Asparagine synthetase [glutamine-hydrolyzing]

Overview
NameAsparagine synthetase [glutamine-hydrolyzing]
Smed IDSMED30007463
Length (bp)1389
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007463

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007463SMESG000051174.1 SmedASXL_014341SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30007463SMESG000051174.1 dd_Smed_v6_25387_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30007463SMESG000051174.1 OX_Smed_1.0.03136ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 332.028 bits (850), Expect = 9.717e-108
Identity = 186/455 (40.88%), Postives = 282/455 (61.98%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSK--CEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K ++ +F+F+     D E IL+LY+K G +     LDG+FA +L+D  +KK FL RD  G+RPL+        + V SEAKGL+ +  S+    ++E  LPG+   ++L   G     E+  Y+      LH+ +   EK       E + +N+R +  +AVKKRL +DRRIGCLLSGGLDSS+VA  + +  KE+ +      L+TF++GM ED  D L A  VA H+ + H + +FN E+ I+ L  +I+SLE++D +++RAS+G+Y + K++++N++ VV+ +GEGSDELT GY +FH+    EK++ E  RLLR L+ FD+ R+D   +   +E RVPFLDH+F +YY SL  +++ PK G+EK LLR++
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQV---QYPLQTFAIGM-EDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRET 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 332.028 bits (850), Expect = 9.717e-108
Identity = 186/455 (40.88%), Postives = 282/455 (61.98%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSK--CEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K ++ +F+F+     D E IL+LY+K G +     LDG+FA +L+D  +KK FL RD  G+RPL+        + V SEAKGL+ +  S+    ++E  LPG+   ++L   G     E+  Y+      LH+ +   EK       E + +N+R +  +AVKKRL +DRRIGCLLSGGLDSS+VA  + +  KE+ +      L+TF++GM ED  D L A  VA H+ + H + +FN E+ I+ L  +I+SLE++D +++RAS+G+Y + K++++N++ VV+ +GEGSDELT GY +FH+    EK++ E  RLLR L+ FD+ R+D   +   +E RVPFLDH+F +YY SL  +++ PK G+EK LLR++
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQV---QYPLQTFAIGM-EDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRET 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 332.028 bits (850), Expect = 9.717e-108
Identity = 186/455 (40.88%), Postives = 282/455 (61.98%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSK--CEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K ++ +F+F+     D E IL+LY+K G +     LDG+FA +L+D  +KK FL RD  G+RPL+        + V SEAKGL+ +  S+    ++E  LPG+   ++L   G     E+  Y+      LH+ +   EK       E + +N+R +  +AVKKRL +DRRIGCLLSGGLDSS+VA  + +  KE+ +      L+TF++GM ED  D L A  VA H+ + H + +FN E+ I+ L  +I+SLE++D +++RAS+G+Y + K++++N++ VV+ +GEGSDELT GY +FH+    EK++ E  RLLR L+ FD+ R+D   +   +E RVPFLDH+F +YY SL  +++ PK G+EK LLR++
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQV---QYPLQTFAIGM-EDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRET 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 322.013 bits (824), Expect = 3.476e-104
Identity = 180/433 (41.57%), Postives = 274/433 (63.28%), Query Frame = 1
Query:  118 KLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSK--CEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K ++ +F+F+     D E IL+LY+K G +     LDG+FA +L+D  +KK FL RD  G+RPL+        + V SEAKGL+ +  S+    ++E  LPG+   ++L   G     E+  Y+      LH+ +   EK       E + +N+R +  +AVKKRL +DRRIGCLLSGGLDSS+VA  + +  KE+ +      L+TF++GM ED  D L A  VA H+ + H + +FN E+ I+ L  +I+SLE++D +++RAS+G+Y + K++++N++ VV+ +GEGSDELT GY +FH+    EK++ E  RLLR L+ FD+ R+D   +   +E RVPFLDH+F +YY SL  +++ PK G+EK LLR++
Sbjct:    2 KIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQV---QYPLQTFAIGM-EDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRET 430          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 322.013 bits (824), Expect = 3.476e-104
Identity = 180/433 (41.57%), Postives = 274/433 (63.28%), Query Frame = 1
Query:  118 KLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSK--CEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K ++ +F+F+     D E IL+LY+K G +     LDG+FA +L+D  +KK FL RD  G+RPL+        + V SEAKGL+ +  S+    ++E  LPG+   ++L   G     E+  Y+      LH+ +   EK       E + +N+R +  +AVKKRL +DRRIGCLLSGGLDSS+VA  + +  KE+ +      L+TF++GM ED  D L A  VA H+ + H + +FN E+ I+ L  +I+SLE++D +++RAS+G+Y + K++++N++ VV+ +GEGSDELT GY +FH+    EK++ E  RLLR L+ FD+ R+D   +   +E RVPFLDH+F +YY SL  +++ PK G+EK LLR++
Sbjct:    2 KIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQV---QYPLQTFAIGM-EDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRET 430          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Match: asns-1 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:O16924])

HSP 1 Score: 211.075 bits (536), Expect = 5.704e-62
Identity = 150/453 (33.11%), Postives = 232/453 (51.21%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSII--GDNQNMQPLVHPKFPHLRMVCNGEIYNYKLL--EDYFDFKSAFASDVECILYLYEKYGAKL--MASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCE-IEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW ++   + T +    F K+  RGPD   LE +   P   +GFHRL+I+  GD  + QP+V      L +VCNGEIYN++ L  +  F  K+   SD   I+  + K+   L    +SLDG+FA I+ D   K  ++ RD +G+RPL++       +++ SE K + E+     CE +E   PG    I+L      V+    Y V     +  +F   + T+ +   +R +L  +V+KRL  +R  G +LSGGLDSS++A +     K+  +         FSVG  ED  D   A  VA +L   H+  V   +  I  +P ++++LE+FD   IR  I  Y LC+ + ++S+  VLL+GEG+DEL   Y +  +  ++     E  R + +LH +D+ R D   S   +E RVPFLD +F+     L    K     +EK +LR +
Sbjct:    1 MCGIWAIIG-EQVTPQQQDAFMKIVGRGPDLTVLEEVQ--PNVHLGFHRLAIVMPGDTPSAQPIVGGG---LSVVCNGEIYNHQSLKIDCPFTLKNG-GSDCAAIITSFIKHNKDLKEACASLDGVFAFIMAD--DKNVYIGRDPIGVRPLFYGYNSNGSLLIGSEVKCIEEL-----CERVEYFPPGCCATISLFAPTRPVQPQQYYSV---PTIADRFLSIDCTKTL---VRDVLVKSVEKRLMGNRNFGFMLSGGLDSSLIASIATRFLKQKPIA--------FSVGF-EDSPDLENAKKVADYLKIPHEVLVITPQQCIDIIPEVVFALETFDPLIIRCGIAHYLLCQHISKSSDVKVLLSGEGADELFGSYAYMQRAPNALHLHKEILRRMHHLHQYDVLRCDRSTSCHGLEIRVPFLDKRFIDLVSRLPPSYKLMPMKLEKHVLRSA 424          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Match: asns-2 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZI9])

HSP 1 Score: 169.088 bits (427), Expect = 2.028e-46
Identity = 145/465 (31.18%), Postives = 231/465 (49.68%), Query Frame = 1
Query:   52 MCGIWGVL-----NYRKCTLKLVKNFEKLKH-RGPD---SYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDY----FDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLI-RDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPK-----FGVEKWLLRKS 1389
            MCG++ +      N  K  L   +   + +H RGPD    Y+  +     G  +   RL+I+ D   +QPL     P+ +++ NGEIYN++ L D     ++ K+    D E I++LYEKY    + + LDG+FA +L        FL  RD +G++ +Y+          S+E K L +    +K  IE   PG+      + K   V+  N  +   +  +H    +          +++ +  +V KRL SD  IG LLSGGLDSS+V+ +     K   +      + +FS+G+  +  D + A  VAK + T H +  F+ E+ IK L  +I+ LES+D +SIRAS  +YFL + +++     V+L+GEG+DE+  GY +FH     E  Q E    + +L+  D  R+D       +E RVPFLD  F+    SLD   K+P+        EK++LR +
Sbjct:    1 MCGVFSICQQTCKNKPKYDLDEARKLSRRQHHRGPDFSGCYQDTKT----GDILVHERLAIM-DLGVVQPL-QGTAPNRQVIHNGEIYNHQELRDTELKKYNLKTH--CDSEVIIFLYEKYRDGHICNLLDGVFAFVLC---CDGDFLAARDPLGVKQMYYGIDDDGRYFFSNEMKCLEDSCGDNK--IESFPPGHY----YTPKTGFVRYFNPEWFDFRKAIHPLDLKL---------LQKTMIASVHKRLMSDAPIGVLLSGGLDSSLVSSIASREMKRRGMA-----VHSFSIGVDHNSPDVVAARKVAKFIGTTHHEFYFSIEEGIKNLRKLIWHLESYDVTSIRASTPMYFLSEEIRKLG-IKVVLSGEGADEIFGGYLYFHNAPSDEDFQKETIDRVLHLYTSDCLRADKSSMAHSVEVRVPFLDKAFVEAAVSLDPAFKRPQKLEDGRNCEKFVLRSA 433          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Match: asns-2 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZI9])

HSP 1 Score: 169.088 bits (427), Expect = 2.556e-46
Identity = 145/465 (31.18%), Postives = 231/465 (49.68%), Query Frame = 1
Query:   52 MCGIWGVL-----NYRKCTLKLVKNFEKLKH-RGPD---SYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDY----FDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLI-RDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPK-----FGVEKWLLRKS 1389
            MCG++ +      N  K  L   +   + +H RGPD    Y+  +     G  +   RL+I+ D   +QPL     P+ +++ NGEIYN++ L D     ++ K+    D E I++LYEKY    + + LDG+FA +L        FL  RD +G++ +Y+          S+E K L +    +K  IE   PG+      + K   V+  N  +   +  +H    +          +++ +  +V KRL SD  IG LLSGGLDSS+V+ +     K   +      + +FS+G+  +  D + A  VAK + T H +  F+ E+ IK L  +I+ LES+D +SIRAS  +YFL + +++     V+L+GEG+DE+  GY +FH     E  Q E    + +L+  D  R+D       +E RVPFLD  F+    SLD   K+P+        EK++LR +
Sbjct:    1 MCGVFSICQQTCKNKPKYDLDEARKLSRRQHHRGPDFSGCYQDTKT----GDILVHERLAIM-DLGVVQPL-QGTAPNRQVIHNGEIYNHQELRDTELKKYNLKTH--CDSEVIIFLYEKYRDGHICNLLDGVFAFVLC---CDGDFLAARDPLGVKQMYYGIDDDGRYFFSNEMKCLEDSCGDNK--IESFPPGHY----YTPKTGFVRYFNPEWFDFRKAIHPLDLKL---------LQKTMIASVHKRLMSDAPIGVLLSGGLDSSLVSSIASREMKRRGMA-----VHSFSIGVDHNSPDVVAARKVAKFIGTTHHEFYFSIEEGIKNLRKLIWHLESYDVTSIRASTPMYFLSEEIRKLG-IKVVLSGEGADEIFGGYLYFHNAPSDEDFQKETIDRVLHLYTSDCLRADKSSMAHSVEVRVPFLDKAFVEAAVSLDPAFKRPQKLEDGRNCEKFVLRSA 433          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Match: asns-2 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZI9])

HSP 1 Score: 91.6633 bits (226), Expect = 1.071e-19
Identity = 95/327 (29.05%), Postives = 154/327 (47.09%), Query Frame = 1
Query:   52 MCGIWGVL-----NYRKCTLKLVKNFEKLKH-RGPD---SYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDY----FDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLI-RDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFE 990
            MCG++ +      N  K  L   +   + +H RGPD    Y+  +     G  +   RL+I+ D   +QPL     P+ +++ NGEIYN++ L D     ++ K+    D E I++LYEKY    + + LDG+FA +L        FL  RD +G++ +Y+          S+E K L +    +K  IE   PG+      + K   V+  N  +   +  +H    +          +++ +  +V KRL SD  IG LLSGGLDSS+V+ +     K   +  +S     FS+G+  +  D + A  VAK + T H +  F+ E
Sbjct:    1 MCGVFSICQQTCKNKPKYDLDEARKLSRRQHHRGPDFSGCYQDTKT----GDILVHERLAIM-DLGVVQPL-QGTAPNRQVIHNGEIYNHQELRDTELKKYNLKTH--CDSEVIIFLYEKYRDGHICNLLDGVFAFVLC---CDGDFLAARDPLGVKQMYYGIDDDGRYFFSNEMKCLEDSCGDNK--IESFPPGHYY----TPKTGFVRYFNPEWFDFRKAIHPLDLKL---------LQKTMIASVHKRLMSDAPIGVLLSGGLDSSLVSSIASREMKRRGMAVHS-----FSIGVDHNSPDVVAARKVAKFIGTTHHEFYFSIE 296          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Fly
Match: AsnS (gene:FBgn0270926 transcript:FBtr0089463)

HSP 1 Score: 185.652 bits (470), Expect = 2.736e-52
Identity = 140/437 (32.04%), Postives = 225/437 (51.49%), Query Frame = 1
Query:  118 KLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAF---ASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQP----KFG------VEKWLLRKS 1389
            K +HRGPDS  +  +  L G  +   RL IIG     QP V     +L +V NGEIYNY  L      K       SD   IL LY+ YG  L+   + GMFA  L D  +K+  L RD  GI P+Y        + V+SE K L++       ++E   PG         +  KV +  + +   Q+ +     Q+ +       +R  L+ AV+  LQ D ++G LLSGG+DSS++A +  +I +E    + + +L+TFSVG+  D  D   A  VAK++++ HK+ +F  ++ +  + +IIY LE++D +++R S+ +  L +++K ++   ++L+GEG+DE+  GY +FH+         E  + +R LH  D  R++       +E RVPFLD  F+ +   +  + K P    KFG      +EK++LR +
Sbjct:   37 KHRHRGPDSTGV-YVNSLEGVAMIHERLRIIGVEMGDQPFVSED-GNLILVANGEIYNYLELSAEIAKKRGSYNPMSDCHVILELYQDYGKDLL-QYITGMFAFALYDRKTKEVLLARDPFGIIPMYVGEDASGNLWVASEMKCLVDTC----SKVETFTPGEA-------RFGKVGDFKTCWQFQQSWIKEVPTQTCE----LSLLRANLEFAVRSHLQCDVQMGALLSGGVDSSLIASIATKIMRER---DPNFRLKTFSVGL-RDAPDFQAARSVAKYIDSDHKEIIFEIDEALDGIRDIIYHLETYDVTTVRCSLPMLLLARYIK-STGIKMILSGEGADEIFGGYLYFHKAPSYNDFHEELVKRVRQLHLSDCLRANKVAMAKGVELRVPFLDTGFVNHVMQIRPEDKIPGPLNKFGEVQQKRLEKYVLRAA 450          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Zebrafish
Match: asns (asparagine synthetase [Source:ZFIN;Acc:ZDB-GENE-040426-1091])

HSP 1 Score: 328.561 bits (841), Expect = 1.234e-106
Identity = 181/454 (39.87%), Postives = 270/454 (59.47%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALS-SKCEIEIVLPGNIVEINLSHKG-AKVKEINSYYVLGQNLLHSKFYQSE------KTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +    +C      N  K+ HRGPD++R E +      C GFHRL+I+     MQPL   KFP+L +  NGEIYN+  L+++F+F      D E +L+LY+++G + M S LDG+FA IL+D  ++K  L RD  G+RPL+ +      + V SE KGL ++  S    +I    PG+    +L   G  +  +++ ++       H+ F + E      + E +  NIR + +DAV+KRL + RRIGCLLSGGLDSS+VA L+ ++ KE  L      ++TFS+G +ED  D   A  VA ++ + H    F  E+ I  L ++I  LES+D +++RASIG+Y + K+++E ++ VV+ +GEGSDELT GY +FH+    +    +  RLL  L+ FD+ R+D   +   +E RVPFLDH+F AYY SL  +++ PK GVEK LLR +
Sbjct:    1 MCGIWALFGSDECLSVQCTNAMKIFHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQPLRVKKFPYLWLCYNGEIYNHIKLKNHFEFDYQTKVDGEILLHLYDRFGIEKMCSLLDGVFAFILLDTANRKVHLGRDTYGVRPLFRMLTDDGFLAVCSEGKGLTQIKHSMPTAKITAFPPGHFEVFDLKLNGKVESVQMDRFHCCTDKPKHADFNKLEGLGTDFELETVKSNIRILFEDAVRKRLMAHRRIGCLLSGGLDSSLVAALLVKLAKEEKL---PYPIQTFSIG-AEDSPDVAAARKVADYIGSEHHVVNFTPEEGISALEDVIVHLESYDITTVRASIGMYLVSKYIREKTDSVVIFSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLEELYLFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPEEMRVPKNGVEKHLLRDA 450          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Xenopus
Match: asns (asparagine synthetase (glutamine-hydrolyzing) [Source:NCBI gene;Acc:448254])

HSP 1 Score: 338.961 bits (868), Expect = 1.272e-111
Identity = 182/455 (40.00%), Postives = 284/455 (62.42%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEM--ALSSKCEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +    +C      +  K+ HRGPD++R E +      C GFHRL+I+     MQPL   KFP+L +  NGEIYN+K LE  F F+     D E IL+LY ++G +  A+ LDG+FA IL+D  ++K +L RD+ G+RPL+ L      + V SEAKGL+++  +++S  +++   PG+    +L   G     E+  ++      LH+ +   +K       E +  NI  + ++AV+KRL + RRIGCLLSGGLDSS+VA  + ++ KE ++      L+TF+VG +ED  D L A  VA H+ + H + +F+ E+ I+ +  +I+SLE++D +++RAS+G+Y + K++++ ++ VV+ +GEGSDELT GY +FH+   +E++  +  RLLR L+ FD+ R+D   +   +E RVPFLDH+  AYY SL  +L+ PK G+EK+LLR+S
Sbjct:    1 MCGIWALFGSDECLSVQCLSAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQPLRVKKFPYLWLCYNGEIYNFKQLEKNFGFEYQTLVDGEVILHLYSEHGIEKTAALLDGVFAFILLDTANRKVYLGRDSYGVRPLFRLLTDDGFLAVCSEAKGLIDLKHSMTSCPKVDPFPPGHYEVFDLKPSGKVTSVEVIKFHNFRDEPLHAAYDTLDKLQPGTDRETVKRNICCLFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLIKLIKERNM---HYPLQTFAVG-TEDSPDLLAARKVALHIGSEHHEIMFDPEEGIQAVDEVIFSLETYDITTVRASVGMYLISKYIRKKTDSVVIFSGEGSDELTQGYIYFHKAPSAEEAAEDSERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRLTAYYLSLPPELRIPKNGIEKYLLRES 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Xenopus
Match: asns (asparagine synthetase (glutamine-hydrolyzing) [Source:NCBI gene;Acc:448254])

HSP 1 Score: 338.576 bits (867), Expect = 1.869e-110
Identity = 182/455 (40.00%), Postives = 284/455 (62.42%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEM--ALSSKCEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +    +C      +  K+ HRGPD++R E +      C GFHRL+I+     MQPL   KFP+L +  NGEIYN+K LE  F F+     D E IL+LY ++G +  A+ LDG+FA IL+D  ++K +L RD+ G+RPL+ L      + V SEAKGL+++  +++S  +++   PG+    +L   G     E+  ++      LH+ +   +K       E +  NI  + ++AV+KRL + RRIGCLLSGGLDSS+VA  + ++ KE ++      L+TF+VG +ED  D L A  VA H+ + H + +F+ E+ I+ +  +I+SLE++D +++RAS+G+Y + K++++ ++ VV+ +GEGSDELT GY +FH+   +E++  +  RLLR L+ FD+ R+D   +   +E RVPFLDH+  AYY SL  +L+ PK G+EK+LLR+S
Sbjct:    1 MCGIWALFGSDECLSVQCLSAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQPLRVKKFPYLWLCYNGEIYNFKQLEKNFGFEYQTLVDGEVILHLYSEHGIEKTAALLDGVFAFILLDTANRKVYLGRDSYGVRPLFRLLTDDGFLAVCSEAKGLIDLKHSMTSCPKVDPFPPGHYEVFDLKPSGKVTSVEVIKFHNFRDEPLHAAYDTLDKLQPGTDRETVKRNICCLFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLIKLIKERNM---HYPLQTFAVG-TEDSPDLLAARKVALHIGSEHHEIMFDPEEGIQAVDEVIFSLETYDITTVRASVGMYLISKYIRKKTDSVVIFSGEGSDELTQGYIYFHKAPSAEEAAEDSERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRLTAYYLSLPPELRIPKNGIEKYLLRES 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Xenopus
Match: asns (asparagine synthetase (glutamine-hydrolyzing) [Source:NCBI gene;Acc:448254])

HSP 1 Score: 217.238 bits (552), Expect = 3.807e-65
Identity = 120/312 (38.46%), Postives = 197/312 (63.14%), Query Frame = 1
Query:  481 PLYFLRYPGNCIMVSSEAKGLMEM--ALSSKCEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            PL+ L      + V SEAKGL+++  +++S  +++   PG+    +L   G     E+  ++      LH+ +   +K       E +  NI  + ++AV+KRL + RRIGCLLSGGLDSS+VA  + ++ KE ++      L+TF+VG +ED  D L A  VA H+ + H + +F+ E+ I+ +  +I+SLE++D +++RAS+G+Y + K++++ ++ VV+ +GEGSDELT GY +FH+   +E++  +  RLLR L+ FD+ R+D   +   +E RVPFLDH+  AYY SL  +L+ PK G+EK+LLR+S
Sbjct:    5 PLFRLLTDDGFLAVCSEAKGLIDLKHSMTSCPKVDPFPPGHYEVFDLKPSGKVTSVEVIKFHNFRDEPLHAAYDTLDKLQPGTDRETVKRNICCLFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLIKLIKERNM---HYPLQTFAVG-TEDSPDLLAARKVALHIGSEHHEIMFDPEEGIQAVDEVIFSLETYDITTVRASVGMYLISKYIRKKTDSVVIFSGEGSDELTQGYIYFHKAPSAEEAAEDSERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRLTAYYLSLPPELRIPKNGIEKYLLRES 312          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Match: Asns (asparagine synthetase [Source:MGI Symbol;Acc:MGI:1350929])

HSP 1 Score: 341.658 bits (875), Expect = 9.902e-112
Identity = 185/455 (40.66%), Postives = 280/455 (61.54%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSK--CEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEKT------ENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K L+  F+F+     D E IL+LY+K G +     LDG+FA IL+D  +KK FL RD  G+RPL+        + V SEAKGL+ +  S+    ++E  LPG+   ++L   G     E+  Y+      LH+ +   EK       E + +N+R +  +A+KKRL +DRRIGCLLSGGLDSS+VA  + +  KE+ +      L+TF++GM ED  D L A  VA ++ + H + +FN E+ I+ L  +I+SLE++D +++RAS+G+Y + K++++N++ VV+ +GEGSDELT GY +FH+    EK++ E  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F +YY SL   ++ PK G+EK LLR++
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEKLFPGFDLETVKNNLRILFDNAIKKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQV---QYPLQTFAIGM-EDSPDLLAARKVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPDMRIPKNGIEKHLLRET 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Match: Asns (asparagine synthetase [Source:MGI Symbol;Acc:MGI:1350929])

HSP 1 Score: 341.658 bits (875), Expect = 9.902e-112
Identity = 185/455 (40.66%), Postives = 280/455 (61.54%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSK--CEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEKT------ENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K L+  F+F+     D E IL+LY+K G +     LDG+FA IL+D  +KK FL RD  G+RPL+        + V SEAKGL+ +  S+    ++E  LPG+   ++L   G     E+  Y+      LH+ +   EK       E + +N+R +  +A+KKRL +DRRIGCLLSGGLDSS+VA  + +  KE+ +      L+TF++GM ED  D L A  VA ++ + H + +FN E+ I+ L  +I+SLE++D +++RAS+G+Y + K++++N++ VV+ +GEGSDELT GY +FH+    EK++ E  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F +YY SL   ++ PK G+EK LLR++
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEKLFPGFDLETVKNNLRILFDNAIKKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQV---QYPLQTFAIGM-EDSPDLLAARKVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPDMRIPKNGIEKHLLRET 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Match: Asns (asparagine synthetase [Source:MGI Symbol;Acc:MGI:1350929])

HSP 1 Score: 142.51 bits (358), Expect = 2.805e-39
Identity = 82/221 (37.10%), Postives = 120/221 (54.30%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSK--CEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEK 705
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K L+  F+F+     D E IL+LY+K G +     LDG+FA IL+D  +KK FL RD  G+RPL+        + V SEAKGL+ +  S+    ++E  LPG+   ++L   G     E+  Y+      LH+ +   EK
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEK 221          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Match: Asns (asparagine synthetase [Source:MGI Symbol;Acc:MGI:1350929])

HSP 1 Score: 126.716 bits (317), Expect = 3.134e-34
Identity = 62/146 (42.47%), Postives = 87/146 (59.59%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLY 489
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K L+  F+F+     D E IL+LY+K G +     LDG+FA IL+D  +KK FL RD  G+RPL+
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLF 146          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Match: Asns (asparagine synthetase [Source:MGI Symbol;Acc:MGI:1350929])

HSP 1 Score: 105.145 bits (261), Expect = 1.083e-26
Identity = 52/127 (40.94%), Postives = 74/127 (58.27%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVD 432
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K L+  F+F+     D E IL+LY+K G +     LDG+FA IL+D
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLD 127          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|P19891|ASNS_CRIGR (Asparagine synthetase [glutamine-hydrolyzing] OS=Cricetulus griseus OX=10029 GN=ASNS PE=2 SV=2)

HSP 1 Score: 342.813 bits (878), Expect = 2.211e-111
Identity = 185/455 (40.66%), Postives = 280/455 (61.54%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSK--CEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHS------KFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K L+  F+F+     D E IL+LY+K G +     LDG+FA IL+D  +KK FL RD  G+RPL+        + V SEAKGL+ +  S+    ++E  LPG+   ++L   G     E+  Y+      LH+      K +Q  + E +  N+R +   AV+KRL +DRRIGCLLSGGLDSS+VA  + +  KE+ +      L+TF++GM ED  D L A  VA ++ + H + +FN E+ I+ L  +I+SLE++D +++RAS+G+Y + K++++N++ VV+ +GEGSDELT GY +FH+    EK++ E  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F +YY SL  +++ PK G+EK LLR++
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEQTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDEPLHALYDSVEKLFQGFELETVKSNLRILFDSAVRKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQV---QYPLQTFAIGM-EDSPDLLAARKVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRET 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|P49088|ASNS_RAT (Asparagine synthetase [glutamine-hydrolyzing] OS=Rattus norvegicus OX=10116 GN=Asns PE=2 SV=3)

HSP 1 Score: 342.813 bits (878), Expect = 2.990e-111
Identity = 185/455 (40.66%), Postives = 281/455 (61.76%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSK--CEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K L+  F+F+     D E IL+LY+K G +     LDG+FA IL+D  +KK FL RD  G+RPL+        + V SEAKGL+ +  S+    ++E  LPG+   ++L   G     E+  Y+      LH+ +   EK       E + +N+R +  +A+KKRL +DRRIGCLLSGGLDSS+VA  + +  KE+ +      L+TF++GM ED  D L A  VA ++ + H + +FN E+ I+ L  +I+SLE++D +++RAS+G+Y + K++++N++ VV+ +GEGSDELT GY +FH+    EK++ E  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F +YY SL  +++ PK G+EK LLR++
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKALTEDGFLAVCSEAKGLVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEKLFPGFEIETVKNNLRILFNNAIKKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQV---PYALQTFAIGM-EDSPDLLAARKVANYIGSEHHEVLFNSEEGIQSLDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKDGIEKHLLRET 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|Q61024|ASNS_MOUSE (Asparagine synthetase [glutamine-hydrolyzing] OS=Mus musculus OX=10090 GN=Asns PE=1 SV=3)

HSP 1 Score: 341.658 bits (875), Expect = 6.927e-111
Identity = 185/455 (40.66%), Postives = 280/455 (61.54%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSK--CEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEKT------ENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K L+  F+F+     D E IL+LY+K G +     LDG+FA IL+D  +KK FL RD  G+RPL+        + V SEAKGL+ +  S+    ++E  LPG+   ++L   G     E+  Y+      LH+ +   EK       E + +N+R +  +A+KKRL +DRRIGCLLSGGLDSS+VA  + +  KE+ +      L+TF++GM ED  D L A  VA ++ + H + +FN E+ I+ L  +I+SLE++D +++RAS+G+Y + K++++N++ VV+ +GEGSDELT GY +FH+    EK++ E  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F +YY SL   ++ PK G+EK LLR++
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEKLFPGFDLETVKNNLRILFDNAIKKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQV---QYPLQTFAIGM-EDSPDLLAARKVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPDMRIPKNGIEKHLLRET 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|Q5ZJU3|ASNS_CHICK (Asparagine synthetase [glutamine-hydrolyzing] OS=Gallus gallus OX=9031 GN=ASNS PE=2 SV=3)

HSP 1 Score: 340.887 bits (873), Expect = 1.294e-110
Identity = 184/455 (40.44%), Postives = 283/455 (62.20%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKC--EIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHS------KFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +    +C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   KFP+L +  NGEIYN+K L++ F F+     D E IL+LY + G +  AS LDG+FA IL+D  ++K FL RD  G+RPL+ +      + V SEAKGL+ +  S+    ++E  LPG+   ++L   G  V  E+  ++      LH+              E +  NIR + ++AV+KRL + RRIGCLLSGGLDSS+VA ++ ++ KE ++      L+TF++GM E+  D L A  VA H+ + H + +FN E+ I+ +  +I+SLE++D +++RASIG+Y + K++++ ++ VV+ +GEGSDELT GY +FH+    E++  E  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F +YY SL ++L+ PK G+EK+LLR+S
Sbjct:    1 MCGIWALFGSDECLSVQCLSAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAVVDQLYGMQPIRVKKFPYLWLCYNGEIYNFKQLQEQFGFEYQTLVDGEVILHLYNRGGIEQTASMLDGVFAFILLDTANRKVFLARDTYGVRPLFKVLTDDGFLGVCSEAKGLINLKHSTSLFPKVEPFLPGHYEVLDLKPSGKVVSVEVVKFHSYKDEPLHAACDTVGNLPSGFDLETVKSNIRVLFENAVRKRLMAHRRIGCLLSGGLDSSLVAAVLLKLMKEMNI---KYPLQTFAIGM-ENSPDLLAARKVAAHIGSEHHEVIFNSEEGIQAVEEVIFSLETYDITTVRASIGMYLVSKYIRKKTDSVVIFSGEGSDELTQGYIYFHKAPSPEEAAEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFTSYYLSLPAELRIPKNGIEKYLLRQS 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|P17714|ASNS_MESAU (Asparagine synthetase [glutamine-hydrolyzing] OS=Mesocricetus auratus OX=10036 GN=ASNS PE=1 SV=3)

HSP 1 Score: 338.576 bits (867), Expect = 1.215e-109
Identity = 184/455 (40.44%), Postives = 279/455 (61.32%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSK--CEIEIVLPGNIVEINLSHKGAKVK-EINSYYVLGQNLLHSKFYQSEKT------ENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+++     MQP+   K+P+L +  NGEIYN+K L+  F+F+     D E IL+LY+K G +     LDG+FA IL+D  +KK FL RD  G+RPL+        + V SEAKGL+ +  S+    ++E  LPG+   ++L   G     E+  Y+      LH+ +   EK       E +  N+R +  +AV+KRL +DRRI CLLSGGLDSS+VA  + +  KE+ +      L+TF++GM ED  D L A  VA ++ + H + +FN E+ I+ L  +I+SLE++D +++RAS+G+Y + K++++N++ VV+ +GEGSDELT GY +FH+    EK++ E  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F +YY SL  +++ PK G+EK LLR++
Sbjct:    1 MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEQTICMLDGVFAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVSLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDEPLHALYDSVEKLFPGFELETVKSNLRILFDNAVRKRLMTDRRIVCLLSGGLDSSLVASSLLKQLKEAQV---QYPLQTFAIGM-EDSPDLLAARKVANYIGSEHHEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRVPKNGIEKHLLRET 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: A0A1S6KMF3 (Glutamine amidotransferase type-2 domain-containing protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 917.916 bits (2371), Expect = 0.000e+0
Identity = 446/446 (100.00%), Postives = 446/446 (100.00%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS
Sbjct:    1 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 446          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: A0A5A9NKK8 (Asparagine synthetase [glutamine-hydrolyzing] OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti015736 PE=4 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 1.829e-114
Identity = 190/456 (41.67%), Postives = 285/456 (62.50%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEM--ALSSKCEIEIVLPGNIVEINLSHKGAKVK--EINSYYVLGQNLLHSKFYQSE------KTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +    +C    + N  K+ HRGPD++R E + +    C GFHRL+I+     MQPL   KFPHL +  NGEIYN+  L+D F+F      D E +L+LY+++G + MAS LDG+FA IL+D   +K FL RD  G+RPL+ +      + V SEAKGL E+  ++S   +I    PG+  E NL   G KV+  +IN ++ L     H+ +   E      + E +  NIR + ++AV+KRL   RRIGCLLSGGLDSS+VA  + ++ KE +L     +++TF++G +ED  D + A  VA ++ + H +  F+ E+ I+ L  +I+ LES+D +++RAS+G+Y + KF++E ++ VV+ +GEGSDELT GY +FH+    E    E  RLL+ L+ FD+ R+D   + + +E R PFLDH+F AYY SL  +++ PK G+EK+LLR++
Sbjct:    1 MCGIWALFGSDECLAVQIINAMKIAHRGPDAFRFENVNDFTNCCFGFHRLAIVDKLYGMQPLRVKKFPHLWLCYNGEIYNHIRLKDQFEFDYQTKVDGEILLHLYDRFGIEKMASLLDGVFAFILLDTTKRKVFLGRDTYGVRPLFKMITDDGFLSVCSEAKGLTEIKHSMSIPAKITPFPPGHFEEFNLKSTG-KVEHVQINRFHNLTDEPEHATYDILEGLCKGFELETVKSNIRILFENAVRKRLMGHRRIGCLLSGGLDSSLVAATLLKLAKEENL---DYKIQTFAIG-TEDSTDIIAARKVAAYIGSEHHEVSFSPEEGIRALEEVIFHLESYDITTVRASVGMYLISKFIREKTDRVVIFSGEGSDELTQGYIYFHKAPSPEAGSEEAMRLLKELYLFDLLRADRTTAAFGLELRAPFLDHRFTAYYLSLPEEMRTPKDGIEKYLLREA 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: A0A1S3INM5 (asparagine synthetase [glutamine-hydrolyzing] OS=Lingula unguis OX=7574 GN=LOC106165722 PE=4 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 1.894e-113
Identity = 188/450 (41.78%), Postives = 278/450 (61.78%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSS---KCEIEIVLPGNIVEINLSHKG-AKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +        +   +  K+ HRGPD++R+E +      C+ FHRL+I+ D   MQP+     PHL M+ NGEIYN KL++  FDF      D E IL+LY   GA+  A  LDG+FA +L+D   +K +L RD  G+RP + +   G  + V SEAKGL+ +A +S   + +I+   PG++   +L  KG AK +EI  ++ +G ++   +       +++  NIR +L  AVKKRL ++RRIGCLLSGGLDSS+VA L+ +  KE  +     +++TF+ GM     D L A  VA  L T H +  F  E+ I+ L ++I  LES+D +++RAS G+Y + K++ EN++ VV+ +GEG+DEL  GY +FH    +E++ +E  RLL +L+ +D+ R D   + W +E RVPFLDHQF +YY S+D KL+QPK GVEK+LLR +
Sbjct:    1 MCGIWAIFGSDDDVSRQCSSCLKIAHRGPDAFRIENVNHFKNCCLAFHRLAIVDDIYGMQPMRVHALPHLWMIYNGEIYNCKLVQKQFDFDYETNCDGEAILHLYNHGGAEFAAQHLDGVFAFVLLDTSERKVYLGRDTYGVRPAFRMVEDG-FLAVCSEAKGLLGLAHTSTDHEVDIQPFPPGHVETYSLDKKGKAKFQEIKRFHKIG-DMPKYETLAPALVDDVTTNIRNLLNAAVKKRLMANRRIGCLLSGGLDSSLVAALVVKNAKELGV---PYKVQTFATGMP-GSTDILAARKVADFLGTEHHEVFFTEEEGIQALGDVIRHLESYDITTVRASTGMYLVSKYISENTDSVVIFSGEGADELCQGYIYFHNAPTAEEADVESRRLLDDLYLYDVLRGDRTTAGWGLELRVPFLDHQFTSYYLSIDPKLRQPKDGVEKYLLRSA 444          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: A0A210PVE5 (Asparagine synthetase [glutamine-hydrolyzing] OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19003 PE=4 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 3.055e-113
Identity = 185/452 (40.93%), Postives = 277/452 (61.28%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGL-----MEMALSSKCEIEIVLPGNIVEINLSHKG-AKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW V           K   K+ HRGPD++RLE I + P  C+GFHRL+I+     MQP+  P++PH+ ++ NGEIYN+  L+  F+F  A   D E I++LY + G +  A  LDG+FA  L+D  ++K +L RD  G++PL+ +      +   SE K L     + +  +    +E  LPG++   NL   G A   E   ++ +G    + K   +   +NI  +IR + + AVKKR+ +DRRIGCLLSGGLDSS+ A  + ++ KE +L      ++TFS+GM +D  D + A  VAKHL T H + VF  E+ I  + ++IY LES+D +++R+S+GLY L K++K+ ++  V+L+GEGSDE+  GY +FH+    E    E SRL ++L+ +D+ RSD   S W +E RVPFLDHQF +YY SL+ ++K PK+G+EK+LLR +
Sbjct:    1 MCGIWAVFGSSGDIFTHCKAAFKIAHRGPDAFRLESIYQFPSCCLGFHRLAILDAQHGMQPMRVPQYPHVWLIYNGEIYNHANLQQEFNFHYATKCDGESIIHLYAQGGIEFAAKHLDGVFAFCLLDTANRKVYLGRDTFGVKPLFRILKEDGFLSACSEVKALKIIVILGLGDNPTATVEQFLPGHVETYNLDSIGRATFVERTRFHKIGDAPAY-KTVVNPTDKNIKSSIRTLFEAAVKKRMMADRRIGCLLSGGLDSSLTAATLVKLAKEQNL---PYPVQTFSIGM-KDSPDLVAARKVAKHLKTEHHEIVFKPEEGIAAIESVIYHLESYDITTVRSSVGLYLLSKYIKQKTDTTVILSGEGSDEIAQGYIYFHKAPSVEDGNEESSRLCKDLYMYDVLRSDRSTSAWGLEIRVPFLDHQFSSYYISLEPEMKAPKYGIEKYLLRSA 447          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: J3SE12 (Asparagine synthetase (Glutamine-hydrolyzing)-like protein OS=Crotalus adamanteus OX=8729 PE=2 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.083e-112
Identity = 195/456 (42.76%), Postives = 290/456 (63.60%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMA--LSSKCEIEIVLPGN--IVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +     C      +  K+ HRGPD++R E +      C GFHRL+I+     MQPL   KFP+L +  NGEIYN++ L+  F F+     D E IL+LY+K G +  AS LDG+FA IL+D  ++K FL RD  G+RPL+ +      + V SEAKGL+ +   +SS  ++E  LPG+  ++++ LS K A V E+  ++   +  LH+ +   +        E +  NIR + ++AV+KRL S RRIGCLLSGGLDSS+VA ++ ++ KE +L   S  L+TFS+GM ED  D L A  VA H+ + H + +F+ ++ I+ L  +I+SLE++D ++IRAS+G+Y + K++++ ++ VV+ +GEGSDELT GY +FH+   +E++  E  RLLR L+ FD+ R+D   +   +E RVPFLDHQF AYY SL  +L+ PK G+EK LLR++
Sbjct:    1 MCGIWALFGSDGCLSAQCLSAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQPLRVKKFPYLWLCYNGEIYNFRRLQKQFGFEYQTLVDGEVILHLYDKGGIEETASMLDGVFAFILLDSANRKVFLGRDTYGVRPLFRVLTDDGFLGVCSEAKGLINLKHNMSSALKVEPFLPGHYEVLDLKLSGKVASV-EVVKFHSPREEPLHAAYSTIQNLPSGVDVETVKSNIRLLFENAVRKRLMSHRRIGCLLSGGLDSSLVAAILIKLIKEQNL---SYPLQTFSIGM-EDSPDLLAARKVAAHIGSEHHEVMFSSQEGIQSLEEVIFSLETYDITTIRASVGMYLVSKYIRKKTDSVVIFSGEGSDELTQGYIYFHKAPTAEEAAEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHQFTAYYLSLPVELRIPKNGIEKHLLREA 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 347.821 bits (891), Expect = 8.601e-114
Identity = 183/456 (40.13%), Postives = 281/456 (61.62%), Query Frame = 1
Query:   49 KMCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEM--ALSSKCEIEIVLPGNIVEINLSHKG-AKVKEINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            KMCGIW +    +C      N  K+ HRGPD++R E +      C GFHRL+I+     MQPL   KFP+L +  NGEIYN++LL++ F+F      D E +L+LY+++G + M+S LDG+FA IL+D  ++K FL RD  G+RP++ L      + V SEAKGL ++  ++S   +I    PG+  E NL   G  +  ++  ++   +   H+++  +E+       E +  NIR + ++AV+KRL + RRIGCLLSGGLDSS+VA  + ++ KE  L      ++TF++G +ED  D   A  VA H+ + H +  F  E+ IK +  +I  LES+D +++RAS+G+Y + K+++E ++ VV+ +GEGSDELT GY +FH+    +    +  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F AYY SL  +++ PK GVEK LLR++
Sbjct:   29 KMCGIWALFGSDECLAIQCTNAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLHGMQPLRVKKFPYLWLCYNGEIYNHELLKEQFEFDYQTRMDGEILLHLYDRFGIEKMSSLLDGVFAFILLDTANRKIFLGRDTYGVRPMFKLLTDDGFLAVCSEAKGLTQITHSMSEPVKIMPFPPGHFEEFNLKLNGKVESVQLERFHCCTEEPKHAEYDDAEQLGKGFALETVKSNIRILFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLVKLSKEQEL---QYPIQTFAIG-AEDSPDIAAARKVAAHIGSEHHEVNFTPEEAIKAVEEVIVHLESYDITTVRASVGMYLISKYIREKTDSVVIFSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLKELYMFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREA 480          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 347.436 bits (890), Expect = 1.000e-113
Identity = 183/456 (40.13%), Postives = 281/456 (61.62%), Query Frame = 1
Query:   49 KMCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEM--ALSSKCEIEIVLPGNIVEINLSHKG-AKVKEINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            KMCGIW +    +C      N  K+ HRGPD++R E +      C GFHRL+I+     MQPL   KFP+L +  NGEIYN++LL++ F+F      D E +L+LY+++G + M+S LDG+FA IL+D  ++K FL RD  G+RP++ L      + V SEAKGL ++  ++S   +I    PG+  E NL   G  +  ++  ++   +   H+++  +E+       E +  NIR + ++AV+KRL + RRIGCLLSGGLDSS+VA  + ++ KE  L      ++TF++G +ED  D   A  VA H+ + H +  F  E+ IK +  +I  LES+D +++RAS+G+Y + K+++E ++ VV+ +GEGSDELT GY +FH+    +    +  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F AYY SL  +++ PK GVEK LLR++
Sbjct:   29 KMCGIWALFGSDECLAIQCTNAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLHGMQPLRVKKFPYLWLCYNGEIYNHELLKEQFEFDYQTRMDGEILLHLYDRFGIEKMSSLLDGVFAFILLDTANRKIFLGRDTYGVRPMFKLLTDDGFLAVCSEAKGLTQITHSMSEPVKIMPFPPGHFEEFNLKLNGKVESVQLERFHCCTEEPKHAEYDDAEQLGKGFALETVKSNIRILFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLVKLSKEQEL---QYPIQTFAIG-AEDSPDIAAARKVAAHIGSEHHEVNFTPEEAIKAVEEVIVHLESYDITTVRASVGMYLVSKYIREKTDSVVIFSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLKELYMFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREA 480          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 346.28 bits (887), Expect = 1.139e-113
Identity = 182/455 (40.00%), Postives = 280/455 (61.54%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEM--ALSSKCEIEIVLPGNIVEINLSHKG-AKVKEINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +    +C      N  K+ HRGPD++R E +      C GFHRL+I+     MQPL   KFP+L +  NGEIYN++LL++ F+F      D E +L+LY+++G + M+S LDG+FA IL+D  ++K FL RD  G+RP++ L      + V SEAKGL ++  ++S   +I    PG+  E NL   G  +  ++  ++   +   H+++  +E+       E +  NIR + ++AV+KRL + RRIGCLLSGGLDSS+VA  + ++ KE  L      ++TF++G +ED  D   A  VA H+ + H +  F  E+ IK +  +I  LES+D +++RAS+G+Y + K+++E ++ VV+ +GEGSDELT GY +FH+    +    +  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F AYY SL  +++ PK GVEK LLR++
Sbjct:    1 MCGIWALFGSDECLAIQCTNAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLHGMQPLRVKKFPYLWLCYNGEIYNHELLKEQFEFDYQTRMDGEILLHLYDRFGIEKMSSLLDGVFAFILLDTANRKIFLGRDTYGVRPMFKLLTDDGFLAVCSEAKGLTQITHSMSEPVKIMPFPPGHFEEFNLKLNGKVESVQLERFHCCTEEPKHAEYDDAEQLGKGFALETVKSNIRILFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLVKLSKEQEL---QYPIQTFAIG-AEDSPDIAAARKVAAHIGSEHHEVNFTPEEAIKAVEEVIVHLESYDITTVRASVGMYLISKYIREKTDSVVIFSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLKELYMFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREA 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 346.28 bits (887), Expect = 1.429e-113
Identity = 182/455 (40.00%), Postives = 280/455 (61.54%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEM--ALSSKCEIEIVLPGNIVEINLSHKG-AKVKEINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +    +C      N  K+ HRGPD++R E +      C GFHRL+I+     MQPL   KFP+L +  NGEIYN++LL++ F+F      D E +L+LY+++G + M+S LDG+FA IL+D  ++K FL RD  G+RP++ L      + V SEAKGL ++  ++S   +I    PG+  E NL   G  +  ++  ++   +   H+++  +E+       E +  NIR + ++AV+KRL + RRIGCLLSGGLDSS+VA  + ++ KE  L      ++TF++G +ED  D   A  VA H+ + H +  F  E+ IK +  +I  LES+D +++RAS+G+Y + K+++E ++ VV+ +GEGSDELT GY +FH+    +    +  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F AYY SL  +++ PK GVEK LLR++
Sbjct:    1 MCGIWALFGSDECLAIQCTNAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLHGMQPLRVKKFPYLWLCYNGEIYNHELLKEQFEFDYQTRMDGEILLHLYDRFGIEKMSSLLDGVFAFILLDTANRKIFLGRDTYGVRPMFKLLTDDGFLAVCSEAKGLTQITHSMSEPVKIMPFPPGHFEEFNLKLNGKVESVQLERFHCCTEEPKHAEYDDAEQLGKGFALETVKSNIRILFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLVKLSKEQEL---QYPIQTFAIG-AEDSPDIAAARKVAAHIGSEHHEVNFTPEEAIKAVEEVIVHLESYDITTVRASVGMYLVSKYIREKTDSVVIFSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLKELYMFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREA 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 346.28 bits (887), Expect = 1.429e-113
Identity = 182/455 (40.00%), Postives = 280/455 (61.54%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEM--ALSSKCEIEIVLPGNIVEINLSHKG-AKVKEINSYYVLGQNLLHSKFYQSEK------TENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +    +C      N  K+ HRGPD++R E +      C GFHRL+I+     MQPL   KFP+L +  NGEIYN++LL++ F+F      D E +L+LY+++G + M+S LDG+FA IL+D  ++K FL RD  G+RP++ L      + V SEAKGL ++  ++S   +I    PG+  E NL   G  +  ++  ++   +   H+++  +E+       E +  NIR + ++AV+KRL + RRIGCLLSGGLDSS+VA  + ++ KE  L      ++TF++G +ED  D   A  VA H+ + H +  F  E+ IK +  +I  LES+D +++RAS+G+Y + K+++E ++ VV+ +GEGSDELT GY +FH+    +    +  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F AYY SL  +++ PK GVEK LLR++
Sbjct:    1 MCGIWALFGSDECLAIQCTNAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLHGMQPLRVKKFPYLWLCYNGEIYNHELLKEQFEFDYQTRMDGEILLHLYDRFGIEKMSSLLDGVFAFILLDTANRKIFLGRDTYGVRPMFKLLTDDGFLAVCSEAKGLTQITHSMSEPVKIMPFPPGHFEEFNLKLNGKVESVQLERFHCCTEEPKHAEYDDAEQLGKGFALETVKSNIRILFENAVRKRLMAHRRIGCLLSGGLDSSLVAATLVKLSKEQEL---QYPIQTFAIG-AEDSPDIAAARKVAAHIGSEHHEVNFTPEEAIKAVEEVIVHLESYDITTVRASVGMYLVSKYIREKTDSVVIFSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLKELYMFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREA 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Yeast
Match: ASN1 (Asparagine synthetase; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway; ASN1 has a paralog, ASN2, that arose from the whole genome duplication [Source:SGD;Acc:S000006349])

HSP 1 Score: 187.578 bits (475), Expect = 9.321e-54
Identity = 149/486 (30.66%), Postives = 238/486 (48.97%), Query Frame = 1
Query:   52 MCGIWG------VLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFH-RLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNY-KLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGN--CIMVSSEAKGLMEMALSSKCE-IEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFS------VGMSEDG--------------------IDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDS--KLKQPKFG-VEKWLLRKS 1389
            MCGI+       V  Y+   L+L K   +++HRGPD         +  S I  H RL+I+G     QP+      ++ +  NGEIYN+ +L E+  D++    SD E I+ +Y K+        LDGMFA  L D    +    RD +GI  LY  R   +   +  +SE K      L+  C+ I    PG++ +       +K  +I  Y+    + L  K   S   +  +  IR  L+ AV+KRL ++   G LLSGGLDSS++A +     +E++   N  +  T+        G+ +DG                     D   A  VAK + +IH +  F  ++ +  L ++IY LE++D ++IRAS  ++ L + +K      ++L+GEGSDE+  GY +F Q   + +   E  + ++NLH  D  R++     W +E RVPFLD +FL    ++D   K+ +PK G +EK++LRK+
Sbjct:    1 MCGIFAAFRHEDVHRYKPKALQLSK---RIRHRGPDWSG----NAIKNSTIFVHERLAIVGVESGAQPITSSDGEYM-LCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDID-APKYLDGMFAWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELK-----CLTDDCDTITAFPPGHVYD-------SKTDKITRYFT--PDWLDEKRIPSTPID--YMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDSSLIASIAA---RETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG-VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 457          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Yeast
Match: ASN2 (Asparagine synthetase; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway; ASN2 has a paralog, ASN1, that arose from the whole genome duplication [Source:SGD;Acc:S000003356])

HSP 1 Score: 184.496 bits (467), Expect = 1.097e-52
Identity = 147/481 (30.56%), Postives = 237/481 (49.27%), Query Frame = 1
Query:   52 MCGIWGVL------NYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFH-RLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNY-KLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSH-KGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQ-----------------------QLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDS--KLKQPKFG-VEKWLLRKS 1389
            MCGI+         N++   L+L K   K++HRGPD      +     S I  H RL+I+G +   QP+      ++  V NGEIYN+ +L E   D+K    SD E I+ LY ++        LDGMFA  L D    +    RD +G+  LY  R        SS++   +  A   KC  ++    +I+     H   ++  +I  Y+    + L  K   S   +  +H IR  L+ AV+KRL ++   G LLSGGLDSS++A +     ++++   N                         +L +F++G+  +  D   A  VAK + +IH +  F  ++ +  L ++IY LE++D ++IRAS  ++ L + +K      ++L+GEGSDE+  GY +F Q   + +   E  + ++NLH  D  R++     W +E RVPFLD  FL    ++D   K+ +PK G +EK++LRK+
Sbjct:    1 MCGIFAAFKHEDIHNFKPKALQLSK---KIRHRGPDWSGNAVM----NSTIFVHERLAIVGLDSGAQPITSADGEYMLGV-NGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDID-APKYLDGMFAFCLYDSKKDRIVAARDPIGVVTLYMGR--------SSQSPETVYFASELKCLTDVC--DSIISFPPGHVYDSETDKITRYFT--PDWLDEKRIPSTPVD--YHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDSSLIAAIAARETEKANADANEDNNVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLP-NAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG-VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 456          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Yeast
Match: YML096W_mRNA (Putative protein with similarity to asparagine synthetases; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; YML096W is not an essential gene and partially overlaps the verified gene RAD10 [Source:SGD;Acc:S000004562])

HSP 1 Score: 86.2705 bits (212), Expect = 1.355e-18
Identity = 107/412 (25.97%), Postives = 176/412 (42.72%), Query Frame = 1
Query:  274 NGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVE-------INLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQS-------DRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSE--------DGIDPLFANMVAKHLNTIHKQCVFN-------FEDVIKELP---NIIYSLESFDASSIR-----ASIGLYFLCKFVKENS----ECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRK 1386
            NGE+YN ++ +   D  S + + +  +  L E  G   +  SL+G +A  + D++S K +  RD +G R L +   P N + V+S           S    +  + G I E       +N + +     E+ S   L    L      SE ++N++     +L+D+VKKR++S       +  I  L SGG+D S++  LICE+ +E+        +E  +V            D  D   +   AK L  ++             +++ +K  P   N++Y  ++    SI      AS G  FL     E +      +VL +G G+DEL  GY  F      E  + E +R + N++  ++ R D  I+   +E R PFLD     Y   L +      F V K +LRK
Sbjct:   94 NGELYNKEISQG--DNDSLYIASM--LQNLKEGMGVIDVIKSLEGEYAYTIYDVNSSKLYFGRDPIGRRSLSYSVTPDNELYVAS--------VTGSAGSFQDCIGGVIYEYDTRTKLLNSNQRSHLPYEVTSEIDLNFTSL------SEVSKNLY----AVLRDSVKKRVESIHPRHIENSPIAVLFSGGIDCSVIVALICEVLQENDYKCGKPVIELLNVSFENPRTGLFPSDTPDRKLSINSAKTLQNLYPNVDIKLVEVDVPYDEYLKWKPFVINLMYPKQTEMDLSIAIAFFFASRGRGFLTSLNGERTPYQRHGIVLFSGLGADELYGGYHKFANKPPHELVE-ELTRQINNIYDRNLNRDDKVIAHNGVEVRYPFLDE----YVIKLSTAEIPINFKVNKLILRK 478          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Nematostella
Match: EDO43756 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:A7RXD3])

HSP 1 Score: 325.865 bits (834), Expect = 3.072e-106
Identity = 183/458 (39.96%), Postives = 266/458 (58.08%), Query Frame = 1
Query:   52 MCGIW---GVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLR---YPGNCIMVSSEAKGLMEMALS-----SKCEIEIVLPGNIVEINLSHKG-AKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW   G+ +Y K T   +     +K RGPD +R+E IP     C+ FHRL+++ D   MQP+   K PHL ++ NGEIYN+K +E+ F F      D E IL+LY+K+GA+  A  LDG+FA  ++D   K+  L RD  GIRP++ L+        + + SEAK L E+  +      K ++E   PG+    +L   G   + E   Y  +G+  +           +   NIR  +  AVKKRL +DRRIGC LSGGLDSS+VA L+ +  K + +      ++TFS+GM E   D   A  VA H+ + H +  F  E+ I+ L ++IY+LES+D ++IRAS+ +Y + K+V EN++ VV+ +GEGSDEL  GY +FH+    E+   E  RLL++L+ +D+ R D   +   +E RVPFLD  F +Y+ SL    +QPK GVEKWLLR +
Sbjct:    1 MCGIWAIFGIHDYHKYTTSSMA----IKGRGPDCFRMETIPHFSNCCLAFHRLAVVDDLYGMQPMRIKKLPHLFLIYNGEIYNHKQVEEKFGFDVFTQCDGEVILHLYDKFGAEKAAQMLDGVFAFCIIDTKKKQVHLGRDTFGIRPMFTLKQEDTKPTVLAICSEAKSLTEIEKTFTGNGHKMQLETFPPGHYHSYSLGANGQVALLESGPYTYIGKPPVFDT--GVVPVRDTMENIRLYMTQAVKKRLMADRRIGCFLSGGLDSSLVAALLTKEAKNAGI---DYPIQTFSIGM-EGSPDVAAARKVAAHIGSEHHEVTFTPEEGIQALHDVIYALESYDITTIRASVPMYLVAKYVSENTDTVVVYSGEGSDELCQGYIYFHKAPSPEEGDKESLRLLKDLYLYDVLRGDRSTAVHGLEIRVPFLDVAFTSYFLSLPPAERQPKEGVEKWLLRAA 448          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Nematostella
Match: EDO25657 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVV2])

HSP 1 Score: 185.652 bits (470), Expect = 4.149e-54
Identity = 140/444 (31.53%), Postives = 221/444 (49.77%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAF--ASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFY------QSEKTENI-FHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPK 1356
            MCGI  ++   K    + +  +++ HRGPD   +  + E  G  +   RLSI+  +   QP+         MV NGEIYN+  L +      AF   SD E I++LYE++G       LDGMFA ++VD         RD +GI+PLY+          +SE K     +++ +C+     P                    YY      +  K+Y      QS+  E + +  IR  L ++V+KRL +D   G LLSGGLDSS+ + +   +     LG +S+ L +FS+G+ E+  D + A  VA+ L T H +  F+ E+ IK +  +I+ LE++D +SIRAS  ++F+ K + +     ++L+GEG+DE+  GY +F     ++  Q E    ++ L   D+ R+D       +E RVPFLD +FL     +  + KQPK
Sbjct:    1 MCGILAIIGKGKEEALVQQLSKRMSHRGPDESDI-HVTEC-GHILSHERLSIVDLHTGKQPIQGTSTA--WMVHNGEIYNHIALRETVLKHHAFRTTSDSEVIVHLYEEFGYDF-CHYLDGMFAFVVVD--GDDFIAGRDPLGIKPLYYGIDERGRYYFASEMK-----SIADQCKTFSTFPP-----------------GHYYTTKTGFV--KYYKPEWEEQSKAVEELDYAAIRTTLTESVRKRLMADVPFGVLLSGGLDSSLTSSIAKRL-----LG-DSKTLHSFSIGLDENAPDLVAARKVAEVLGTEHHEVYFSVEEGIKNIEKLIWHLETYDVTSIRASTPMFFMSKKITDLG-IKMVLSGEGADEIFGGYLYFRNAPSADDFQKETIERVQKLFTADLLRADKSTMAHGLEARVPFLDKEFLELAMKIKPEEKQPK 406          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Nematostella
Match: EDO28991 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:A7T4X2])

HSP 1 Score: 100.138 bits (248), Expect = 1.066e-22
Identity = 110/403 (27.30%), Postives = 185/403 (45.91%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLK---LVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQN-MQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAF--ASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLP--GNIVEINLSHKGAKVKEINS-----YYVLGQNLLHSKFYQSEKT---------------ENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGM----SEDGIDPLFANMVAKHLNTIHKQCVFNFED--VIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGY 1158
            MCGI G  N  K ++K   L    +   HRGPDS        +    +  +RLS+I  + N +QP    ++    +V NGEIYN+  L+     K A+  +SD E + Y  + +G +     + GMFA    +I+S +  L+RD +GI+PL++     +C+  +SE K + ++       I++++   G I E   S K    K++ +     + V+    L+ K Y +  +               E++      I  D+VK+ L SD  +G  +SGG+DSS++A         S   +++  L+ F+  +    SE       +N++ K L   H    +NFE    I++L  + +  ES       A +    + K   E  +   +LTGEG+DEL  GY
Sbjct:    1 MCGISGFYNLNKSSIKKEFLSDMIDVQNHRGPDSNNFYYNNHI---GLAHNRLSLIDLSDNAIQPFYTDEY---VLVYNGEIYNFLELKKELP-KVAYESSSDTEVLFYCLQFWGIEKTLEKIQGMFAFAWYNINSDELILVRDRIGIKPLFYGVDSNSCLWFASEVKTIQKVTNFKPDPIQMLMSPIGGIAE--KSRKKTLWKDLFTLTPGCFIVVKGGKLYKKEYFNTTSLVNEKEYMRLSGLSLEDVTVEFGSIFNDSVKRLLISDAPMGAFVSGGIDSSLIA---------SYASKHNSNLKLFTANVVGRYSEFNNATELSNVLGKKL--YH----YNFEKEMAIRDLVKVTWHYESPLVVHFNA-LPFSNISKIASE-QKVKAVLTGEGADELFLGY 377          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Medaka
Match: asns (asparagine synthetase (glutamine-hydrolyzing) [Source:NCBI gene;Acc:101158956])

HSP 1 Score: 345.51 bits (885), Expect = 3.052e-113
Identity = 191/457 (41.79%), Postives = 279/457 (61.05%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMA--LSSKCEIEIVLPGNIVEINLSHKGAKVK--EINSYYVLGQNLLHSKFYQSEKT-------ENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW +    +C         K+ HRGPD++R E +      C GFHRL+I+     MQPL   KFP+L +  NGEIYN+  L+  FDF      D E +L+LY+++G K MAS LDG+FA IL+D  ++K  L RD  G+RPL+ L      + V SEAKGL  ++  +S +  IE  LPG+I   +L   G KV+  ++  ++   Q   H+  Y   +T       E +  NIR +L++AV+KRL + RRIGCLLSGGLDSS++A L+ ++ KE  L     +++TFS+G SED  D L A  VA H+ + H +  F  E+ I+ +  +I+ LE++D ++IRAS+G++ + K ++E ++ VV+ +GEGSDELT GY +FH+   +  +  +  RLL+ L+ FD+ R+D   +   +E RVPFLDH+F AYY SL   ++ PK GVEK LLR S
Sbjct:    1 MCGIWALFGSDECLSVQCTCAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQPLRIKKFPYLWLCYNGEIYNHHTLQKTFDFDFQTKVDGEVLLHLYDRFGIKKMASLLDGVFAFILLDTANRKVHLGRDTYGVRPLFKLLTDDGFLAVCSEAKGLTNISHSMSEEVSIEPFLPGHIEVFDLKLSG-KVQSLQMEPFHCCTQEPTHA-LYDPLQTLPAGLDEETVKSNIRSLLENAVRKRLMAHRRIGCLLSGGLDSSLIAALLVKLAKEEKL---PYKIQTFSIG-SEDSPDILAARKVAAHIGSEHHEVNFTAEEGIRAVEEVIFHLETYDITTIRASVGMFLVSKHIREKTDSVVIFSGEGSDELTQGYIYFHKAPSAAAAAKDSVRLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFTAYYLSLPENMRVPKDGVEKHLLRDS 451          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Planmine SMEST
Match: SMESG000051174.1 (SMESG000051174.1)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 441/446 (98.88%), Postives = 443/446 (99.33%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDN NMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECIL++YEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIF NIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIE SRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS
Sbjct:    1 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNTNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILHIYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSHKGAKVKEINSYYVLGQNLLHSKFYQSEKTENIFQNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIESSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 446          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Planmine SMEST
Match: SMESG000068121.1 (SMESG000068121.1)

HSP 1 Score: 420.239 bits (1079), Expect = 1.268e-142
Identity = 215/453 (47.46%), Postives = 300/453 (66.23%), Query Frame = 1
Query:   52 MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRLSIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVECILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRYPGNCIMVSSEAKGLMEMALS----SKCEIEIVLPGNIVEINLSHKGA---KVKEINSYYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKHLNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKENSECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS 1389
            MCGIW ++ Y   T+ L+  F+ +  RGPDSYR+E I      C+GFHRLSI+GD   MQP+   + PHL ++CNGEIYNYK L   F       SD+EC+++LYEK G   MA +LDG+F+  ++D   KK FLIRD  G+RP+ ++      + + SE KGL+++  +       +I I+ PG ++E +L   G      KE +S+  +G   +     + +  +NI+ NIR +L+ AV KRLQS+RRIGCLLSGGLDSS++AGL+ +  KE+ +     +L+TFS+GM +DG+D L A  V+K L T H +  F+ ED IK LP++IY LE+FD ++IRASIG+Y L KF++ N++ +V+ +GEGSDELT GY +FH+  + E    EC RLL +L YFDIRR+D  IS   +E RVPFLD +F +YY SLD KL+QPK G+EKWLLRKS
Sbjct:    1 MCGIWAIIGYEGNTMSLMHYFQTIADRGPDSYRIENINHYKDCCLGFHRLSIVGDIDGMQPIRIKEEPHLSLICNGEIYNYKSLVSEFSLDVTTHSDIECMIHLYEKLGPVGMAQNLDGVFSCFILDTLKKKVFLIRDRHGVRPMKYILAEKGFLGICSEIKGLIDIIPNILHEEGIQINILKPGCVLEFDLYDNGTVNTSFKE-HSFAKIGNQPIFKSLVEPDPNKNIYENIRGLLEAAVTKRLQSERRIGCLLSGGLDSSLIAGLLVKTMKEAKI---DYKLQTFSIGMGDDGVDILAARKVSKFLGTEHFEVNFSLEDSIKLLPDLIYRLETFDITTIRASIGMYLLAKFIQTNTDNIVIFSGEGSDELTGGYIYFHKAPNPEAFHEECMRLLNDLCYFDIRRADRTISGCGLEPRVPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKS 449          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Planmine SMEST
Match: SMESG000078345.1 (SMESG000078345.1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.694e-8
Identity = 59/218 (27.06%), Postives = 93/218 (42.66%), Query Frame = 1
Query:  778 RIGCLLSGGLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSE------DGIDPLFANMVAKHLNTIHKQCVFNF-----------EDVIKELPNIIYSLESFDASSIRASIGLYFLCK---FVKENSE-----CVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIR---RSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLK 1347
            ++  L SGGLDS+++A L+ +    +      + ++ F+V  S       D  D L   +    L +I+    +NF           E   + +  +I    S    SI  +  L+F  +   F+    E       V+LTG G+DEL  GY     + D +  +I    L + LH    R   R D  IS    EGR PFLD + +++  SL  +LK
Sbjct:  272 KVAILFSGGLDSAVIAVLVDKFLPIN------ESIDLFNVSFSTETKLECDSPDRLSGLICLNELKSINPDRRWNFVKINISPSELKEQRQQRIAKLIQPCHSVLDDSIGCA--LWFAARGEGFIDNEKEPYKSPARVVLTGIGADELMAGYSRHRSVFDRQGYEILQQELDKELHRISSRNMGRDDRVISSHGKEGRFPFLDEEVVSFLTSLPIQLK 481          
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Planmine SMEST
Match: SMESG000078345.1 (SMESG000078345.1)

HSP 1 Score: 51.2174 bits (121), Expect = 9.038e-7
Identity = 32/85 (37.65%), Postives = 43/85 (50.59%), Query Frame = 1
Query: 1102 SECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIR---RSDSCISKWQMEGRVPFLDHQFLAYYYSLDSKLK 1347
            S   V+LTG G+DEL  GY     + D +  +I    L + LH    R   R D  IS    EGR PFLD + +++  SL  +LK
Sbjct:  243 SPARVVLTGIGADELMAGYSRHRSVFDRQGYEILQQELDKELHRISSRNMGRDDRVISSHGKEGRFPFLDEEVVSFLTSLPIQLK 327          
The following BLAST results are available for this feature:
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASNS9.717e-10840.88asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
ASNS9.717e-10840.88asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
ASNS9.717e-10840.88asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
ASNS3.476e-10441.57asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
ASNS3.476e-10441.57asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
asns-15.704e-6233.11Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
asns-22.028e-4631.18Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
asns-22.556e-4631.18Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
asns-21.071e-1929.05Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AsnS2.736e-5232.04gene:FBgn0270926 transcript:FBtr0089463[more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asns1.234e-10639.87asparagine synthetase [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
asns1.272e-11140.00asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
asns1.869e-11040.00asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
asns3.807e-6538.46asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Asns9.902e-11240.66asparagine synthetase [Source:MGI Symbol;Acc:MGI:1... [more]
Asns9.902e-11240.66asparagine synthetase [Source:MGI Symbol;Acc:MGI:1... [more]
Asns2.805e-3937.10asparagine synthetase [Source:MGI Symbol;Acc:MGI:1... [more]
Asns3.134e-3442.47asparagine synthetase [Source:MGI Symbol;Acc:MGI:1... [more]
Asns1.083e-2640.94asparagine synthetase [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P19891|ASNS_CRIGR2.211e-11140.66Asparagine synthetase [glutamine-hydrolyzing] OS=C... [more]
sp|P49088|ASNS_RAT2.990e-11140.66Asparagine synthetase [glutamine-hydrolyzing] OS=R... [more]
sp|Q61024|ASNS_MOUSE6.927e-11140.66Asparagine synthetase [glutamine-hydrolyzing] OS=M... [more]
sp|Q5ZJU3|ASNS_CHICK1.294e-11040.44Asparagine synthetase [glutamine-hydrolyzing] OS=G... [more]
sp|P17714|ASNS_MESAU1.215e-10940.44Asparagine synthetase [glutamine-hydrolyzing] OS=M... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMF30.000e+0100.00Glutamine amidotransferase type-2 domain-containin... [more]
A0A5A9NKK81.829e-11441.67Asparagine synthetase [glutamine-hydrolyzing] OS=T... [more]
A0A1S3INM51.894e-11341.78asparagine synthetase [glutamine-hydrolyzing] OS=L... [more]
A0A210PVE53.055e-11340.93Asparagine synthetase [glutamine-hydrolyzing] OS=M... [more]
J3SE121.083e-11242.76Asparagine synthetase (Glutamine-hydrolyzing)-like... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asns8.601e-11440.13asparagine synthetase [glutamine-hydrolyzing]-like... [more]
asns1.000e-11340.13asparagine synthetase [glutamine-hydrolyzing]-like... [more]
asns1.139e-11340.00asparagine synthetase [glutamine-hydrolyzing]-like... [more]
asns1.429e-11340.00asparagine synthetase [glutamine-hydrolyzing]-like... [more]
asns1.429e-11340.00asparagine synthetase [glutamine-hydrolyzing]-like... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ASN19.321e-5430.66Asparagine synthetase; catalyzes the synthesis of ... [more]
ASN21.097e-5230.56Asparagine synthetase; catalyzes the synthesis of ... [more]
YML096W_mRNA1.355e-1825.97Putative protein with similarity to asparagine syn... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO437563.072e-10639.96Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
EDO256574.149e-5431.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO289911.066e-2227.30Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asns3.052e-11341.79asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
back to top
BLAST of Asparagine synthetase [glutamine-hydrolyzing] vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000051174.10.000e+098.88SMESG000051174.1[more]
SMESG000068121.11.268e-14247.46SMESG000068121.1[more]
SMESG000078345.11.694e-827.06SMESG000078345.1[more]
SMESG000078345.19.038e-737.65SMESG000078345.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007463 ID=SMED30007463|Name=Asparagine synthetase [glutamine-hydrolyzing]|organism=Schmidtea mediterranea sexual|type=transcript|length=1389bp
AAGATCGTTTTTAGTATTTCAATATAATAAGTACAGTTAATAATACCTAA
AATGTGCGGTATCTGGGGGGTGTTGAATTATAGAAAATGCACACTGAAAT
TAGTGAAGAACTTTGAAAAACTTAAACACCGAGGTCCGGATTCGTACAGA
TTAGAAAGGATACCCGAACTTCCGGGCTCCTGTATCGGATTTCACCGACT
ATCCATTATAGGAGATAACCAGAATATGCAACCATTAGTTCATCCAAAAT
TTCCTCATCTTCGAATGGTTTGTAATGGTGAGATTTACAACTATAAATTG
CTTGAGGATTATTTTGACTTCAAATCAGCCTTTGCTAGTGATGTGGAATG
CATCTTGTATCTCTATGAAAAATATGGGGCAAAATTAATGGCATCAAGCC
TTGATGGAATGTTTGCAATGATACTGGTTGATATACATTCAAAAAAAGCT
TTTTTAATAAGAGATGCAATGGGAATACGACCTCTGTATTTTCTTCGATA
TCCAGGAAATTGCATAATGGTTTCGTCAGAGGCCAAAGGATTAATGGAGA
TGGCTTTGAGTTCAAAATGTGAAATTGAAATTGTACTTCCTGGAAATATT
GTAGAAATAAACTTGTCACACAAAGGGGCAAAAGTTAAGGAAATTAATTC
ATATTATGTACTTGGACAAAATCTATTGCACTCAAAGTTCTATCAAAGTG
AGAAAACGGAAAATATTTTTCATAACATTCGCCAGATTTTAAAAGATGCT
GTTAAAAAGCGATTACAATCTGATAGAAGAATTGGATGTCTTTTATCTGG
TGGTCTTGATAGCAGCATTGTAGCAGGCTTGATTTGCGAAATTTACAAAG
AATCTTCACTTGGAGAAAATTCCCAACAATTAGAAACATTTTCAGTTGGA
ATGAGCGAAGATGGAATTGATCCACTATTCGCTAACATGGTCGCAAAGCA
TTTGAATACCATTCATAAACAATGCGTGTTCAATTTCGAGGATGTGATTA
AGGAGCTTCCAAATATTATATATAGTTTGGAGTCATTTGACGCCTCATCC
ATTCGAGCTTCAATTGGCCTATACTTTCTATGTAAATTTGTGAAGGAAAA
CAGTGAATGCGTCGTTTTATTAACCGGTGAAGGTTCCGATGAACTGACAT
TTGGATACGAACACTTTCATCAGATTAAAGATTCTGAAAAGTCTCAAATC
GAATGCAGTCGGCTTTTAAGAAATTTGCATTATTTTGACATTCGACGAAG
TGACAGTTGTATTTCAAAATGGCAAATGGAAGGCCGAGTTCCGTTCCTTG
ACCATCAATTTTTAGCTTATTATTATTCTCTCGATTCGAAATTGAAACAA
CCAAAATTTGGAGTGGAAAAATGGTTGCTTCGAAAATCA
back to top

protein sequence of SMED30007463-orf-1

>SMED30007463-orf-1 ID=SMED30007463-orf-1|Name=SMED30007463-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=446bp
MCGIWGVLNYRKCTLKLVKNFEKLKHRGPDSYRLERIPELPGSCIGFHRL
SIIGDNQNMQPLVHPKFPHLRMVCNGEIYNYKLLEDYFDFKSAFASDVEC
ILYLYEKYGAKLMASSLDGMFAMILVDIHSKKAFLIRDAMGIRPLYFLRY
PGNCIMVSSEAKGLMEMALSSKCEIEIVLPGNIVEINLSHKGAKVKEINS
YYVLGQNLLHSKFYQSEKTENIFHNIRQILKDAVKKRLQSDRRIGCLLSG
GLDSSIVAGLICEIYKESSLGENSQQLETFSVGMSEDGIDPLFANMVAKH
LNTIHKQCVFNFEDVIKELPNIIYSLESFDASSIRASIGLYFLCKFVKEN
SECVVLLTGEGSDELTFGYEHFHQIKDSEKSQIECSRLLRNLHYFDIRRS
DSCISKWQMEGRVPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR006426Asn_synth_AEB
IPR033738AsnB_N
IPR029055Ntn_hydrolases_N
IPR001962Asn_synthase
IPR014729Rossmann-like_a/b/a_fold
IPR017932GATase_2_dom
Vocabulary: molecular function
TermDefinition
GO:0004066asparagine synthase (glutamine-hydrolyzing) activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016874ligase activity
Vocabulary: biological process
TermDefinition
GO:0006529asparagine biosynthetic process
GO:0006541glutamine metabolic process
GO:0008652cellular amino acid biosynthetic process
GO:0042149cellular response to glucose starvation
GO:0043066negative regulation of apoptotic process
GO:0045931positive regulation of mitotic cell cycle
GO:0070981L-asparagine biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017932Glutamine amidotransferase type 2 domainPFAMPF13537GATase_7coord: 49..165
e-value: 6.8E-25
score: 87.4
IPR017932Glutamine amidotransferase type 2 domainPROSITEPS51278GATASE_TYPE_2coord: 2..189
score: 26.17
IPR006426Asparagine synthase, glutamine-hydrolyzingPIRSFPIRSF001589Asn_synthetase_glu-hcoord: 386..446
e-value: 3.5E-7
score: 26.7
coord: 1..394
e-value: 2.4E-69
score: 232.0
IPR006426Asparagine synthase, glutamine-hydrolyzingTIGRFAMTIGR01536TIGR01536coord: 2..382
e-value: 3.6E-85
score: 284.8
IPR001962Asparagine synthasePFAMPF00733Asn_synthasecoord: 226..379
e-value: 2.1E-38
score: 132.9
coord: 380..445
e-value: 1.2E-11
score: 44.9
IPR001962Asparagine synthaseCDDcd01991Asn_Synthase_B_Ccoord: 227..445
e-value: 8.24204E-47
score: 160.663
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 210..446
e-value: 6.7E-62
score: 211.8
IPR029055Nucleophile aminohydrolases, N-terminalGENE3DG3DSA:3.60.20.10coord: 3..190
e-value: 3.5E-38
score: 132.5
IPR029055Nucleophile aminohydrolases, N-terminalSUPERFAMILYSSF56235N-terminal nucleophile aminohydrolases (Ntn hydrolases)coord: 1..189
NoneNo IPR availablePANTHERPTHR11772ASPARAGINE SYNTHETASEcoord: 1..446
NoneNo IPR availablePANTHERPTHR11772:SF23ASPARAGINE SYNTHETASE [GLUTAMINE-HYDROLYZING]coord: 1..446
NoneNo IPR availableSUPERFAMILYSSF52402Adenine nucleotide alpha hydrolases-likecoord: 221..445
IPR033738Asparagine synthase, N-terminal domainCDDcd00712AsnBcoord: 2..167
e-value: 1.52991E-45
score: 155.793