G/T mismatch-specific thymine DNA glycosylase

Overview
NameG/T mismatch-specific thymine DNA glycosylase
Smed IDSMED30007468
Length (bp)2064
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G/T mismatch-specific thymine DNA glycosylase (SMED30007468) t-SNE clustered cells

Violin plots show distribution of expression levels for G/T mismatch-specific thymine DNA glycosylase (SMED30007468) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G/T mismatch-specific thymine DNA glycosylase (SMED30007468) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G/T mismatch-specific thymine DNA glycosylase (SMED30007468) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007468

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007468SMESG000015791.1 SMESG000029305.1 Contig1492newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007468SMESG000015791.1 SMESG000029305.1 Contig1492uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007468SMESG000036036.1 Contig1492newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007468SMESG000036036.1 Contig1492uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30007468SMESG000029305.1 SMESG000015791.1 SmedASXL_004863SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30007468SMESG000029306.1 SMESG000015791.1 SMESG000029305.1 SMESG000029302.1 dd_Smed_v4_4026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 178.333 bits (451), Expect = 8.058e-49
Identity = 83/178 (46.63%), Postives = 116/178 (65.17%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQM-LDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRG 707
            LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  +   YGIGF +   R   G+ +LS KE + G  ++V+K++KY+P+I VFNG  IYE F      +  KN   GLQP+K+  T+++ +VMPSSSARCAQ PRA+DK+ +++ LK LRD ++G
Sbjct:  124 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKG 301          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 177.948 bits (450), Expect = 9.739e-49
Identity = 83/178 (46.63%), Postives = 116/178 (65.17%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQM-LDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRG 707
            LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  +   YGIGF +   R   G+ +LS KE + G  ++V+K++KY+P+I VFNG  IYE F      +  KN   GLQP+K+  T+++ +VMPSSSARCAQ PRA+DK+ +++ LK LRD ++G
Sbjct:  120 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKG 297          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 151.754 bits (382), Expect = 7.923e-41
Identity = 75/185 (40.54%), Postives = 114/185 (61.62%), Query Frame = 3
Query:  255 MLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQM-LDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYT-EFRVTQPDPR 785
            M     HH+ GPGNHFW+C+   G+    +   DD  +   YGIGF +   R   G+ +LS KE + G  ++V+K++KY+P+I VFNG  IYE F      +  KN   GLQP+K+  T+++ +VMPSSSARCAQ PRA+DK+ +++ LK LRD ++G    ++ ++V    YT + ++ Q D +
Sbjct:    1 MAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEV---QYTFDLQLAQEDAK 182          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 117.087 bits (292), Expect = 9.528e-29
Identity = 62/140 (44.29%), Postives = 86/140 (61.43%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDS 596
            LPDIL  NLDIV++GI P  M     HH+ GPGNHFW  ++EV  ++H    +D T    YGIGF +   R   G+ +LS KE + G  ++V+K++KY+P+I VFNG  IYE F      +  KN   GLQP+K+  T++
Sbjct:  124 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFW--LSEV-QLNH---MDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTET 257          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 76.6406 bits (187), Expect = 2.926e-16
Identity = 37/83 (44.58%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  192 NLPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQM-LDYGIGFISFCTRPNKGTTELSR 437
             LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  +   YGIGF +   R   G+ +LSR
Sbjct:   27 TLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSR 109          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Celegans
Match: mrps-31 (28S ribosomal protein S31, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q09261])

HSP 1 Score: 62.7734 bits (151), Expect = 3.670e-10
Identity = 24/64 (37.50%), Postives = 47/64 (73.44%), Query Frame = -2
Query: 1875 VGFQEHVFPQQYLTG-KLPTTGMVGQFMNYVCMGLSQNPHLTVSEKKAHIKWYEEYLSTKIEEI 2063
            V F +HVF +++L    +P +G +  FM+ VC+GLS+NP++T ++K+ H+KW+ +Y +T+ +++
Sbjct:  304 VSFIDHVFLERHLPSLGIPKSGPIAHFMHLVCVGLSKNPYMTAAKKREHLKWFADYFNTEKQKL 367          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Fly
Match: Thd1 (gene:FBgn0026869 transcript:FBtr0333706)

HSP 1 Score: 217.238 bits (552), Expect = 3.883e-59
Identity = 90/195 (46.15%), Postives = 139/195 (71.28%), Query Frame = 3
Query:  162 NGNNDEKPV-LNLPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVF 743
            NG ++E+ +   +PD L +NLDIV+VGI P        HH++GPGNHFW+C+   G+    ++ ++D +++  GIGF +   R  KG+ +L+RKE+K G+ +++EK+++++PK+ VFNG  I+E F G K F  G QP++++GTD+ I+VMPSSSARCAQLPRA DK+PF+ +LKK RD + G +P ++E + VF
Sbjct:  767 NGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGKKEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNGQIPHIDESECVF 961          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Fly
Match: Thd1 (gene:FBgn0026869 transcript:FBtr0345197)

HSP 1 Score: 217.238 bits (552), Expect = 3.883e-59
Identity = 90/195 (46.15%), Postives = 139/195 (71.28%), Query Frame = 3
Query:  162 NGNNDEKPV-LNLPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVF 743
            NG ++E+ +   +PD L +NLDIV+VGI P        HH++GPGNHFW+C+   G+    ++ ++D +++  GIGF +   R  KG+ +L+RKE+K G+ +++EK+++++PK+ VFNG  I+E F G K F  G QP++++GTD+ I+VMPSSSARCAQLPRA DK+PF+ +LKK RD + G +P ++E + VF
Sbjct:  767 NGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGKKEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNGQIPHIDESECVF 961          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Fly
Match: Thd1 (gene:FBgn0026869 transcript:FBtr0089106)

HSP 1 Score: 217.238 bits (552), Expect = 3.883e-59
Identity = 90/195 (46.15%), Postives = 139/195 (71.28%), Query Frame = 3
Query:  162 NGNNDEKPV-LNLPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVF 743
            NG ++E+ +   +PD L +NLDIV+VGI P        HH++GPGNHFW+C+   G+    ++ ++D +++  GIGF +   R  KG+ +L+RKE+K G+ +++EK+++++PK+ VFNG  I+E F G K F  G QP++++GTD+ I+VMPSSSARCAQLPRA DK+PF+ +LKK RD + G +P ++E + VF
Sbjct:  767 NGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGKKEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNGQIPHIDESECVF 961          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Fly
Match: mRpS31 (gene:FBgn0036557 transcript:FBtr0075519)

HSP 1 Score: 66.6254 bits (161), Expect = 2.639e-11
Identity = 28/59 (47.46%), Postives = 38/59 (64.41%), Query Frame = -2
Query: 1887 VGFQEHVFPQQYLTGKLPTTGMVGQFMNYVCMGLSQNPHLTVSEKKAHIKWYEEYLSTK 2063
            V F EH+F +Q+L    P+ G +  FM  VC+GLS+NP+LT  EKK HI W+ +Y   K
Sbjct:  300 VDFSEHIFLEQHLEDWCPSKGPIRHFMELVCVGLSKNPYLTAQEKKDHIFWFRDYFQAK 358          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Zebrafish
Match: tdg.1 (thymine DNA glycosylase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-050522-44])

HSP 1 Score: 174.481 bits (441), Expect = 1.867e-47
Identity = 87/194 (44.85%), Postives = 121/194 (62.37%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLD-YGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGN------KNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYT 755
            LPDIL  NLD V++GI P  M       F GPGNHFW+C+   G     +   DD  + + YGIGF +   R   G+ +LS KE++ G  ++VEKIK++KP I VFNG  IYE F         K    GLQP+K+  +D+ +++MPSSSARCAQ PRA+DK+ F++ L++LRD ++G + Q E ++V   NYT
Sbjct:  152 LPDILIPNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTEKLLNHMDDQSLPEKYGIGFTNMVARATPGSKDLSSKELREGGKILVEKIKQFKPLIAVFNGKCIYEMFCRELFGKKPKTLEFGLQPHKIPDSDTALYLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLKGVIKQKEVEEV---NYT 342          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Zebrafish
Match: tdg.1 (thymine DNA glycosylase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-050522-44])

HSP 1 Score: 174.481 bits (441), Expect = 1.867e-47
Identity = 87/194 (44.85%), Postives = 121/194 (62.37%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLD-YGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGN------KNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYT 755
            LPDIL  NLD V++GI P  M       F GPGNHFW+C+   G     +   DD  + + YGIGF +   R   G+ +LS KE++ G  ++VEKIK++KP I VFNG  IYE F         K    GLQP+K+  +D+ +++MPSSSARCAQ PRA+DK+ F++ L++LRD ++G + Q E ++V   NYT
Sbjct:  152 LPDILIPNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTEKLLNHMDDQSLPEKYGIGFTNMVARATPGSKDLSSKELREGGKILVEKIKQFKPLIAVFNGKCIYEMFCRELFGKKPKTLEFGLQPHKIPDSDTALYLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLKGVIKQKEVEEV---NYT 342          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Zebrafish
Match: tdg.2 (thymine DNA glycosylase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131121-30])

HSP 1 Score: 162.925 bits (411), Expect = 1.303e-43
Identity = 75/178 (42.13%), Postives = 111/178 (62.36%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVT-CEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRG 707
            LPD++  NLD++++GI P  +      H+  PGNHFW+C+   G+ +  +    D T    YGIGF +   R   G+ +LS KE++ G   ++EK++ Y+P I VFNG  IYE F      +  KN   GLQP K+  T++V ++MPSSS RCAQ PRA+DK+ F++ LK+LRD ++G
Sbjct:  133 LPDVITHNLDMLIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTNEQLNHMHDQTLPEHYGIGFTNMVERTTPGSKDLSNKEIREGGHQLLEKLQTYRPLIAVFNGKCIYEIFCKEIFGVKAKNLEFGLQPYKVPETETVCYLMPSSSPRCAQFPRAQDKVHFYIKLKELRDQLKG 310          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Zebrafish
Match: tdg.2 (thymine DNA glycosylase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131121-30])

HSP 1 Score: 162.925 bits (411), Expect = 1.340e-43
Identity = 75/178 (42.13%), Postives = 111/178 (62.36%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVT-CEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRG 707
            LPD++  NLD++++GI P  +      H+  PGNHFW+C+   G+ +  +    D T    YGIGF +   R   G+ +LS KE++ G   ++EK++ Y+P I VFNG  IYE F      +  KN   GLQP K+  T++V ++MPSSS RCAQ PRA+DK+ F++ LK+LRD ++G
Sbjct:  132 LPDVITHNLDMLIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTNEQLNHMHDQTLPEHYGIGFTNMVERTTPGSKDLSNKEIREGGHQLLEKLQTYRPLIAVFNGKCIYEIFCKEIFGVKAKNLEFGLQPYKVPETETVCYLMPSSSPRCAQFPRAQDKVHFYIKLKELRDQLKG 309          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Zebrafish
Match: tdg.2 (thymine DNA glycosylase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131121-30])

HSP 1 Score: 67.781 bits (164), Expect = 2.577e-12
Identity = 29/81 (35.80%), Postives = 45/81 (55.56%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVT-CEDDTQMLDYGIGFISFCTRPNKGTTELS 434
            LPD++  NLD++++GI P  +      H+  PGNHFW+C+   G+ +  +    D T    YGIGF +   R   G+ +LS
Sbjct:  132 LPDVITHNLDMLIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTNEQLNHMHDQTLPEHYGIGFTNMVERTTPGSKDLS 212          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Xenopus
Match: tdg (thymine DNA glycosylase [Source:NCBI gene;Acc:448432])

HSP 1 Score: 177.563 bits (449), Expect = 2.202e-48
Identity = 85/204 (41.67%), Postives = 127/204 (62.25%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLD-YGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPR 785
            LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  + + YGIGF +   R   G+ +LS KE + G  +++EK++KYKP++  FNG  IYE F      +  K F  G+QP+++  TD+V +VMPSSSARCAQ PRA+DK+  ++ LK+LR+ ++G     E ++V +    + ++ Q D +
Sbjct:  159 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFLSGLSDMQLNHLDDHSLPEKYGIGFTNMVERTTPGSKDLSSKEFREGGRILLEKLQKYKPRVAAFNGKCIYEIFSKEIFGVKIKKFEFGIQPHRVPETDTVCYVMPSSSARCAQFPRAQDKVHHYIKLKELRNQLKGVESSREVQEVQYS--FDLQLAQADAK 360          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Xenopus
Match: tdg (thymine DNA glycosylase [Source:NCBI gene;Acc:448432])

HSP 1 Score: 177.563 bits (449), Expect = 3.639e-48
Identity = 85/204 (41.67%), Postives = 127/204 (62.25%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLD-YGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPR 785
            LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  + + YGIGF +   R   G+ +LS KE + G  +++EK++KYKP++  FNG  IYE F      +  K F  G+QP+++  TD+V +VMPSSSARCAQ PRA+DK+  ++ LK+LR+ ++G     E ++V +    + ++ Q D +
Sbjct:  172 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFLSGLSDMQLNHLDDHSLPEKYGIGFTNMVERTTPGSKDLSSKEFREGGRILLEKLQKYKPRVAAFNGKCIYEIFSKEIFGVKIKKFEFGIQPHRVPETDTVCYVMPSSSARCAQFPRAQDKVHHYIKLKELRNQLKGVESSREVQEVQYS--FDLQLAQADAK 373          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Xenopus
Match: tdg (thymine DNA glycosylase [Source:NCBI gene;Acc:448432])

HSP 1 Score: 176.407 bits (446), Expect = 9.212e-48
Identity = 83/190 (43.68%), Postives = 121/190 (63.68%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLD-YGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVF 743
            LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  + + YGIGF +   R   G+ +LS KE + G  +++EK++KYKP++  FNG  IYE F      +  K F  G+QP+++  TD+V +VMPSSSARCAQ PRA+DK+  ++ LK+LR+ ++G     E ++V +
Sbjct:  159 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFLSGLSDMQLNHLDDHSLPEKYGIGFTNMVERTTPGSKDLSSKEFREGGRILLEKLQKYKPRVAAFNGKCIYEIFSKEIFGVKIKKFEFGIQPHRVPETDTVCYVMPSSSARCAQFPRAQDKVHHYIKLKELRNQLKGVESSREVQEVQY 348          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Xenopus
Match: mrps31 (mitochondrial ribosomal protein S31 [Source:NCBI gene;Acc:779479])

HSP 1 Score: 57.7658 bits (138), Expect = 2.960e-8
Identity = 26/59 (44.07%), Postives = 36/59 (61.02%), Query Frame = -2
Query: 1887 VGFQEHVFPQQYLTGKLPTTGMVGQFMNYVCMGLSQNPHLTVSEKKAHIKWYEEYLSTK 2063
            V F EH+F  +YL    P  G +  FM  V  GLS+NP+L+V +K+ HI+WY +Y   K
Sbjct:  306 VEFHEHIFLDKYLED-FPKQGPIRHFMELVVCGLSKNPYLSVKQKREHIEWYRDYFQQK 363          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 177.948 bits (450), Expect = 4.488e-49
Identity = 83/178 (46.63%), Postives = 116/178 (65.17%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQML-DYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRG 707
            LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  +   YGIGF +   R   G+ +LS KE + G  ++V+K++KY+P+I VFNG  IYE F      +  KN   GLQP+K+  T+++ +VMPSSSARCAQ PRA+DK+ +++ LK LRD ++G
Sbjct:  111 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKG 288          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 178.333 bits (451), Expect = 5.247e-49
Identity = 83/178 (46.63%), Postives = 116/178 (65.17%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQML-DYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRG 707
            LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  +   YGIGF +   R   G+ +LS KE + G  ++V+K++KY+P+I VFNG  IYE F      +  KN   GLQP+K+  T+++ +VMPSSSARCAQ PRA+DK+ +++ LK LRD ++G
Sbjct:  135 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKG 312          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 121.324 bits (303), Expect = 6.923e-31
Identity = 61/141 (43.26%), Postives = 85/141 (60.28%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQM-LDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDS 596
            LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  +   YGIGF +   R   G+ +LS KE + G  ++V+K++KY+P+I VFNG  IYE F      +  KN   GLQP+K+  T++
Sbjct:   27 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTET 167          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 101.293 bits (251), Expect = 4.889e-24
Identity = 44/87 (50.57%), Postives = 64/87 (73.56%), Query Frame = 3
Query:  465 MVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRG 707
            +V+K++KY+P+I VFNG  IYE F      +  KN   GLQP+K+  T+++ +VMPSSSARCAQ PRA+DK+ +++ LK LRD ++G
Sbjct:    2 LVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKG 88          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 76.6406 bits (187), Expect = 1.788e-16
Identity = 37/83 (44.58%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  192 NLPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQM-LDYGIGFISFCTRPNKGTTELSR 437
             LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  +   YGIGF +   R   G+ +LSR
Sbjct:   27 TLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSR 109          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. UniProt/SwissProt
Match: sp|P56581|TDG_MOUSE (G/T mismatch-specific thymine DNA glycosylase OS=Mus musculus OX=10090 GN=Tdg PE=1 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 3.670e-48
Identity = 83/178 (46.63%), Postives = 116/178 (65.17%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQML-DYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRG 707
            LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  +   YGIGF +   R   G+ +LS KE + G  ++V+K++KY+P+I VFNG  IYE F      +  KN   GLQP+K+  T+++ +VMPSSSARCAQ PRA+DK+ +++ LK LRD ++G
Sbjct:  135 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKG 312          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. UniProt/SwissProt
Match: sp|Q13569|TDG_HUMAN (G/T mismatch-specific thymine DNA glycosylase OS=Homo sapiens OX=9606 GN=TDG PE=1 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 3.870e-48
Identity = 83/178 (46.63%), Postives = 116/178 (65.17%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQM-LDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRG 707
            LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  +   YGIGF +   R   G+ +LS KE + G  ++V+K++KY+P+I VFNG  IYE F      +  KN   GLQP+K+  T+++ +VMPSSSARCAQ PRA+DK+ +++ LK LRD ++G
Sbjct:  124 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKG 301          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. UniProt/SwissProt
Match: sp|O59825|TDG_SCHPO (G/U mismatch-specific uracil DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=thp1 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 3.593e-18
Identity = 52/167 (31.14%), Postives = 88/167 (52.69%), Query Frame = 3
Query:  171 NDEKPVL--NLPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMV--SHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVF-NGIGIYEAFIGN-------KNFSMGLQPNKMEGTDSVIFVMPSSSARCA 635
            N+  P L   +PD + EN   ++VG+ P     +  H F+ P N FW+ + +  ++  +   T  +D  +  +G+G  + C RP+    +L ++EM+ GA ++ EK+K+Y+P++ +F +G GI+E            K F  G QP K    D+ +FV  SSS R A
Sbjct:  132 NEVDPALLQGVPDYICENPYAIIVGLNPGITSSLKGHAFASPSNRFWKMLNKSKLLEGNAEFTYLNDKDLPAHGLGITNLCARPSSSGADLRKEEMQDGARILYEKVKRYRPQVGLFISGKGIWEEMYKMLTGKKLPKTFVFGWQPEKF--GDANVFVGISSSGRAA 296          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. UniProt/SwissProt
Match: sp|Q6D9D7|MUG_PECAS (G/U mismatch-specific DNA glycosylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=mug PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.617e-18
Identity = 45/144 (31.25%), Postives = 69/144 (47.92%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSA 626
            + DIL  NL +V  GI P        +HF+ P N FW+ I + G     +T  ++  +LD G G      RP    TEL R E+  G   +VEK+ +Y+P+ +   G   +    G K  S G Q  ++  T   ++V+P+ S 
Sbjct:    2 ITDILAMNLQVVFCGINPGLSTAHHGYHFANPNNRFWKVIHQAGFTERLLTPAEEQHLLDTGCGITMLVERPTVEATELGRDELLQGGNAIVEKMTRYQPRALAVLGKQAFSQAFGIKKVSWGRQERRIGETQ--VWVLPNPSG 143          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. UniProt/SwissProt
Match: sp|C6DKG5|MUG_PECCP (G/U mismatch-specific DNA glycosylase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=mug PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.199e-17
Identity = 46/144 (31.94%), Postives = 69/144 (47.92%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSA 626
            + DIL  NL +V  GI P        +HF+ P N FW+ I  VG     +T  ++  +LD G G      RP    TEL R E+  G   +VEK+++Y+P+ +   G   +    G K  S G Q   +  T   ++V+P+ S 
Sbjct:    2 ITDILAMNLQVVFCGINPGLSTAHHGYHFANPSNRFWKVIHHVGFTERLLTPAEEQHLLDTGCGITMLVERPTVEATELGRDELLQGGNAIVEKMERYQPRALAVLGKQAFSQAFGIKKVSWGRQSLNIGETQ--VWVLPNPSG 143          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. TrEMBL
Match: A0A3R7CLJ3 (G/T mismatch-specific thymine DNA glycosylase (Fragment) OS=Clonorchis sinensis OX=79923 GN=TDG PE=4 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 2.800e-95
Identity = 133/198 (67.17%), Postives = 164/198 (82.83%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRS 788
            LPD L+E LDIV+VGI PS       HH++GPGNHFW CI++ G+V   VTC DD +MLDYGIGF + CTRP KG  EL+RKEMK GA +M+EK++KY+PKI VFNG GIYEA++G+KNFSMG QP  ++GTD+ IFVMPSSSARCAQLPRAEDK+PFFV+L+KLRD++RGDL +L + +VVF +YTEFRVTQPDP+S
Sbjct:   54 LPDHLKEGLDIVIVGINPSLASASVGHHYAGPGNHFWTCISQAGLVPEMVTCYDDERMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYRPKIAVFNGKGIYEAYVGHKNFSMGRQPTTLDGTDTTIFVMPSSSARCAQLPRAEDKLPFFVALRKLRDYIRGDLSELPDSEVVFADYTEFRVTQPDPKS 251          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. TrEMBL
Match: A0A1S8WRA8 (Uracil-DNA glycosylase family protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_07237 PE=4 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 1.387e-94
Identity = 133/198 (67.17%), Postives = 164/198 (82.83%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRS 788
            LPD L+E LDIV+VGI PS       HH++GPGNHFW CI++ G+V   VTC DD +MLDYGIGF + CTRP KG  EL+RKEMK GA +M+EK++KY+PKI VFNG GIYEA++G+KNFSMG QP  ++GTD+ IFVMPSSSARCAQLPRAEDK+PFFV+L+KLRD++RGDL +L + +VVF +YTEFRVTQPDP+S
Sbjct:   93 LPDHLKEGLDIVIVGINPSLASASVGHHYAGPGNHFWTCISQAGLVPEMVTCYDDERMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYRPKIAVFNGKGIYEAYVGHKNFSMGRQPTTLDGTDTTIFVMPSSSARCAQLPRAEDKLPFFVALRKLRDYIRGDLSELPDSEVVFADYTEFRVTQPDPKS 290          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. TrEMBL
Match: A0A183PSR6 (UDG domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS17402 PE=4 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 1.982e-94
Identity = 131/199 (65.83%), Postives = 165/199 (82.91%), Query Frame = 3
Query:  192 NLPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRS 788
            +LPD L+E LDIV+VGI PS       HH++GPGNHFW C+++ G+V   V+C DD++MLDYGIGF + CTRP KG  EL+RKEMK GA +M+EK++KYKPKI VFNG GIYEA++G+KNF MG QP  ++GTD VIFVMPSSSARCAQLPRAEDK+PFF++L+KLRD++RGDL +L + +VVF +YTEFRVTQPDP+S
Sbjct:   24 SLPDHLKEGLDIVIVGINPSLASAHVGHHYAGPGNHFWTCLSQAGLVPMAVSCYDDSKMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYKPKIAVFNGKGIYEAYVGHKNFCMGRQPTTLDGTDIVIFVMPSSSARCAQLPRAEDKLPFFLALRKLRDYVRGDLAELPDSEVVFADYTEFRVTQPDPKS 222          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. TrEMBL
Match: A0A074ZXA2 (UDG domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_11500 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 4.097e-94
Identity = 133/198 (67.17%), Postives = 164/198 (82.83%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRS 788
            LPD L+E LDIV+VGI PS       HH++GPGNHFW CI++ G+V   VTC DD +MLDYGIGF + CTRP KG  EL+RKEMK GA +M+EK++KY+PKI VFNG GIYEA++G+KNFSMG QP  ++GTD+ IFVMPSSSARCAQLPRAEDK+PFFV+L+KLRD++RGDL +L + +VVF +YTEFRVTQPDP+S
Sbjct:   72 LPDHLKEGLDIVIVGINPSLASASVGHHYAGPGNHFWTCISQAGLVPEMVTCYDDERMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYRPKIAVFNGKGIYEAYVGHKNFSMGRQPTTLDGTDTTIFVMPSSSARCAQLPRAEDKLPFFVALRKLRDYIRGDLSELPDSEVVFADYTEFRVTQPDPKS 269          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. TrEMBL
Match: A0A3P6NTE1 (UDG domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS94 PE=4 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 1.788e-93
Identity = 136/210 (64.76%), Postives = 167/210 (79.52%), Query Frame = 3
Query:  162 NGNNDEKPVLN-LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRS 788
            N N D +   N LPD L+E LDIV+VGI PS       HH++GPGNHFW C+TE G+V   VTC DD  MLDYGIGF + CTR  KG  EL+RKEMK G+ +M++KI+KYKPKI VFNG GIYEAFIG+KNFSMG QP  + GTD+V+FVMPSSSARCAQLPRAEDK+PFF++L+KLR+++RG+ P+L + +VVF +YTEFRVTQPDP+S
Sbjct:   39 NANVDGQLCSNALPDHLKEGLDIVIVGINPSIASAHLGHHYAGPGNHFWTCLTEAGLVPTEVTCYDDMNMLDYGIGFTNVCTRATKGAAELTRKEMKAGSAVMLDKIRKYKPKIAVFNGKGIYEAFIGHKNFSMGKQPQPLAGTDTVVFVMPSSSARCAQLPRAEDKLPFFIALRKLREYLRGERPELSDSEVVFNDYTEFRVTQPDPKS 248          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Cavefish
Match: tdg.2 (G/T mismatch-specific thymine DNA glycosylase-like [Source:NCBI gene;Acc:103045467])

HSP 1 Score: 174.096 bits (440), Expect = 1.067e-47
Identity = 85/213 (39.91%), Postives = 126/213 (59.15%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLD-YGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDL--PQLEEKDVVFE--------NYTEFRVTQPDP 782
            LPDI+  +LDI+++GI P  +      H+  PGNHFW+C+   G+    +    D  + D +GIGF +   R   G+ +LS KE++ G   ++EK++ Y+P+I  FNG GIYE F      +  KN   GLQP K+ GT++V ++MPSSS RCAQ PRA+DK+ F++ LK+LRD M+G +  P++EE    F+             +  QPDP
Sbjct:  135 LPDIITYDLDILIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTEEQLNYMHDQTLPDRHGIGFTNMVERTTPGSKDLSNKEIREGGKQLLEKLQMYRPRIAAFNGKGIYEIFCKEIFGVKAKNLEFGLQPYKVPGTETVCYLMPSSSPRCAQFPRAQDKVHFYIRLKELRDQMKGVVKNPEVEETQYTFDLNMAKEDAKRMAIKEEQPDP 347          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Cavefish
Match: tdg.1 (G/T mismatch-specific thymine DNA glycosylase [Source:NCBI gene;Acc:103043944])

HSP 1 Score: 166.392 bits (420), Expect = 1.460e-44
Identity = 80/178 (44.94%), Postives = 110/178 (61.80%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVT-CEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGN------KNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRG 707
            LPDIL  NLD V++GI P  M       F GPGNHFW+C+   G     +    D T    YGIGF +   R   G+ +LS KE++ G  ++VEKIK++KP I VFNG  IYE F         K    GLQP+K+  +++ +++MPSSSARCAQ PRA+DK+ F++ L++LRD ++G
Sbjct:  156 LPDILTPNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTDQLLNHMHDQTLPEKYGIGFTNMVARATPGSKDLSSKELREGGKILVEKIKQFKPLIAVFNGKCIYEMFCREIFGKKPKTLEFGLQPHKIPDSETALYLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLKG 333          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Sea Lamprey
Match: tdg.2 (thymine DNA glycosylase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131121-30])

HSP 1 Score: 177.178 bits (448), Expect = 2.796e-49
Identity = 84/193 (43.52%), Postives = 123/193 (63.73%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLD-YGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGN------KNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLP--QLEEKDVVFE 746
            LPDIL  NLDIV++GI P  M     HH+ GPGNHFW+C+   G+    +   DD  + + YGIGF +   R   G+ +L  KE++ G  ++++K++K+KP I VFNG  I+E F         KNF  G QPNK+  TD +++VMPSSSARCAQ PRA+DK+ F++ +K+LR+  +G  P  +++E +  F+
Sbjct:  173 LPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFLSGLTDQLLNHLDDKSLPEKYGIGFTNMVERTTPGSKDLKSKEIREGGKILLQKLQKFKPTIAVFNGKCIFEIFFKEVFGEKIKNFQFGEQPNKIPETDIIVYVMPSSSARCAQFPRAQDKVHFYIKMKELRNSTKGVTPNEEIQETEYTFD 365          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011012.1 (pep scaffold:Pmarinus_7.0:GL480982:4649:4843:-1 gene:ENSPMAG00000009986.1 transcript:ENSPMAT00000011012.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 4.464e-12
Identity = 28/57 (49.12%), Postives = 40/57 (70.18%), Query Frame = -2
Query: 1887 FQEHVFPQQYLTGKLPTTGMVGQFMNYVCMGLSQNPHLTVSEKKAHIKWYEEYLSTK 2057
            F EHVF +++LT + P++G V  FM  V  GLS+NP+LTV++K+ HI W+ EY   K
Sbjct:    1 FHEHVFLERHLT-EFPSSGPVRHFMQLVVTGLSKNPYLTVAQKREHIAWFREYFEKK 56          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Nematostella
Match: EDO42559 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S194])

HSP 1 Score: 162.155 bits (409), Expect = 1.955e-45
Identity = 85/209 (40.67%), Postives = 121/209 (57.89%), Query Frame = 3
Query:   96 YQQQNGNVDFTQNNKN--QNFTKPN--GNNDEKPVLNL--PDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMR 704
            Y  + G  D + NN +  +   +PN  G   E+ V+ L  PD + ENLDI+ +GI P        HH++GP NHFW C+ + G+V   +T  DD +   YGIG  +   R  +G+++LSRKE+K G   ++ K+K+ KP +  FNG GIYE F  +K   +G Q   + GT+ V++VMPSSS R    PRA DK+ FF  LK LRD  +
Sbjct:   17 YFDRPGTSDDSSNNGSPARKRARPNKYGGMSEEDVMKLLLPDRVAENLDILFIGINPGLTSAYKGHHYAGPNNHFWPCLYDSGLVPEKLTFRDDEKCPAYGIGLTNIVERTTRGSSDLSRKEIKDGVDALIVKVKRLKPLVACFNGKGIYEIFSKSK-CEIGRQTKCIPGTNVVVYVMPSSSGRTMTYPRASDKLKFFTELKSLRDEAK 224          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Medaka
Match: tdg.2 (G/T mismatch-specific thymine DNA glycosylase [Source:NCBI gene;Acc:101162834])

HSP 1 Score: 175.637 bits (444), Expect = 2.151e-47
Identity = 80/181 (44.20%), Postives = 114/181 (62.98%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLD-YGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF------IGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLP 716
            LPD++  NLDI+++GI P  +     HH+  PGNHFW+C+   G+    +    D  + + Y IGF +   R   G+ +LS KE++ G   ++EK++KYKP I  FNG GIYE F      +  KN   GLQP K+  T++V ++MPSSS RCAQ PRA+DK+ F++ LK+LRD M+G LP
Sbjct:  276 LPDVITYNLDILIIGINPGLLSAFKGHHYPNPGNHFWKCLFLSGLTEEQLNYMHDQNLPEKYSIGFTNMVERTTPGSKDLSSKEIREGGRQLLEKLQKYKPLIAAFNGKGIYEIFCKEIFGVKAKNLEFGLQPYKIPETETVCYLMPSSSPRCAQFPRAQDKVHFYIKLKELRDQMKGLLP 456          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Medaka
Match: tdg.1 (thymine DNA glycosylase [Source:NCBI gene;Acc:101155844])

HSP 1 Score: 168.703 bits (426), Expect = 3.082e-45
Identity = 85/193 (44.04%), Postives = 117/193 (60.62%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQM-LDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF----IGNK--NFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDL--PQLEEKDVVFE 746
            LPD+L  NLD V++GI P  M       F GPGNHFW+C+   G     +    DT + + Y +GF +   R   G+ +LS KE++ G  ++VEK+KKYKP I VFNG  IYE F     G K      GLQP+K+   D  +F+MPSSSARCAQ PRA+DK+ F++ L++LRD ++G     ++EE D  F+
Sbjct:  167 LPDLLDHNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTEDQLNHMHDTTLPVKYKMGFTNMVARATPGSKDLSSKELREGGKILVEKLKKYKPLIAVFNGKCIYEMFCRELFGKKPQKLEFGLQPHKIPDCDVALFLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLKGVRRNTEIEEVDYSFD 359          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Medaka
Match: tdg.1 (thymine DNA glycosylase [Source:NCBI gene;Acc:101155844])

HSP 1 Score: 169.088 bits (427), Expect = 2.273e-44
Identity = 85/193 (44.04%), Postives = 117/193 (60.62%), Query Frame = 3
Query:  195 LPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQM-LDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAF----IGNK--NFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDL--PQLEEKDVVFE 746
            LPD+L  NLD V++GI P  M       F GPGNHFW+C+   G     +    DT + + Y +GF +   R   G+ +LS KE++ G  ++VEK+KKYKP I VFNG  IYE F     G K      GLQP+K+   D  +F+MPSSSARCAQ PRA+DK+ F++ L++LRD ++G     ++EE D  F+
Sbjct:  167 LPDLLDHNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTEDQLNHMHDTTLPVKYKMGFTNMVARATPGSKDLSSKELREGGKILVEKLKKYKPLIAVFNGKCIYEMFCRELFGKKPQKLEFGLQPHKIPDCDVALFLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLKGVRRNTEIEEVDYSFD 359          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Medaka
Match: mrps31 (mitochondrial ribosomal protein S31 [Source:NCBI gene;Acc:101173806])

HSP 1 Score: 59.6918 bits (143), Expect = 3.934e-9
Identity = 28/66 (42.42%), Postives = 39/66 (59.09%), Query Frame = -2
Query: 1866 VGFQEHVFPQQYLTGKLPTTGMVGQFMNYVCMGLSQNPHLTVSEKKAHIKWYEEYLSTKIEEIDMA 2063
            V F EH+F  ++L    P  G V  FM  V  GLS+NP+LTV +KK HI W+ +Y   K + ++ A
Sbjct:  286 VPFHEHIFLDKHLEQGFPQHGPVRHFMELVVAGLSRNPYLTVKQKKEHIDWFRDYFHHKEDVLNEA 351          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Planmine SMEST
Match: SMESG000015791.1 (SMESG000015791.1)

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 482/483 (99.79%), Postives = 483/483 (100.00%), Query Frame = 3
Query:  327 MVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRSXXXXXXXXXXXXXXXXXHALQDNVGXXXXXXXXXXXXXXXPMENEIIKDERNXXXXXXXXXXXXXXXXXXIVNSSLLSWPQNGGLTIIHTGQPIIMPTNTNPTAQSNTLLLLDPTGLSFSSIPVPMNSTQLQVRPMILPTDNEQRISTTAHLSTISSIKPIEGSNSFANFSPNIKARPPVDIQKTTPVKSTIKVLTTNENSKSIIMMSTGASVAXXXXXXXXXXXXXXXKPIAEAQTLNQTFAQIEHDTTPVSVANQSQPDKGANNEQQIKYNPLNDPNDEWELFMNGIFTGEFXXXXXXXXXXXXXXDAIEEYEILSQFNVSRILTVL 1775
            MVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRSLLKAERRRKRKAELNAEHALQDNVGENSTTTTNEESKSKKPMENEIIKDERNSYDSTQTSFSSSIQNQSTIVNSSLLSWPQNGGLTIIHTGQPIIMPTNTNPTAQSNTLLLLDPTGLSFSSIPVPMNSTQLQVRPMILPTDNEQRISTTAHLSTISSIKPIEGSNSFANFSPNIKARPPVDIQKTTPVKSTIKVLTTNENSKSIIMMSTGASVATSTINSTIQTNT+SNKPIAEAQTLNQTFAQIEHDTTPVSVANQSQPDKGANNEQQIKYNPLNDPNDEWELFMNGIFTGEFAYPAPPQTVPVQPTDAIEEYEILSQFNVSRILTVL
Sbjct:    1 MVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRSLLKAERRRKRKAELNAEHALQDNVGENSTTTTNEESKSKKPMENEIIKDERNSYDSTQTSFSSSIQNQSTIVNSSLLSWPQNGGLTIIHTGQPIIMPTNTNPTAQSNTLLLLDPTGLSFSSIPVPMNSTQLQVRPMILPTDNEQRISTTAHLSTISSIKPIEGSNSFANFSPNIKARPPVDIQKTTPVKSTIKVLTTNENSKSIIMMSTGASVATSTINSTIQTNTDSNKPIAEAQTLNQTFAQIEHDTTPVSVANQSQPDKGANNEQQIKYNPLNDPNDEWELFMNGIFTGEFAYPAPPQTVPVQPTDAIEEYEILSQFNVSRILTVL 483          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Planmine SMEST
Match: SMESG000029306.1 (SMESG000029306.1)

HSP 1 Score: 508.064 bits (1307), Expect = 1.752e-177
Identity = 300/305 (98.36%), Postives = 302/305 (99.02%), Query Frame = 3
Query:  327 MVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRSXXXXXXXXXXXXXXXXXHALQDNVGXXXXXXXXXXXXXXXPMENEIIKDERNXXXXXXXXXXXXXXXXXXIVNSSLLSWPQNGGLTIIHTGQPIIMPTNTNPTAQSNTLLLLDPTGLSFSSIPVPMNSTQLQVRPMILPTDNEQRISTTAH 1241
            MVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRSLLKAERRRKRKAELNAEHALQDNVGENSTTTTNEESKSKKPMENEIIKDERNSYDSTQTSFSSSIQNQSTIVNSSLLSWPQNGGLTIIHTGQPIIMPTNTNPTAQSNTLLLLDPTGLSFSSIPVPMNSTQLQVRPMILPTDNEQ +S  +H
Sbjct:    1 MVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRSLLKAERRRKRKAELNAEHALQDNVGENSTTTTNEESKSKKPMENEIIKDERNSYDSTQTSFSSSIQNQSTIVNSSLLSWPQNGGLTIIHTGQPIIMPTNTNPTAQSNTLLLLDPTGLSFSSIPVPMNSTQLQVRPMILPTDNEQ-LSLISH 304          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Planmine SMEST
Match: SMESG000029306.1 (SMESG000029306.1)

HSP 1 Score: 506.138 bits (1302), Expect = 7.519e-177
Identity = 298/298 (100.00%), Postives = 298/298 (100.00%), Query Frame = 3
Query:  327 MVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRSXXXXXXXXXXXXXXXXXHALQDNVGXXXXXXXXXXXXXXXPMENEIIKDERNXXXXXXXXXXXXXXXXXXIVNSSLLSWPQNGGLTIIHTGQPIIMPTNTNPTAQSNTLLLLDPTGLSFSSIPVPMNSTQLQVRPMILPTDNEQ 1220
            MVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRSLLKAERRRKRKAELNAEHALQDNVGENSTTTTNEESKSKKPMENEIIKDERNSYDSTQTSFSSSIQNQSTIVNSSLLSWPQNGGLTIIHTGQPIIMPTNTNPTAQSNTLLLLDPTGLSFSSIPVPMNSTQLQVRPMILPTDNEQ
Sbjct:    1 MVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRSLLKAERRRKRKAELNAEHALQDNVGENSTTTTNEESKSKKPMENEIIKDERNSYDSTQTSFSSSIQNQSTIVNSSLLSWPQNGGLTIIHTGQPIIMPTNTNPTAQSNTLLLLDPTGLSFSSIPVPMNSTQLQVRPMILPTDNEQ 298          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Planmine SMEST
Match: SMESG000067021.1 (SMESG000067021.1)

HSP 1 Score: 308.531 bits (789), Expect = 1.664e-93
Identity = 135/212 (63.68%), Postives = 170/212 (80.19%), Query Frame = 3
Query:  156 KPNGNNDEKPV-LNLPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRS 788
            + NG ++E+ V   LPD L+ENLD++VVGI PS       HH++G GNHFW CI E G+V   VTC DD +M+DYGIGF + C+RP KG  E+SRKEMK GA +M+EK++KYKPKI VFNG GIYEAFIG+KNF MG QP  ++GTD ++FVMPSSSARCAQLPRAEDK+PFF++L+KLRDH+ GDLP L +++V+F +YTEFRVTQPDP+S
Sbjct:   91 RYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKS 302          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Planmine SMEST
Match: SMESG000067021.1 (SMESG000067021.1)

HSP 1 Score: 308.145 bits (788), Expect = 2.160e-93
Identity = 135/212 (63.68%), Postives = 170/212 (80.19%), Query Frame = 3
Query:  156 KPNGNNDEKPV-LNLPDILRENLDIVVVGITPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFISFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIGNKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLRDHMRGDLPQLEEKDVVFENYTEFRVTQPDPRS 788
            + NG ++E+ V   LPD L+ENLD++VVGI PS       HH++G GNHFW CI E G+V   VTC DD +M+DYGIGF + C+RP KG  E+SRKEMK GA +M+EK++KYKPKI VFNG GIYEAFIG+KNF MG QP  ++GTD ++FVMPSSSARCAQLPRAEDK+PFF++L+KLRDH+ GDLP L +++V+F +YTEFRVTQPDP+S
Sbjct:   91 RYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKS 302          
The following BLAST results are available for this feature:
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TDG8.058e-4946.63thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
TDG9.739e-4946.63thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
TDG7.923e-4140.54thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
TDG9.528e-2944.29thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
TDG2.926e-1644.58thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps-313.670e-1037.5028S ribosomal protein S31, mitochondrial [Source:... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Thd13.883e-5946.15gene:FBgn0026869 transcript:FBtr0333706[more]
Thd13.883e-5946.15gene:FBgn0026869 transcript:FBtr0345197[more]
Thd13.883e-5946.15gene:FBgn0026869 transcript:FBtr0089106[more]
mRpS312.639e-1147.46gene:FBgn0036557 transcript:FBtr0075519[more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdg.11.867e-4744.85thymine DNA glycosylase, tandem duplicate 1 [Sourc... [more]
tdg.11.867e-4744.85thymine DNA glycosylase, tandem duplicate 1 [Sourc... [more]
tdg.21.303e-4342.13thymine DNA glycosylase, tandem duplicate 2 [Sourc... [more]
tdg.21.340e-4342.13thymine DNA glycosylase, tandem duplicate 2 [Sourc... [more]
tdg.22.577e-1235.80thymine DNA glycosylase, tandem duplicate 2 [Sourc... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tdg2.202e-4841.67thymine DNA glycosylase [Source:NCBI gene;Acc:4484... [more]
tdg3.639e-4841.67thymine DNA glycosylase [Source:NCBI gene;Acc:4484... [more]
tdg9.212e-4843.68thymine DNA glycosylase [Source:NCBI gene;Acc:4484... [more]
mrps312.960e-844.07mitochondrial ribosomal protein S31 [Source:NCBI g... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tdg4.488e-4946.63thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
Tdg5.247e-4946.63thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
Tdg6.923e-3143.26thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
Tdg4.889e-2450.57thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
Tdg1.788e-1644.58thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56581|TDG_MOUSE3.670e-4846.63G/T mismatch-specific thymine DNA glycosylase OS=M... [more]
sp|Q13569|TDG_HUMAN3.870e-4846.63G/T mismatch-specific thymine DNA glycosylase OS=H... [more]
sp|O59825|TDG_SCHPO3.593e-1831.14G/U mismatch-specific uracil DNA glycosylase OS=Sc... [more]
sp|Q6D9D7|MUG_PECAS4.617e-1831.25G/U mismatch-specific DNA glycosylase OS=Pectobact... [more]
sp|C6DKG5|MUG_PECCP1.199e-1731.94G/U mismatch-specific DNA glycosylase OS=Pectobact... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7CLJ32.800e-9567.17G/T mismatch-specific thymine DNA glycosylase (Fra... [more]
A0A1S8WRA81.387e-9467.17Uracil-DNA glycosylase family protein (Fragment) O... [more]
A0A183PSR61.982e-9465.83UDG domain-containing protein OS=Schistosoma matth... [more]
A0A074ZXA24.097e-9467.17UDG domain-containing protein OS=Opisthorchis vive... [more]
A0A3P6NTE11.788e-9364.76UDG domain-containing protein OS=Dibothriocephalus... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tdg.21.067e-4739.91G/T mismatch-specific thymine DNA glycosylase-like... [more]
tdg.11.460e-4444.94G/T mismatch-specific thymine DNA glycosylase [Sou... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tdg.22.796e-4943.52thymine DNA glycosylase, tandem duplicate 2 [Sourc... [more]
ENSPMAT00000011012.14.464e-1249.12pep scaffold:Pmarinus_7.0:GL480982:4649:4843:-1 ge... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO425591.955e-4540.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tdg.22.151e-4744.20G/T mismatch-specific thymine DNA glycosylase [Sou... [more]
tdg.13.082e-4544.04thymine DNA glycosylase [Source:NCBI gene;Acc:1011... [more]
tdg.12.273e-4444.04thymine DNA glycosylase [Source:NCBI gene;Acc:1011... [more]
mrps313.934e-942.42mitochondrial ribosomal protein S31 [Source:NCBI g... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015791.10.000e+099.79SMESG000015791.1[more]
SMESG000029306.11.752e-17798.36SMESG000029306.1[more]
SMESG000029306.17.519e-177100.00SMESG000029306.1[more]
SMESG000067021.11.664e-9363.68SMESG000067021.1[more]
SMESG000067021.12.160e-9363.68SMESG000067021.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007468 ID=SMED30007468|Name=G/T mismatch-specific thymine DNA glycosylase|organism=Schmidtea mediterranea sexual|type=transcript|length=2064bp
TTATTATTTAATATTATTTCTATAAAAACTATTGAATAATTAACTTAATT
AATAATTGTTAAGCTAATATTTAAGTTTATAAATATATTATCATGTATCA
ACAGCAAAATGGAAATGTTGATTTTACACAGAATAATAAAAATCAAAATT
TTACTAAACCAAATGGAAATAATGATGAAAAGCCAGTATTAAATTTACCT
GATATTTTAAGAGAAAACTTAGATATTGTTGTGGTTGGCATAACACCGTC
AGGAATGTTAGGAGTATCAAATCATCATTTTTCCGGGCCCGGAAATCATT
TTTGGAGATGCATAACAGAAGTAGGGATGGTTTCCCATCCAGTCACCTGT
GAGGATGACACTCAAATGCTAGATTATGGAATAGGTTTTATCAGTTTTTG
TACCCGTCCAAATAAAGGAACCACCGAATTAAGTAGGAAAGAAATGAAAA
TTGGTGCCGGATTAATGGTGGAAAAGATCAAAAAATATAAACCGAAAATT
GTGGTGTTTAACGGGATTGGTATCTATGAGGCGTTTATTGGCAATAAGAA
TTTCTCAATGGGTCTACAACCGAATAAAATGGAAGGAACGGATTCTGTCA
TATTCGTTATGCCGTCATCTAGTGCCAGATGTGCCCAATTGCCGAGAGCA
GAGGACAAAATACCGTTTTTTGTTTCATTGAAAAAGTTGAGAGATCACAT
GAGAGGTGATTTACCGCAACTCGAAGAGAAAGATGTCGTATTTGAAAACT
ACACGGAATTCCGAGTCACCCAGCCTGATCCGAGAAGTCTACTGAAAGCT
GAAAGGCGCCGAAAACGAAAAGCCGAATTAAACGCGGAACATGCTCTACA
GGATAATGTAGGGGAAAATTCAACAACGACCACAAATGAGGAGTCGAAAT
CCAAAAAACCAATGGAAAATGAAATAATTAAAGATGAAAGAAACAGCTAC
GATTCTACTCAGACTTCATTTTCATCGTCTATTCAAAATCAATCGACTAT
TGTCAATTCTTCGTTGTTGTCATGGCCACAGAATGGGGGATTGACAATTA
TCCACACTGGTCAACCAATCATAATGCCAACCAATACCAATCCGACTGCA
CAGTCTAATACATTGCTATTGCTGGATCCCACTGGACTGTCATTTTCATC
GATTCCAGTTCCAATGAATTCGACTCAGTTGCAAGTTCGACCGATGATAT
TGCCAACAGACAATGAACAGCGTATTTCCACAACGGCTCACTTGTCAACC
ATTAGTTCTATCAAGCCAATTGAAGGATCGAATAGTTTCGCTAATTTCTC
ACCAAACATCAAAGCTCGTCCACCTGTAGATATACAGAAAACGACACCGG
TGAAATCCACAATAAAAGTACTGACGACGAATGAAAACAGCAAATCGATT
ATTATGATGAGTACTGGGGCCAGTGTAGCAACCTCTACGATAAATAGCAC
CATTCAAACAAACACTGAATCAAACAAACCAATAGCAGAAGCACAAACCT
TAAACCAAACGTTTGCTCAGATAGAACATGATACAACTCCAGTAAGCGTA
GCAAACCAATCACAACCCGACAAAGGTGCAAATAATGAGCAACAAATCAA
ATACAATCCTCTAAACGATCCAAATGATGAATGGGAGCTATTTATGAACG
GCATATTCACGGGCGAATTTGCGTATCCTGCTCCTCCCCAAACCGTGCCA
GTGCAACCAACTGATGCTATTGAAGAATATGAAATCCTATCTCAATTCAA
TGTTTCACGGATTTTAACAGTTTTATAATAAATAAACAAATCAATATTAA
AACATGTATTAACGTTTATTTCGTAACTCTTGTTCGTATTTCGCATCTTC
GATGCTCTTTTGCATTGCCATATCGATTTCTTCTATTTTAGTTGACAGAT
ACTCTTCATACCATTTAATATGGGCTTTTTTCTCACTTACGGTAAGATGG
GGATTTTGGCTCAGTCCCATGCAGACATAATTCATGAATTGCCCAACCAT
TCCGGTTGTCGGTAATTTACCAGTGAGATATTGCTGAGGAAAAACATGCT
CCTGAAATCCGACT
back to top

protein sequence of SMED30007468-orf-1

>SMED30007468-orf-1 ID=SMED30007468-orf-1|Name=SMED30007468-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=562bp
MYQQQNGNVDFTQNNKNQNFTKPNGNNDEKPVLNLPDILRENLDIVVVGI
TPSGMLGVSNHHFSGPGNHFWRCITEVGMVSHPVTCEDDTQMLDYGIGFI
SFCTRPNKGTTELSRKEMKIGAGLMVEKIKKYKPKIVVFNGIGIYEAFIG
NKNFSMGLQPNKMEGTDSVIFVMPSSSARCAQLPRAEDKIPFFVSLKKLR
DHMRGDLPQLEEKDVVFENYTEFRVTQPDPRSLLKAERRRKRKAELNAEH
ALQDNVGENSTTTTNEESKSKKPMENEIIKDERNSYDSTQTSFSSSIQNQ
STIVNSSLLSWPQNGGLTIIHTGQPIIMPTNTNPTAQSNTLLLLDPTGLS
FSSIPVPMNSTQLQVRPMILPTDNEQRISTTAHLSTISSIKPIEGSNSFA
NFSPNIKARPPVDIQKTTPVKSTIKVLTTNENSKSIIMMSTGASVATSTI
NSTIQTNTESNKPIAEAQTLNQTFAQIEHDTTPVSVANQSQPDKGANNEQ
QIKYNPLNDPNDEWELFMNGIFTGEFAYPAPPQTVPVQPTDAIEEYEILS
QFNVSRILTVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036895Uracil-DNA_glycosylase-like_sf
IPR015637MUG/TDG
IPR026299MRP-S31
IPR005122Uracil-DNA_glycosylase-like
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
GO:0019104DNA N-glycosylase activity
Vocabulary: cellular component
TermDefinition
GO:0005763mitochondrial small ribosomal subunit
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 234..254
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 231..249
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 253..267
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..29
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 231..278
NoneNo IPR availablePANTHERPTHR12159:SF9G/T MISMATCH-SPECIFIC THYMINE DNA GLYCOSYLASEcoord: 16..257
IPR036895Uracil-DNA glycosylase-like domain superfamilyGENE3DG3DSA:3.40.470.10coord: 18..212
e-value: 4.4E-60
score: 204.7
IPR036895Uracil-DNA glycosylase-like domain superfamilySUPERFAMILYSSF52141Uracil-DNA glycosylase-likecoord: 35..200
IPR005122Uracil-DNA glycosylase-likePFAMPF03167UDGcoord: 38..182
e-value: 3.1E-13
score: 50.0
IPR015637G/U mismatch-specific DNA glycosylasePANTHERPTHR12159G/T AND G/U MISMATCH-SPECIFIC DNA GLYCOSYLASEcoord: 16..257
IPR015637G/U mismatch-specific DNA glycosylaseCDDcd10028UDG_F2_MUGcoord: 35..193
e-value: 5.47411E-56
score: 183.492