPSVNLSPNAFQNVTPQAHTPDLSHAEENIDYFSQELRDSQSETFTTAKGNVYSCPVIQCDDAEEHLKVMEVEAVLYPESLIVELQRDVREKFFNHLEERSQEVLNHTVVIMDAKKEKLKSELDLRLHLHQPRAKRIEMDIHNVRAAELILHEDRVDRHCKGILQALADLRTDFDNLQETRRKLNEGFRAKIHSKEDTLYTATKSYTLVKLSASVQSSLAEHMNGIQELQRQFRQNVEIKFEGLREANAQLMKHFKLFVEGGNFTPKEIEKYRKHLEKVAKRIDSADEALMLDMKGTESKYLDQAKEVISKFEEKLQFLKVDLMFLEKIQSVLTNTQVQIKAEAMKSNTHKKMISTVMSKLKDKLEAYTQCCPDNGVTSGDISGLTSTL--IEELRKRSQYLDCYLDPSMAVPLPDAPLQGAFAVAARPRSRKQEQVGSPAADPLLQPSCMGGAFMEDKAVEVVRGLLRISKS------------QTCQDASVGLKE--------ASSATVTAPARTSSPPESVNSQSVRRLTKPTRFDKKFQVFGPKPDEQQEILTFKGLITNILWEANDLLLQAAEDFYKKKERRSVSRPQYIQESFELCAEDLNKRLLVYQSQSHEYHRGCVQEFCKQLKTIEEIVCEIPEALLTKLRDQHLEDLSRSLTLVRQQFERTWQQSEEKKREHRGKLCVRLNHPACEEELNRLVAAEDDRQEEQR----KATENNRLELQACIKKNADAFVTALATLTEHLLFQLDNIVTTDEIQGGSVEPKRENITTLVRRTQAGTLQEERKERPLSEKGSRAWPG 1374          
BLAST of Coiled-coil domain-containing protein 180 vs. TrEMBL
Match: A0A2T7NM27 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_18029 PE=4 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 2.562e-97
Identity = 252/840 (30.00%), Postives = 437/840 (52.02%), Query Frame = 3
Query: 1899 LDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEF--LEQSKLRNDQKTYIQIS-VLESVVKSFNCVHDRCIYLDC-------------IKTQSXXXXXXXXXXXXDGTNQNKVQFS--AITVLSKGGRQPSEDQGLKTIKSLLQIQN-SYIGNQDNQIEKL-----------------NKCKDKGV-SQSDNKMTQNGNXXXXXXXXXXXXXXDPKPINEKSKLVNKNQRLEKKYLVFGDETPETTQTFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHS-FLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSILLEKMLSECVQCLEEAETIQLK---NIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVI---LKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTSDDIREILLTDKNHKKFGDEALSKSLINAKHTSCHDTAILERAKTVKEFKRFYFEKL-----EHHRILKDRRSEELDNYKTFWNESIKSLQN 4271
            +D+ K +  NF NF++ W    +E A  +V  K +E N EL LR HLH+PR +R EYDVHNVR+ EL++H+ERV++ CKG++ SL+ +   +  +  +H     KF+  I + E  F+  T +S+L+ ++     + +++M  +R ++R FR++++  LQ LR +N+ FI+SFKLFS GGNF  EE++++ +++EK + R+D  EG IMS LE +E ++ +   +  + FE++FK H+ D+ FM+++ R     Q+KIK EV+ SN+Q++ +  ++ +L H     EQ +   +Q +  Q++  L+SV++ F     RC YL+C             I  +S           N     +KV FS   +T  SK G+  SED  +  IKS+L+ Q    I   D + E+L                  + K+K   SQ+  ++ +    + S      S++S+P   N   K  +K  +L+K       E       FL  I +  +E + G+   AELYY+ KGVR VT    LQE+F+Q +E I  KL+ Y+QQA+DY+ +CL+EF +QL ++E++    P ++   +L++ ++   + + E + +  K    +E  + KK ++ + LR   G P +  EL  +CE E  R  E M  I   +KS +T+ E   S  +  ++ +   +EQ LL  D++L   ++     + +   T +LIR  M   +   D  +N     K +W      +++L ++ +K      L+ ++  AK T  H + I  R    +++K  + + L     E  + L+D      + +   W  SI+ +++
Sbjct:  738 VDVKKSIRMNFLNFLETWCGEAKERALSVVVAKCEELNSELDLRLHLHQPRSRRAEYDVHNVRAAELVMHAERVTRHCKGVDQSLSELRARFVAMSLEHNKLATKFRHDIEALEVIFINATKSSRLVALQNQLAVELDKFMAVIRTSLRQFRQHLDETLQMLRDSNARFIKSFKLFSEGGNFCPEEVEEYRKRLEKMSHRVDGAEGSIMSELEGMESKRLEVASKVASEFEDRFKSHMFDLLFMEQIARWLTNTQVKIKCEVAASNAQAQNLDRHLDDLEHRIDAYEQPRFDKEQTSPSQLNDFLKSVMELFQ---KRCGYLNCKLEAGRPQSCVPQIGLRSRQPSYQWFGSKNTLFMSSKVGFSSEGLTSGSKPGKPSSEDPSISVIKSILKTQKYKLIVGADAEAEELASTGMAATPTSGIPMDATREKNKSAHSQASTRVNEGEKPTASRRPTLPSLSSEPG-RNLGLKRGSKTGKLDKSRSFLSGEDGVEENHFLGLIMSILREAMSGLTTTAELYYKQKGVRPVTRPQVLQETFEQCSEVITQKLQSYYQQADDYHNQCLQEFRQQLSKMEHLTARVPPIIIKDMLKQHVA---RTMSEQDALHAKFKMFLEESNTKKIKHENNLRPQMGHPHQAPELEVLCELETQRHEEHMLAIAEHIKSLKTSTE---SNAKMLLEGLVQLSEQQLLQYDDLLVVDEVDKGRVERKRHPTIELIRRKMTGEALEEDQEENPLPRGKGNWLGFPSNQLVLENRPNKI----QLTPAINTAKITLGHSSTIKARDMAYEDYKVLFEKTLASIEEEEKKFLQDE-----ERWAVSWTASIQHIKD 1558          

HSP 2 Score: 147.517 bits (371), Expect = 1.146e-31
Identity = 119/494 (24.09%), Postives = 235/494 (47.57%), Query Frame = 3
Query:  339 NILDLPDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTESLINVSCQNLNSDLLESDAEMEIRFQIINPS------NLDNLIRENFQRLNNEREIAFDKQKQLIENNIKKILLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLNKHLDVIKSKIENETIKVPATI----KLCISNLNDLVSKLSVDLQDL-FLKIIIEMQPEVCNEKTIENWISFLISMRNEFNEGCDNFLKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYFS 1787
            ++  LPD +   K  S++I +I   RK +      + +Q L +I+ +TE  I    +     L E  A       +I         +LD+LI      L  E E +    ++LI+    K+   E  R+  +R +  + S  + +I +    ++ R+++     +N + + N+ +  DL  +L+   +++ R        ++  WQ    NK +   +  +++E I  P  +    K  I+ L  L S      Q L F+  + +++P V  +  +  W   +  +  E        L K YE++E++ Q  +  I+ +K ++L E I  + ++   V++   LPL+G+    FE++L+ +E  I +  + ++  +  + K+ + + ++W +HE  L K E  +  K++ +   H   N   E  L++++D+MRQD+SE+ L++ L K   +L+KI+  Y  F   Q N +  YP +V+S++  F++ I  YFS
Sbjct:  109 DVRSLPDIVVPAKQGSDIIERITASRKERHETAVEDMHQELSVISTETEPQITRVSEETLQMLAEGGATTAGLLALIEKDENLLTYSLDDLIS-----LWKEVENSTPWHRELIQQLDMKLNEIEEKRMERIRRVFQEYSETLKKISYLLTPDLERLLDRESQVINQTCLSNRRAYADLFVRLMSADLERERTQHSTWCQRVEDWQMLRTNKAVQSFRDFMQSEDIVKPPGVENVRKFMITELEILNS------QRLEFISSLRDLKPPVSTKSAVYTWRQQMKKVSQELESVSQMHLTKLYEEMEKVCQSCLEKIENIKRSMLEEGIVTE-SKAQQVVEEQMLPLVGEQQRMFEQNLDTMEKSIAEHTKKMEDAVHSMFKYAQGVAHLWDVHEIGLAKQERALQEKLDDSRHEHDYVNQEWEANLDIVMDRMRQDASEEALRDSLSKVFDMLEKIQEFYKEFHQSQKNIVHMYPDMVQSELNNFDQAICTYFS 590          
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Nematostella
Match: EDO34559 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP14])

HSP 1 Score: 75.0998 bits (183), Expect = 6.339e-14
Identity = 52/205 (25.37%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 3285 SKIKAFCKEVLDGILYAAELYYRNKGVRKVT--HSFLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSILLEKMLSECVQCLEEAETIQLKNIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILK--SYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQ 3887
             +IK   +E L+G+L  AE+YY+ KG ++       +Q++FD  AE ++ +L+ Y  QA++Y+  C++           V++   +  F+   +K+++    CL  +                 + S+LR   G P  R EL+++C +E  R+ E ++ I +  S    +E+ +  G   V+ +    E  LL  D +LT  D++
Sbjct:   15 GQIKNVLREGLEGLLATAEMYYKQKGTQRAPTRPQAIQDNFDACAEILVQRLQSYKTQADEYHNSCIQAC--------TVVSKKAQYYFASFGKKIVTGFSSCLTSSSMCYFPQ---------HHQSQLRPTLGHPQNRQELDTLCGSETRRKTESIDGIQEHSSALLQSEVEF--GGTLVQNLAQTCETMLLQFDAVLTLEDVE 200          
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Medaka
Match: ENSORLT00000040510.1 (coiled-coil domain containing 180 [Source:NCBI gene;Acc:101156417])

HSP 1 Score: 88.5817 bits (218), Expect = 4.271e-17
Identity = 104/468 (22.22%), Postives = 208/468 (44.44%), Query Frame = 3
Query: 2061 IEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRNDQKTYIQISVLESVVKSFNCVHDRCIYLDCIKTQSXXXXXXXXXXXXDGTNQNKVQFSAITVLS-KGGRQPSEDQGLKTIKSLLQIQNSYIGNQDNQIEKLNKCKDKGVSQSDNKMTQNGNXXXXXXXXXXXXXXDPKPINEKSKLVNKNQRLEKKYLVFGD--ETPETTQTFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHSFLQESFDQAAEDIIFKLKFYFQQA 3455
            I+  +   R  EL +H E V   C+ +     +   +   L+     K E+F   +++ E +   V ++  L  +   F+D  + +  E +     FR+ + ++L+K R   S  + S ++FS GG+F+ EE+     +++K  K I   E  I++ LE  E +    + +     +EK      ++ F +++ +  +  QL+I+TE + SN Q   I  +++ LR   LE+S   + +     +S +E  VK       RC+YLD             N+   D   + K       +LS +    PS ++    +  +++  NS +  QD+  E  ++ + +G +   N +                 A + +P+++ S+ +    R  K++ +FG   E  ++  +F S ++A   +  + ++  A  +Y +K    V    L +S D+ AE+++  L  Y +QA
Sbjct:  686 IQTHICQPRLAELQLHREIVDNFCEEMLKVFASCRMELQKLQSTISKKNEEFTATLSNTESSIQMVCSSRSLEAIVLDFQDSLHRHTEERKHHQTVFRQTLSMRLEKSRSKASKLLNSMRVFSEGGDFAPEELKTIQMRMKKETKMIRLTEKSILTELESFESRNFQQIKELSTPLQEKLSSLTSEVKFAERVRKILSSAQLQIQTEAAGSNLQQTSINSSLEKLRS--LEKSPKESPEDVCSLLSSVEDEVK------KRCLYLD------------FNVGMLDLMGRPKSLKPVQPILSFQHLNSPSGERLQDPVFGIIKFLNSSLSRQDSAGE--DQLRGRGAAAGQNPIHHQ-----------KLTAVNVRPVSKSSRSI----RNIKRFQIFGSKLEEEQSISSFPSVLQAVLWKTNELLIQGAADFYSSKSGSSVL--LLPDSLDKGAENMMQLLLEYQKQA 1114          

HSP 2 Score: 53.1434 bits (126), Expect = 2.542e-6
Identity = 60/348 (17.24%), Postives = 154/348 (44.25%), Query Frame = 3
Query:  753 RIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLNKHLDVIKS---KIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLKIIIEMQPEVCNEKTIENWISFLISMRNEFNEGCDNFLKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIE-KFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYF 1784
            RIG   P  VHR+ +A   E+N+++I N+     ++  L    + +           L  W++    + +D  ++   + E++ +     +K     L +    +   ++ L         P  C+   + +W   L S+ ++ +    +FL       EQ+    + +++  K    A ++ ++  ++++++ +  LPL+ +  S  E+ L+ +E   +   ++  +++       +K     W+ H    ++ ++ +   ++    S Q++    +  L+ ++ ++RQ SSE ++K  L+K    L  I+ S T   ++Q   + + P+L+  ++  + + + + F
Sbjct:  179 RIGFLTPPAVHRLFHAEATELNIALIANRRCAARVELDLKKQTLQQESLLHQQWEATLTSWKRSKEKEIVDQFRNFCRRDESQPLVPDQQMKQTQRALTEQRCAIICKIRSLV--------PPTCSSALVSDWFKQLTSLNSQLDHLHSDFLNHYRCSKEQLWDNLLAEVERCKEVFSALQLSEE--QVNDIVTSQLLPLIRQRQSQDEERLSALEACYDAVAQHA-LRLSGYALAVVKAAVLHWEEHVIRSERIKEKLEQHLDDLKCSLQQRTETKKENLDNLLQRLRQASSEDDMKSLLEKSEKFLQDIEHSCTECVSEQWEVISRLPALLMEELTSYSKSLSSLF 515          
BLAST of Coiled-coil domain-containing protein 180 vs. Planmine SMEST
Match: SMESG000039547.1 (SMESG000039547.1)

HSP 1 Score: 2765.33 bits (7167), Expect = 0.000e+0
Identity = 1408/1418 (99.29%), Postives = 1414/1418 (99.72%), Query Frame = 3
Query:   54 MLFENNSKNFFDIKESYTDNCIKLKSKSRVDFTRDNARILSCDKVNRQLFDSEVQLINALQNIKFKGKEAIKNSNYMNIKGSNSTNFDIVDLDEKNILDLPDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTESLINVSCQNLNSDLLESDAEMEIRFQIINPSNLDNLIRENFQRLNNEREIAFDKQKQLIENNIKKILLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLNKHLDVIKSKIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLKIIIEMQPEVCNEKTIENWISFLISMRNEFNEGCDNFLKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYFSNYFSMENVGNISAEEEHPKLNNDIFDSSRLEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRNDQKTYIQISVLESVVKSFNCVHDRCIYLDCIKTQSXXXXXXXXXXXXDGTNQNKVQFSAITVLSKGGRQPSEDQGLKTIKSLLQIQNSYIGNQDNQIEKLNKCKDKGVSQSDNKMTQNGNXXXXXXXXXXXXXXDPKPINEKSKLVNKNQRLEKKYLVFGDETPETTQTFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHSFLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSILLEKMLSECVQCLEEAETIQLKNIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTSDDIREILLTDKNHKKFGDEALSKSLINAKHTSCHDTAILERAKTVKEFKRFYFEKLEHHRILKDRRSEELDNYKTFWNESIKSLQNGVKNNSTKILLQ 4307
            MLFENNSKNFFDIKESYTDNCIKLKSKSRVDFTRDNARILSCDKVNRQLFDSEVQLINALQNIKFKGK+AIKNSNYMNIKGSNSTNFDIVDLDEKNILDLPDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTESLINVSCQNLNSDLLESDAEMEIRFQIINPSNLDNLIRENF RLNNEREIAFDKQKQLIENNIK ILLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLNKHLDVIKSKIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLKIIIEMQPEVCNE TIENWISFLISMRNEFNEGCDNF+KKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYFSNYFSMENVGNISAEEEHPKLNNDIFDSSRLEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTI+EDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLR DQKTYIQISVLESVVKSFNCVHDRCIYLDCIKTQSNPKLKPNNLENNDGTNQNKVQFSAITVLSKGGRQPSEDQGLKTIKSLLQIQNSYIGNQDNQIEKLNKCKDKGVSQSDNKMTQNGNVSRSLSVVSGSVASDPKPINEKSKLVNKNQRLEKKYLVFGDETPETTQTFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHSFLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSILLEKMLSECVQCLEEAETIQL+NIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCE+EITRQNEEMEVILKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTSDDIREILLTDKNHKKFGDEALSKSLINAKHTSCHDTAILERAKTVK+FKRFYFEKLEHHRILKDRRSEELDNYKTFWNESIKSLQNGVKNNSTKILLQ
Sbjct:    1 MLFENNSKNFFDIKESYTDNCIKLKSKSRVDFTRDNARILSCDKVNRQLFDSEVQLINALQNIKFKGKQAIKNSNYMNIKGSNSTNFDIVDLDEKNILDLPDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTESLINVSCQNLNSDLLESDAEMEIRFQIINPSNLDNLIRENFHRLNNEREIAFDKQKQLIENNIKNILLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAILIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLNKHLDVIKSKIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLKIIIEMQPEVCNENTIENWISFLISMRNEFNEGCDNFVKKSYEKLEQINQKRMNDIDILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIEKTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQEQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQQSNTMKKYPSLVESDVKKFEEKIINYFSNYFSMENVGNISAEEEHPKLNNDIFDSSRLEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKIDEFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSLNTIMEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFEDKNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIEEIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFKFHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLEQSKLRKDQKTYIQISVLESVVKSFNCVHDRCIYLDCIKTQSNPKLKPNNLENNDGTNQNKVQFSAITVLSKGGRQPSEDQGLKTIKSLLQIQNSYIGNQDNQIEKLNKCKDKGVSQSDNKMTQNGNVSRSLSVVSGSVASDPKPINEKSKLVNKNQRLEKKYLVFGDETPETTQTFLSKIKAFCKEVLDGILYAAELYYRNKGVRKVTHSFLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLLELENVINSYPEVMFSILLEKMLSECVQCLEEAETIQLENIEILSLKKTQYYSKLRSDFGQPSKRSELNSVCESEITRQNEEMEVILKSYETNNEIVYSCGRKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNISSKTLDNSKNVSNSTKASWTSDDIREILLTDKNHKKFGDEALSKSLINAKHTSCHDTAILERAKTVKKFKRFYFEKLEHHRILKDRRSEELDNYKTFWNESIKSLQNGVKNNSTKILLQ 1418          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCDC1801.444e-5926.21coiled-coil domain containing 180 [Source:HGNC Sym... [more]
CCDC1802.578e-5926.21coiled-coil domain containing 180 [Source:HGNC Sym... [more]
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1806.270e-6728.02coiled-coil domain containing 180 [Source:ZFIN;Acc... [more]
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000013429.11.019e-7029.15coiled-coil domain containing 180 [Source:NCBI gen... [more]
ENSXETT00000013488.11.236e-7029.15coiled-coil domain containing 180 [Source:NCBI gen... [more]
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ccdc1808.205e-6325.42coiled-coil domain containing 180 [Source:MGI Symb... [more]
Ccdc1809.459e-2724.38coiled-coil domain containing 180 [Source:MGI Symb... [more]
Ccdc1802.360e-2028.77coiled-coil domain containing 180 [Source:MGI Symb... [more]
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9P1Z9|CC180_HUMAN1.238e-5826.21Coiled-coil domain-containing protein 180 OS=Homo ... [more]
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JHJ72.909e-11531.02coiled-coil domain-containing protein 180 OS=Lingu... [more]
R7VJ831.108e-10030.23Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A210R1304.635e-10029.46Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A2D0PN632.833e-9824.04coiled-coil domain-containing protein 180 OS=Ictal... [more]
A0A2T7NM272.562e-9730.00Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO345596.339e-1425.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000040510.14.271e-1722.22coiled-coil domain containing 180 [Source:NCBI gen... [more]
back to top
BLAST of Coiled-coil domain-containing protein 180 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000039547.10.000e+099.29SMESG000039547.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007470 ID=SMED30007470|Name=Coiled-coil domain-containing protein 180|organism=Schmidtea mediterranea sexual|type=transcript|length=4373bp
ATATAAATCTTATATGATAATTACTATATTACATTGTTTTATTGATATTT
CAAATGCTGTTTGAAAATAATTCAAAAAATTTCTTTGATATTAAAGAATC
ATACACTGATAATTGCATAAAGTTAAAATCCAAAAGTCGCGTTGATTTTA
CTCGAGATAATGCTAGAATATTATCATGTGATAAAGTCAATAGACAATTA
TTCGATTCAGAAGTTCAATTAATCAATGCACTTCAAAATATAAAATTCAA
AGGAAAAGAAGCAATAAAAAATAGTAATTACATGAACATTAAAGGCTCCA
ATTCAACAAACTTTGATATAGTTGATTTAGATGAAAAAAACATTTTAGAT
TTACCTGATAATATTAAGTCAACTAAAACGAATTCAGAATTAATTAATCA
AATTTTGGAAATTAGAAAACATAAATTTTCAAAATTTTTTACTGAATTCT
ATCAATTGTTGGGATTAATTAATAAAAAAACCGAGAGCCTGATTAACGTA
TCATGCCAAAATTTGAACTCCGATCTGCTTGAAAGCGATGCTGAAATGGA
GATCCGGTTTCAAATTATTAATCCTTCGAATTTAGATAATTTAATTCGAG
AAAATTTTCAGCGCCTCAACAATGAAAGAGAAATTGCTTTTGATAAACAA
AAACAATTAATAGAAAATAATATTAAAAAAATTTTGTTGTTTGAATCAGA
TCGAGTCATTGCATTAAGGAATTTATTATTGAAATCGTCAACAGAAATTA
TAAGAATCGGCCATTTTGCTCCGTCAGAGGTTCACAGAATCATGAATGCG
ATTTTAATAGAAGTAAACCTCTCAATAATCGACAATAAGGAGTCCCTTCA
TGATTTGAAAACAAAACTGCTTATGCATATAATTGATAAAAATCGAAAAG
CACAAATTTATTTAAATAATCAACTGAATATTTGGCAGAAAAAAATGCTA
AATAAGCATCTTGATGTCATAAAAAGTAAAATAGAGAATGAAACAATCAA
AGTTCCAGCAACAATAAAATTGTGCATATCCAATTTGAATGATTTAGTTT
CAAAATTGTCAGTTGACCTCCAAGATTTATTCCTCAAAATCATAATTGAA
ATGCAACCAGAGGTTTGTAATGAAAAGACAATTGAAAATTGGATCTCGTT
CTTAATTTCAATGAGAAATGAATTCAATGAAGGTTGTGATAATTTTTTGA
AAAAATCCTATGAAAAACTTGAACAAATAAATCAAAAACGTATGAATGAT
ATTGATATTTTAAAGGCAACTGTTTTAGCAGAAAAAATCTATGATGATAA
AAATGAAATCTCAAATGTCATAGACAATTTGTGCTTACCTCTATTGGGAA
AATTCCATTCTAATTTCGAAAAAGATCTCAATGAAATTGAAATTATCATA
GAAAAAACTTGCGAGAATTTAGACATAAAAATAAAGGATATTGAGAAATT
TCTAAAGAATCTATGGAATATCTGGAAACTCCATGAAAGAGACCTAAAGA
AAACCGAAGACGGAATATATCTGAAAATAAATTCAGCAATTTCGTCGCAT
CAAGAACAAAATATTCATATTGAAAATGAACTGAATGTCATGGTTGATAA
AATGAGACAAGACTCATCTGAACAAAATCTCAAAGAAGATCTGAAAAAAT
GTTTAAGCATTTTAGATAAAATCAAAACCAGTTATACAAATTTCTTTAAT
CAACAATCTAATACAATGAAAAAATATCCATCACTCGTGGAGTCGGACGT
TAAAAAGTTTGAAGAAAAAATTATAAATTACTTTTCCAATTATTTTTCTA
TGGAAAATGTTGGAAATATTTCAGCCGAAGAAGAACATCCCAAATTGAAT
AATGATATCTTTGATTCATCCAGATTGGAGATTACCGACGACCAATGTTT
AGACTTAGTGAAAGGAGTTGAAAACAATTTTAGGAATTTCATTCAAAAGT
GGAACAAAATTGTCGAAGAAAATGCTTCAAAGTTAGTGGCAATAAAGATC
GATGAGTTTAATGGTGAGCTTAAGCTTCGTTTTCATTTACATGAGCCAAG
GTACAAACGAATTGAATACGATGTCCATAATGTCCGAAGCACTGAACTCA
TTATTCATTCTGAAAGAGTTTCTAAACAGTGCAAAGGAATTGAGAGTTCT
TTAAATACGATTATAGAAGATTATGCGACCTTGGAAAGAGATCACAAAAT
GAAACAGGAAAAATTTAAAGAAAAAATAACATCGGACGAAGAAGCATTTT
TAACTGTAACTAACAATTCGAAACTGATTAATATGAAGAAAATGTTTGAA
GATAAAAATAATGAGTATATGAATGAGCTACGAGCTACGATGAGAGATTT
CCGGAAAAATGTTGAAATAAAATTGCAGAAATTGCGTCAGACAAACAGTG
ACTTCATCCGTTCGTTTAAATTATTTTCCATTGGCGGCAACTTTTCTATT
GAAGAAATTGATGATTTTTCGAGAAAAATTGAAAAGGCGAATAAAAGAAT
TGATGATGTTGAAGGAGAGATCATGTCAAGTCTCGAGGTCGTGGAAAAAC
AACAGCAAGATGCTTTAATACAGTTCCAAAATATGTTTGAGGAGAAATTC
AAATTCCACATAGTTGATATTAATTTCATGGATAAACTCAACAGAGCTTT
TGCTTTTATTCAATTGAAAATTAAAACCGAAGTTTCCAATTCAAACAGCC
AGAGCCGAATAATTTTCGAGAACATTAAAAATTTACGACACGAGTTTCTT
GAACAGTCGAAGTTAAGGAACGACCAAAAGACCTATATCCAGATATCAGT
TCTAGAAAGTGTGGTGAAATCTTTTAATTGTGTACATGATAGGTGCATTT
ACTTGGATTGCATTAAAACACAGTCAAATCCAAAACTAAAACCAAATAAT
TTAGAAAATAACGATGGAACAAATCAAAATAAAGTCCAATTTTCGGCTAT
TACTGTACTTAGTAAAGGAGGACGTCAGCCCAGTGAAGATCAAGGACTTA
AAACAATTAAAAGTCTTTTGCAAATTCAAAATTCTTATATTGGGAATCAA
GATAATCAAATTGAAAAACTTAACAAATGTAAAGATAAGGGAGTGTCTCA
AAGTGATAATAAAATGACTCAAAATGGAAATGTTAGTCGATCCTTGTCAG
TCGTCTCTGGATCTGTAGCCAGTGACCCTAAACCAATTAATGAAAAAAGT
AAACTGGTTAATAAAAATCAAAGATTGGAAAAGAAATATTTAGTTTTTGG
TGACGAAACTCCAGAGACAACGCAAACGTTTTTAAGTAAAATTAAGGCGT
TTTGTAAGGAAGTCTTAGATGGGATTTTATACGCTGCGGAATTGTATTAC
CGAAATAAAGGAGTCCGTAAGGTAACTCATTCGTTTCTCCAAGAAAGCTT
TGATCAAGCTGCCGAAGACATTATTTTTAAATTAAAATTTTATTTTCAAC
AAGCTGAAGATTATTACAAAGAATGTTTGAAAGAATTCAACCGACAATTG
TTGGAATTAGAAAATGTCATTAACTCATATCCTGAGGTTATGTTCTCGAT
TCTTCTTGAGAAAATGTTGTCGGAATGTGTTCAATGTCTCGAAGAAGCAG
AGACCATTCAACTGAAAAATATTGAAATTCTTTCATTGAAGAAAACTCAG
TATTATAGTAAATTGAGGTCTGATTTTGGGCAACCAAGTAAAAGGAGTGA
ATTAAATAGTGTTTGCGAAAATGAAATAACGAGACAAAATGAAGAAATGG
AAGTGATATTGAAATCCTATGAAACTAATAATGAAATAGTATATTCATGT
GGAAGAAAGTTTGTAAAGATAATTACAGATGCTACAGAACAATACCTTTT
GTTAATGGACAATATTTTAACAACTGCTGACATACAAATTTCAGAGACAA
AAGACGAGCCTTTAGATACCAAAGATTTAATACGATCTCATATGAATATA
TCATCGAAAACTTTGGATAATTCAAAAAACGTTTCTAATTCTACGAAAGC
ATCATGGACTTCGGATGATATTCGTGAAATATTGTTGACGGACAAAAACC
ATAAAAAGTTTGGTGATGAAGCCTTATCGAAATCACTAATAAATGCAAAA
CACACAAGTTGCCATGATACAGCCATTTTAGAGCGAGCCAAAACCGTAAA
GGAATTCAAACGATTTTATTTTGAAAAGCTGGAACATCATCGAATTCTGA
AAGATCGTCGCTCCGAAGAACTGGATAACTACAAGACTTTTTGGAACGAA
TCAATAAAGAGTTTACAAAATGGCGTAAAAAATAACAGTACAAAGATTTT
GCTTCAATAAAAGAGTGAAAATGAAGTCGAATATTATTTTCCTTTTTATT
TGGCTATGAATTCAGAATTTTAC
back to top

protein sequence of SMED30007470-orf-1

>SMED30007470-orf-1 ID=SMED30007470-orf-1|Name=SMED30007470-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1419bp
MLFENNSKNFFDIKESYTDNCIKLKSKSRVDFTRDNARILSCDKVNRQLF
DSEVQLINALQNIKFKGKEAIKNSNYMNIKGSNSTNFDIVDLDEKNILDL
PDNIKSTKTNSELINQILEIRKHKFSKFFTEFYQLLGLINKKTESLINVS
CQNLNSDLLESDAEMEIRFQIINPSNLDNLIRENFQRLNNEREIAFDKQK
QLIENNIKKILLFESDRVIALRNLLLKSSTEIIRIGHFAPSEVHRIMNAI
LIEVNLSIIDNKESLHDLKTKLLMHIIDKNRKAQIYLNNQLNIWQKKMLN
KHLDVIKSKIENETIKVPATIKLCISNLNDLVSKLSVDLQDLFLKIIIEM
QPEVCNEKTIENWISFLISMRNEFNEGCDNFLKKSYEKLEQINQKRMNDI
DILKATVLAEKIYDDKNEISNVIDNLCLPLLGKFHSNFEKDLNEIEIIIE
KTCENLDIKIKDIEKFLKNLWNIWKLHERDLKKTEDGIYLKINSAISSHQ
EQNIHIENELNVMVDKMRQDSSEQNLKEDLKKCLSILDKIKTSYTNFFNQ
QSNTMKKYPSLVESDVKKFEEKIINYFSNYFSMENVGNISAEEEHPKLNN
DIFDSSRLEITDDQCLDLVKGVENNFRNFIQKWNKIVEENASKLVAIKID
EFNGELKLRFHLHEPRYKRIEYDVHNVRSTELIIHSERVSKQCKGIESSL
NTIIEDYATLERDHKMKQEKFKEKITSDEEAFLTVTNNSKLINMKKMFED
KNNEYMNELRATMRDFRKNVEIKLQKLRQTNSDFIRSFKLFSIGGNFSIE
EIDDFSRKIEKANKRIDDVEGEIMSSLEVVEKQQQDALIQFQNMFEEKFK
FHIVDINFMDKLNRAFAFIQLKIKTEVSNSNSQSRIIFENIKNLRHEFLE
QSKLRNDQKTYIQISVLESVVKSFNCVHDRCIYLDCIKTQSNPKLKPNNL
ENNDGTNQNKVQFSAITVLSKGGRQPSEDQGLKTIKSLLQIQNSYIGNQD
NQIEKLNKCKDKGVSQSDNKMTQNGNVSRSLSVVSGSVASDPKPINEKSK
LVNKNQRLEKKYLVFGDETPETTQTFLSKIKAFCKEVLDGILYAAELYYR
NKGVRKVTHSFLQESFDQAAEDIIFKLKFYFQQAEDYYKECLKEFNRQLL
ELENVINSYPEVMFSILLEKMLSECVQCLEEAETIQLKNIEILSLKKTQY
YSKLRSDFGQPSKRSELNSVCENEITRQNEEMEVILKSYETNNEIVYSCG
RKFVKIITDATEQYLLLMDNILTTADIQISETKDEPLDTKDLIRSHMNIS
SKTLDNSKNVSNSTKASWTSDDIREILLTDKNHKKFGDEALSKSLINAKH
TSCHDTAILERAKTVKEFKRFYFEKLEHHRILKDRRSEELDNYKTFWNES
IKSLQNGVKNNSTKILLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR026701CCDC180
IPR027914DUF4456
IPR028089DUF4455
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 745..776
NoneNo IPR availableCOILSCoilCoilcoord: 802..822
NoneNo IPR availablePANTHERPTHR21444FAMILY NOT NAMEDcoord: 606..1406
coord: 44..579
IPR028089Domain of unknown function DUF4455PFAMPF14643DUF4455coord: 121..577
e-value: 4.9E-58
score: 196.9
IPR027914Domain of unknown function DUF4456PFAMPF14644DUF4456coord: 1093..1292
e-value: 2.3E-30
score: 105.9
IPR026701Coiled-coil domain-containing protein 180PANTHERPTHR21444:SF14COILED-COIL DOMAIN-CONTAINING PROTEIN 180coord: 606..1406
coord: 44..579