cAMP-dependent protein kinase catalytic subunit

Overview
NamecAMP-dependent protein kinase catalytic subunit
Smed IDSMED30007454
Uniprot Best hitcAMP-dependent protein kinase catalytic subunit 1 OS=Drosophila melanogaster OX=7227 GN=Pka-C1 PE=1 SV=3 (E=2.83232e-166)
Length (bp)1036
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP-dependent protein kinase catalytic subunit (SMED30007454) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP-dependent protein kinase catalytic subunit (SMED30007454) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007454

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30007454SMESG000048623.1 SMESG000043218.1 dd_Smed_v4_8371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30007454SMESG000048623.1 SMESG000043218.1 dd_Smed_v6_8371_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007454SMESG000048623.1 SMESG000043218.1 dd_Smed_v4_8371_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007454SMESG000048623.1 SMESG000043218.1 dd_Smed_v4_8371_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the epidermisSMED30007454SMESG000048623.1 SMESG000043218.1 dd_Smed_v4_8371_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30007454SMESG000048623.1 SMESG000043218.1 dd_Smed_v4_8371_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30007454SMESG000048623.1 SMESG000043218.1 dd_Smed_v4_8371_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30007454SMESG000048623.1 SMESG000043218.1 dd_Smed_v4_8371_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Human
Match: PRKACA (protein kinase cAMP-activated catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9380])

HSP 1 Score: 464.922 bits (1195), Expect = 6.920e-165
Identity = 212/312 (67.95%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN A LD F R+KTLGTGS+GRV+LV+HK+   +YAMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLVKL + FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP DT NF+DYEE+ ++++   K  KE
Sbjct:   28 QNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKE 339          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Human
Match: PRKACA (protein kinase cAMP-activated catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9380])

HSP 1 Score: 464.922 bits (1195), Expect = 6.920e-165
Identity = 212/312 (67.95%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN A LD F R+KTLGTGS+GRV+LV+HK+   +YAMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLVKL + FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP DT NF+DYEE+ ++++   K  KE
Sbjct:   28 QNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKE 339          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Human
Match: PRKACA (protein kinase cAMP-activated catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9380])

HSP 1 Score: 465.307 bits (1196), Expect = 7.230e-165
Identity = 212/312 (67.95%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN A LD F R+KTLGTGS+GRV+LV+HK+   +YAMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLVKL + FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP DT NF+DYEE+ ++++   K  KE
Sbjct:   36 QNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Human
Match: PRKACA (protein kinase cAMP-activated catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9380])

HSP 1 Score: 465.307 bits (1196), Expect = 7.230e-165
Identity = 212/312 (67.95%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN A LD F R+KTLGTGS+GRV+LV+HK+   +YAMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLVKL + FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP DT NF+DYEE+ ++++   K  KE
Sbjct:   36 QNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Human
Match: PRKACB (protein kinase cAMP-activated catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9381])

HSP 1 Score: 464.922 bits (1195), Expect = 7.529e-165
Identity = 213/319 (66.77%), Postives = 263/319 (82.45%), Query Frame = 2
Query:   32 QACLLGNQNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            +A L+ +QN A L+DF R KTLGTGS+GRV+LV+HK  + YYAMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGV+DIK HKWF + +W A+++++   PF PK  G  DT NF+DYEE+ ++++ T K  KE
Sbjct:   16 EARLISSQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKE 334          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Celegans
Match: kin-1 (cAMP-dependent protein kinase catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:P21137])

HSP 1 Score: 472.241 bits (1214), Expect = 7.175e-168
Identity = 216/312 (69.23%), Postives = 261/312 (83.65%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN ACLDDF R+KTLGTGS+GRV+LV+HK+   YYAMK+L+K  +VK+KQ+EHTLNEKRILQAI+FPFLV + + FKDNS LYMV+EFI GGEMF+HLRRIG+F E H +FYA+Q+VLA EYLH LD+IYRDLKPEN+LID TGY+KITD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+++LKDLL++LLQVDLTKR GNLKNGV DIKNHKWF S +W A+++K+   PF PK  GP D  NF+DYEE+ L+I+ T K  KE
Sbjct:   44 QNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEEPLRISGTEKCAKE 355          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Celegans
Match: kin-1 (cAMP-dependent protein kinase catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:P21137])

HSP 1 Score: 471.47 bits (1212), Expect = 8.783e-168
Identity = 216/312 (69.23%), Postives = 261/312 (83.65%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN ACLDDF R+KTLGTGS+GRV+LV+HK+   YYAMK+L+K  +VK+KQ+EHTLNEKRILQAI+FPFLV + + FKDNS LYMV+EFI GGEMF+HLRRIG+F E H +FYA+Q+VLA EYLH LD+IYRDLKPEN+LID TGY+KITD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+++LKDLL++LLQVDLTKR GNLKNGV DIKNHKWF S +W A+++K+   PF PK  GP D  NF+DYEE+ L+I+ T K  KE
Sbjct:   34 QNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEEPLRISGTEKCAKE 345          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Celegans
Match: kin-1 (cAMP-dependent protein kinase catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:P21137])

HSP 1 Score: 471.085 bits (1211), Expect = 1.173e-167
Identity = 216/312 (69.23%), Postives = 261/312 (83.65%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN ACLDDF R+KTLGTGS+GRV+LV+HK+   YYAMK+L+K  +VK+KQ+EHTLNEKRILQAI+FPFLV + + FKDNS LYMV+EFI GGEMF+HLRRIG+F E H +FYA+Q+VLA EYLH LD+IYRDLKPEN+LID TGY+KITD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+++LKDLL++LLQVDLTKR GNLKNGV DIKNHKWF S +W A+++K+   PF PK  GP D  NF+DYEE+ L+I+ T K  KE
Sbjct:   28 QNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEEPLRISGTEKCAKE 339          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Celegans
Match: kin-1 (cAMP-dependent protein kinase catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:P21137])

HSP 1 Score: 471.47 bits (1212), Expect = 1.772e-167
Identity = 216/312 (69.23%), Postives = 261/312 (83.65%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN ACLDDF R+KTLGTGS+GRV+LV+HK+   YYAMK+L+K  +VK+KQ+EHTLNEKRILQAI+FPFLV + + FKDNS LYMV+EFI GGEMF+HLRRIG+F E H +FYA+Q+VLA EYLH LD+IYRDLKPEN+LID TGY+KITD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+++LKDLL++LLQVDLTKR GNLKNGV DIKNHKWF S +W A+++K+   PF PK  GP D  NF+DYEE+ L+I+ T K  KE
Sbjct:   55 QNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEEPLRISGTEKCAKE 366          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Celegans
Match: kin-1 (cAMP-dependent protein kinase catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:P21137])

HSP 1 Score: 472.241 bits (1214), Expect = 1.773e-167
Identity = 216/312 (69.23%), Postives = 261/312 (83.65%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN ACLDDF R+KTLGTGS+GRV+LV+HK+   YYAMK+L+K  +VK+KQ+EHTLNEKRILQAI+FPFLV + + FKDNS LYMV+EFI GGEMF+HLRRIG+F E H +FYA+Q+VLA EYLH LD+IYRDLKPEN+LID TGY+KITD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+++LKDLL++LLQVDLTKR GNLKNGV DIKNHKWF S +W A+++K+   PF PK  GP D  NF+DYEE+ L+I+ T K  KE
Sbjct:   73 QNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEEPLRISGTEKCAKE 384          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Fly
Match: Pka-C1 (gene:FBgn0000273 transcript:FBtr0335495)

HSP 1 Score: 470.7 bits (1210), Expect = 2.826e-167
Identity = 213/311 (68.49%), Postives = 260/311 (83.60%), Query Frame = 2
Query:   56 NVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            N A LDDF R+KTLGTGS+GRV++VQHK  + YYAMK+L+K  +VK+KQ+EHTLNEKRILQAI FPFLV L YHFKDNS LYMV+E++ GGEMF+HLR++G+F E H +FYA+Q+VLA EYLH+LD+IYRDLKPEN+LID  GY+K+TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVL+YEM+   PPF  +  I +YEKIV GKV  P++F SDLKDLLR+LLQVDLTKR GNLK GVNDIKN KWF S +W A+F+K+   PF P+  GP DT NF+DYEE++L+I++T K  KE
Sbjct:   39 NTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKE 349          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Fly
Match: Pka-C1 (gene:FBgn0000273 transcript:FBtr0079852)

HSP 1 Score: 470.7 bits (1210), Expect = 2.826e-167
Identity = 213/311 (68.49%), Postives = 260/311 (83.60%), Query Frame = 2
Query:   56 NVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            N A LDDF R+KTLGTGS+GRV++VQHK  + YYAMK+L+K  +VK+KQ+EHTLNEKRILQAI FPFLV L YHFKDNS LYMV+E++ GGEMF+HLR++G+F E H +FYA+Q+VLA EYLH+LD+IYRDLKPEN+LID  GY+K+TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVL+YEM+   PPF  +  I +YEKIV GKV  P++F SDLKDLLR+LLQVDLTKR GNLK GVNDIKN KWF S +W A+F+K+   PF P+  GP DT NF+DYEE++L+I++T K  KE
Sbjct:   39 NTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKE 349          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Fly
Match: Pka-C1 (gene:FBgn0000273 transcript:FBtr0079851)

HSP 1 Score: 470.7 bits (1210), Expect = 2.826e-167
Identity = 213/311 (68.49%), Postives = 260/311 (83.60%), Query Frame = 2
Query:   56 NVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            N A LDDF R+KTLGTGS+GRV++VQHK  + YYAMK+L+K  +VK+KQ+EHTLNEKRILQAI FPFLV L YHFKDNS LYMV+E++ GGEMF+HLR++G+F E H +FYA+Q+VLA EYLH+LD+IYRDLKPEN+LID  GY+K+TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVL+YEM+   PPF  +  I +YEKIV GKV  P++F SDLKDLLR+LLQVDLTKR GNLK GVNDIKN KWF S +W A+F+K+   PF P+  GP DT NF+DYEE++L+I++T K  KE
Sbjct:   39 NTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKE 349          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Fly
Match: Pka-C3 (gene:FBgn0000489 transcript:FBtr0075529)

HSP 1 Score: 329.331 bits (843), Expect = 1.354e-109
Identity = 151/302 (50.00%), Postives = 211/302 (69.87%), Query Frame = 2
Query:   68 LDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATV 973
            LDD+  +KT+GTG++GRV L + +  + Y AMK+L    ++++KQIEH  NE+ IL+ I  PF++ L +  KD+S LYM+ +++ GGE+FT+LR  GKF      FYA+++V ALEYLH L ++YRDLKPEN+LI+  G++KITD GFAK+++ +TWT CGTPEY+APE+I SKG++ AVDWW+LGVLIYEM    PPF  E    +YEKI+ GK+    +     KDL++ LL  D TKR+GN+KNG +D+K H+WF  +NWN V+ K+   P  P  +   DT NF+DY E+  K A  V
Sbjct:  188 LDDYQIIKTVGTGTFGRVCLCRDRISEKYCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKKLRDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEKILSGKIEWERHMDPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKKLKPPILPDVHHDGDTKNFDDYPEKDWKPAKAV 489          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Fly
Match: Pka-C3 (gene:FBgn0000489 transcript:FBtr0075528)

HSP 1 Score: 330.102 bits (845), Expect = 8.574e-109
Identity = 151/302 (50.00%), Postives = 211/302 (69.87%), Query Frame = 2
Query:   68 LDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATV 973
            LDD+  +KT+GTG++GRV L + +  + Y AMK+L    ++++KQIEH  NE+ IL+ I  PF++ L +  KD+S LYM+ +++ GGE+FT+LR  GKF      FYA+++V ALEYLH L ++YRDLKPEN+LI+  G++KITD GFAK+++ +TWT CGTPEY+APE+I SKG++ AVDWW+LGVLIYEM    PPF  E    +YEKI+ GK+    +     KDL++ LL  D TKR+GN+KNG +D+K H+WF  +NWN V+ K+   P  P  +   DT NF+DY E+  K A  V
Sbjct:  271 LDDYQIIKTVGTGTFGRVCLCRDRISEKYCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKKLRDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEKILSGKIEWERHMDPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKKLKPPILPDVHHDGDTKNFDDYPEKDWKPAKAV 572          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Zebrafish
Match: prkacbb (protein kinase, cAMP-dependent, catalytic, beta b [Source:ZFIN;Acc:ZDB-GENE-050904-4])

HSP 1 Score: 470.315 bits (1209), Expect = 4.163e-167
Identity = 212/313 (67.73%), Postives = 258/313 (82.43%), Query Frame = 2
Query:   50 NQNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
             Q+  CLDDF R KTLGTGS+GRV+LV+HK    YYAMKVL+K  +VK+KQ+EHTLNEKRILQA++FPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNL+NGVNDIKNHKWF + +W A++ ++   PF PK  GP DT NF+DYEE+ ++++ T K  KE
Sbjct:   35 QQSTTCLDDFDRQKTLGTGSFGRVLLVKHKASDQYYAMKVLDKQKVVKLKQVEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLRNGVNDIKNHKWFATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEEDIRVSVTEKCAKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Zebrafish
Match: prkacab (protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-040801-208])

HSP 1 Score: 466.077 bits (1198), Expect = 2.548e-165
Identity = 210/312 (67.31%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN ACL+DF RLKTLGTGS+GRV+LV+H++   +YAMK+L K  +VK+KQIEHTLNEKRILQA++FPFLV+L Y FKDN+ LYMVM+++ GGEMF+HLRRIG+F E H +FYASQ+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVL+YEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIK HKWF + +W A++++    PF PK  GP DT NF+DYEE+ ++++ T K  KE
Sbjct:   36 QNTACLEDFDRLKTLGTGSFGRVMLVRHRETGQHYAMKILNKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYSFKDNTNLYMVMQYVQGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLMYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFSTTDWIAIYQRRVEAPFVPKCRGPGDTSNFDDYEEEEIRVSFTEKCAKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Zebrafish
Match: prkacaa (protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate a [Source:ZFIN;Acc:ZDB-GENE-050114-6])

HSP 1 Score: 460.685 bits (1184), Expect = 2.884e-163
Identity = 209/312 (66.99%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN A LD F RLKTLGTGS+GRV+LV+HK+   ++AMK+L+K  +VK+KQIEHTLNEKRILQA++FPFLV+L + FKDN+ LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIK HKWF + +W A+++K+   PF PK  GP DT NF+DY+E+ ++++ T K  KE
Sbjct:   37 QNTASLDHFERLKTLGTGSFGRVMLVKHKESGQHFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEHSFKDNTNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKGHKWFATTDWIAIYQKKVEAPFIPKCKGPGDTSNFDDYDEEEIRVSITEKCGKE 348          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Zebrafish
Match: prkacba (protein kinase, cAMP-dependent, catalytic, beta a [Source:ZFIN;Acc:ZDB-GENE-040426-1351])

HSP 1 Score: 452.595 bits (1163), Expect = 2.525e-159
Identity = 205/313 (65.50%), Postives = 259/313 (82.75%), Query Frame = 2
Query:   50 NQNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
             ++ ACLDDF +LKTLGTGS+GRV+LV+HK+ + Y+AMK+L+K  +VK+KQIEHTLNEK+ILQA++FPFLVKL   FKDNS LYMVM +I GGEMF+HLRRIG+F E + +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGV+DIKNH+WF S +W A++ K+   P  PK  GP DT NF++Y+E+ ++++ + +  KE
Sbjct:   79 QKSTACLDDFDKLKTLGTGSFGRVMLVKHKQSEQYFAMKILDKLKVVKLKQIEHTLNEKKILQAVSFPFLVKLECAFKDNSNLYMVMRYIQGGEMFSHLRRIGRFSEQNARFYAAQIVLTFEYLHMLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRYPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKNHRWFASTDWIAIYEKKVDAPIIPKCRGPGDTSNFDEYDEEVIRVSVSEQCSKE 391          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Zebrafish
Match: prkacba (protein kinase, cAMP-dependent, catalytic, beta a [Source:ZFIN;Acc:ZDB-GENE-040426-1351])

HSP 1 Score: 452.595 bits (1163), Expect = 2.525e-159
Identity = 205/313 (65.50%), Postives = 259/313 (82.75%), Query Frame = 2
Query:   50 NQNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
             ++ ACLDDF +LKTLGTGS+GRV+LV+HK+ + Y+AMK+L+K  +VK+KQIEHTLNEK+ILQA++FPFLVKL   FKDNS LYMVM +I GGEMF+HLRRIG+F E + +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGV+DIKNH+WF S +W A++ K+   P  PK  GP DT NF++Y+E+ ++++ + +  KE
Sbjct:   79 QKSTACLDDFDKLKTLGTGSFGRVMLVKHKQSEQYFAMKILDKLKVVKLKQIEHTLNEKKILQAVSFPFLVKLECAFKDNSNLYMVMRYIQGGEMFSHLRRIGRFSEQNARFYAAQIVLTFEYLHMLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRYPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKNHRWFASTDWIAIYEKKVDAPIIPKCRGPGDTSNFDEYDEEVIRVSVSEQCSKE 391          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Xenopus
Match: prkacb (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:100038053])

HSP 1 Score: 474.552 bits (1220), Expect = 1.390e-168
Identity = 215/312 (68.91%), Postives = 261/312 (83.65%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN A LDDF R+KTLGTGS+GRV+LV+HK  + YYAMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP DT NF+DYEE+ ++++ T K  KE
Sbjct:   36 QNTASLDDFERIKTLGTGSFGRVMLVKHKGAEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKCRGPGDTSNFDDYEEEDIRVSLTEKCAKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Xenopus
Match: prkacb (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:100038053])

HSP 1 Score: 473.396 bits (1217), Expect = 3.012e-168
Identity = 215/312 (68.91%), Postives = 261/312 (83.65%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN A LDDF R+KTLGTGS+GRV+LV+HK  + YYAMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP DT NF+DYEE+ ++++ T K  KE
Sbjct:   27 QNTASLDDFERIKTLGTGSFGRVMLVKHKGAEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKCRGPGDTSNFDDYEEEDIRVSLTEKCAKE 338          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Xenopus
Match: ints8 (integrator complex subunit 8 [Source:Xenbase;Acc:XB-GENE-980129])

HSP 1 Score: 464.922 bits (1195), Expect = 6.515e-165
Identity = 212/312 (67.95%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN A L+ F R+KTLGTGS+GRV+LV+HK+  +++AMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYASQ+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGV DIK HKWF + +W AV++K+   PF PK  GP DT NF+DYEE+ ++++ T K  KE
Sbjct:   22 QNTAHLEQFERIKTLGTGSFGRVMLVRHKENGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVTDIKGHKWFSTTDWIAVYQKKVEAPFIPKCKGPGDTSNFDDYEEEEIRVSITEKCAKE 333          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Xenopus
Match: ints8 (integrator complex subunit 8 [Source:Xenbase;Acc:XB-GENE-980129])

HSP 1 Score: 465.307 bits (1196), Expect = 6.808e-165
Identity = 212/312 (67.95%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN A L+ F R+KTLGTGS+GRV+LV+HK+  +++AMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYASQ+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGV DIK HKWF + +W AV++K+   PF PK  GP DT NF+DYEE+ ++++ T K  KE
Sbjct:   42 QNTAHLEQFERIKTLGTGSFGRVMLVRHKENGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVTDIKGHKWFSTTDWIAVYQKKVEAPFIPKCKGPGDTSNFDDYEEEEIRVSITEKCAKE 353          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Xenopus
Match: ints8 (integrator complex subunit 8 [Source:Xenbase;Acc:XB-GENE-980129])

HSP 1 Score: 464.922 bits (1195), Expect = 7.113e-165
Identity = 212/312 (67.95%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN A L+ F R+KTLGTGS+GRV+LV+HK+  +++AMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYASQ+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGV DIK HKWF + +W AV++K+   PF PK  GP DT NF+DYEE+ ++++ T K  KE
Sbjct:   26 QNTAHLEQFERIKTLGTGSFGRVMLVRHKENGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVTDIKGHKWFSTTDWIAVYQKKVEAPFIPKCKGPGDTSNFDDYEEEEIRVSITEKCAKE 337          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Mouse
Match: Prkaca (protein kinase, cAMP dependent, catalytic, alpha [Source:MGI Symbol;Acc:MGI:97592])

HSP 1 Score: 467.618 bits (1202), Expect = 5.327e-166
Identity = 212/313 (67.73%), Postives = 260/313 (83.07%), Query Frame = 2
Query:   50 NQNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            +QN A LD F R+KTLGTGS+GRV+LV+HK+   +YAMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLVKL + FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP DT NF+DYEE+ ++++   K  KE
Sbjct:   35 SQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Mouse
Match: Prkaca (protein kinase, cAMP dependent, catalytic, alpha [Source:MGI Symbol;Acc:MGI:97592])

HSP 1 Score: 467.233 bits (1201), Expect = 7.155e-166
Identity = 212/313 (67.73%), Postives = 260/313 (83.07%), Query Frame = 2
Query:   50 NQNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            +QN A LD F R+KTLGTGS+GRV+LV+HK+   +YAMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLVKL + FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP DT NF+DYEE+ ++++   K  KE
Sbjct:   27 SQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKE 339          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Mouse
Match: Prkacb (protein kinase, cAMP dependent, catalytic, beta [Source:MGI Symbol;Acc:MGI:97594])

HSP 1 Score: 454.907 bits (1169), Expect = 4.609e-161
Identity = 208/309 (67.31%), Postives = 255/309 (82.52%), Query Frame = 2
Query:   62 ACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            A L+DF R KTLGTGS+GRV+LV+HK  + YYAMK+L+K  +VK+KQIEHTLNEKRILQA+ FPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGV+DIK HKWF + +W A+++++   PF PK  G  DT NF+DYEE+ ++++ T K  KE
Sbjct:   27 AGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKCGKE 335          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Mouse
Match: Prkacb (protein kinase, cAMP dependent, catalytic, beta [Source:MGI Symbol;Acc:MGI:97594])

HSP 1 Score: 455.292 bits (1170), Expect = 5.192e-161
Identity = 208/309 (67.31%), Postives = 255/309 (82.52%), Query Frame = 2
Query:   62 ACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            A L+DF R KTLGTGS+GRV+LV+HK  + YYAMK+L+K  +VK+KQIEHTLNEKRILQA+ FPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGV+DIK HKWF + +W A+++++   PF PK  G  DT NF+DYEE+ ++++ T K  KE
Sbjct:   39 AGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKCGKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Mouse
Match: Prkacb (protein kinase, cAMP dependent, catalytic, beta [Source:MGI Symbol;Acc:MGI:97594])

HSP 1 Score: 454.521 bits (1168), Expect = 6.244e-161
Identity = 208/309 (67.31%), Postives = 255/309 (82.52%), Query Frame = 2
Query:   62 ACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            A L+DF R KTLGTGS+GRV+LV+HK  + YYAMK+L+K  +VK+KQIEHTLNEKRILQA+ FPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGV+DIK HKWF + +W A+++++   PF PK  G  DT NF+DYEE+ ++++ T K  KE
Sbjct:   26 AGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKCGKE 334          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. UniProt
Match: sp|P12370|KAPC1_DROME (cAMP-dependent protein kinase catalytic subunit 1 OS=Drosophila melanogaster OX=7227 GN=Pka-C1 PE=1 SV=3)

HSP 1 Score: 470.7 bits (1210), Expect = 2.832e-166
Identity = 213/311 (68.49%), Postives = 260/311 (83.60%), Query Frame = 2
Query:   56 NVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            N A LDDF R+KTLGTGS+GRV++VQHK  + YYAMK+L+K  +VK+KQ+EHTLNEKRILQAI FPFLV L YHFKDNS LYMV+E++ GGEMF+HLR++G+F E H +FYA+Q+VLA EYLH+LD+IYRDLKPEN+LID  GY+K+TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVL+YEM+   PPF  +  I +YEKIV GKV  P++F SDLKDLLR+LLQVDLTKR GNLK GVNDIKN KWF S +W A+F+K+   PF P+  GP DT NF+DYEE++L+I++T K  KE
Sbjct:   39 NTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKE 349          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. UniProt
Match: sp|P05132|KAPCA_MOUSE (cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus OX=10090 GN=Prkaca PE=1 SV=3)

HSP 1 Score: 467.618 bits (1202), Expect = 3.726e-165
Identity = 212/313 (67.73%), Postives = 260/313 (83.07%), Query Frame = 2
Query:   50 NQNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            +QN A LD F R+KTLGTGS+GRV+LV+HK+   +YAMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLVKL + FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP DT NF+DYEE+ ++++   K  KE
Sbjct:   35 SQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. UniProt
Match: sp|P36887|KAPCA_PIG (cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa OX=9823 GN=PRKACA PE=1 SV=4)

HSP 1 Score: 465.307 bits (1196), Expect = 3.397e-164
Identity = 212/312 (67.95%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN A LD F R+KTLGTGS+GRV+LV+HK+   ++AMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLVKL Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP DT NF+DYEE+ ++++   K  KE
Sbjct:   36 QNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. UniProt
Match: sp|P17612|KAPCA_HUMAN (cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA PE=1 SV=2)

HSP 1 Score: 465.307 bits (1196), Expect = 3.472e-164
Identity = 212/312 (67.95%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN A LD F R+KTLGTGS+GRV+LV+HK+   +YAMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLVKL + FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP DT NF+DYEE+ ++++   K  KE
Sbjct:   36 QNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. UniProt
Match: sp|P27791|KAPCA_RAT (cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus OX=10116 GN=Prkaca PE=1 SV=2)

HSP 1 Score: 464.922 bits (1195), Expect = 5.148e-164
Identity = 212/313 (67.73%), Postives = 260/313 (83.07%), Query Frame = 2
Query:   50 NQNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            +QN A LD F R+KTLGTGS+GRV+LV+HK+   +YAMK+L+K  +VK+KQIEHTLNEKRILQA+NFPFLVKL + FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP DT NF+DYEE+ ++++   K  KE
Sbjct:   35 SQNTAQLDHFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|24658152 (tr|A0A158QTM7|A0A158QTM7_9CEST Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS3401 PE=3 SV=1)

HSP 1 Score: 490.345 bits (1261), Expect = 1.305e-171
Identity = 224/312 (71.79%), Postives = 269/312 (86.22%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN ACLDDF R+KTLGTGS+GRV+LVQHK K+TYYAMK+L+K  +VK+KQ+EHTLNEKRILQAI+FPFLVKL+YHFKDNS LYMV++FI GGEMF+HLR+IG+F E+H +FYASQVVLA EYLHHL+++YRDLKPENILID  GY+KITD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVL+YEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W  +++ EA  PF PK  GP D DNF++YEE+ L+I+AT K  K+
Sbjct:   35 QNTACLDDFDRIKTLGTGSFGRVMLVQHKAKKTYYAMKILDKQKVVKLKQVEHTLNEKRILQAISFPFLVKLNYHFKDNSNLYMVLDFINGGEMFSHLRKIGRFSESHARFYASQVVLAFEYLHHLELVYRDLKPENILIDEHGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFYADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWFVIYKCEAEAPFIPKCKGPGDADNFDEYEEEPLRISATEKCAKD 346          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|19305532 (tr|A0A564Y7G1|A0A564Y7G1_HYMDI Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3898 PE=3 SV=1)

HSP 1 Score: 490.345 bits (1261), Expect = 2.353e-171
Identity = 224/312 (71.79%), Postives = 267/312 (85.58%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN ACLDDF R+KTLGTGS+GRV+LVQHK K+TYYAMK+L+K  +VK+KQ+EHTLNEKRILQAINFPFLVKL+Y FKDNS LYMV++FI GGEMF+HLR+IG+F E+H +FYASQVVLA EYLHHL+++YRDLKPENILID  GY+KITD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVL+YEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF S +W  +++ E   PF PK  GP D DNF++YEE+ L+I+AT K  K+
Sbjct:   53 QNTACLDDFDRIKTLGTGSFGRVMLVQHKAKKTYYAMKILDKQKVVKLKQVEHTLNEKRILQAINFPFLVKLNYSFKDNSNLYMVLDFINGGEMFSHLRKIGRFSESHARFYASQVVLAFEYLHHLELVYRDLKPENILIDEHGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFYADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFASTDWFVIYKCEGEAPFVPKCKGPGDADNFDEYEEEPLRISATEKCAKD 364          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|19343179 (tr|A0A564Y900|A0A564Y900_HYMDI Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3898 PE=3 SV=1)

HSP 1 Score: 489.574 bits (1259), Expect = 3.854e-171
Identity = 224/312 (71.79%), Postives = 267/312 (85.58%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN ACLDDF R+KTLGTGS+GRV+LVQHK K+TYYAMK+L+K  +VK+KQ+EHTLNEKRILQAINFPFLVKL+Y FKDNS LYMV++FI GGEMF+HLR+IG+F E+H +FYASQVVLA EYLHHL+++YRDLKPENILID  GY+KITD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVL+YEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF S +W  +++ E   PF PK  GP D DNF++YEE+ L+I+AT K  K+
Sbjct:   42 QNTACLDDFDRIKTLGTGSFGRVMLVQHKAKKTYYAMKILDKQKVVKLKQVEHTLNEKRILQAINFPFLVKLNYSFKDNSNLYMVLDFINGGEMFSHLRKIGRFSESHARFYASQVVLAFEYLHHLELVYRDLKPENILIDEHGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFYADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFASTDWFVIYKCEGEAPFVPKCKGPGDADNFDEYEEEPLRISATEKCAKD 353          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|19346013 (tr|A0A564Y8E2|A0A564Y8E2_HYMDI Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3898 PE=3 SV=1)

HSP 1 Score: 490.345 bits (1261), Expect = 5.399e-171
Identity = 224/312 (71.79%), Postives = 267/312 (85.58%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN ACLDDF R+KTLGTGS+GRV+LVQHK K+TYYAMK+L+K  +VK+KQ+EHTLNEKRILQAINFPFLVKL+Y FKDNS LYMV++FI GGEMF+HLR+IG+F E+H +FYASQVVLA EYLHHL+++YRDLKPENILID  GY+KITD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVL+YEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF S +W  +++ E   PF PK  GP D DNF++YEE+ L+I+AT K  K+
Sbjct:   77 QNTACLDDFDRIKTLGTGSFGRVMLVQHKAKKTYYAMKILDKQKVVKLKQVEHTLNEKRILQAINFPFLVKLNYSFKDNSNLYMVLDFINGGEMFSHLRKIGRFSESHARFYASQVVLAFEYLHHLELVYRDLKPENILIDEHGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFYADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFASTDWFVIYKCEGEAPFVPKCKGPGDADNFDEYEEEPLRISATEKCAKD 388          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|19331483 (tr|A0A564Y7T1|A0A564Y7T1_HYMDI Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3898 PE=3 SV=1)

HSP 1 Score: 488.804 bits (1257), Expect = 5.487e-171
Identity = 224/312 (71.79%), Postives = 267/312 (85.58%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            QN ACLDDF R+KTLGTGS+GRV+LVQHK K+TYYAMK+L+K  +VK+KQ+EHTLNEKRILQAINFPFLVKL+Y FKDNS LYMV++FI GGEMF+HLR+IG+F E+H +FYASQVVLA EYLHHL+++YRDLKPENILID  GY+KITD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVL+YEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF S +W  +++ E   PF PK  GP D DNF++YEE+ L+I+AT K  K+
Sbjct:   32 QNTACLDDFDRIKTLGTGSFGRVMLVQHKAKKTYYAMKILDKQKVVKLKQVEHTLNEKRILQAINFPFLVKLNYSFKDNSNLYMVLDFINGGEMFSHLRKIGRFSESHARFYASQVVLAFEYLHHLELVYRDLKPENILIDEHGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFYADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFASTDWFVIYKCEGEAPFVPKCKGPGDADNFDEYEEEPLRISATEKCAKD 343          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Cavefish
Match: ENSAMXT00000050353.1 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:103029308])

HSP 1 Score: 471.855 bits (1213), Expect = 9.489e-168
Identity = 214/312 (68.59%), Postives = 260/312 (83.33%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            Q+  CLDDF RLKTLGTGS+GRV+LV+HK  + YYAMK+L+K  +VK+KQIEHTLNEKRILQA++FPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E+H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A++ ++   P  PK  GP DT NF+DYEE+ ++I+ T K  KE
Sbjct:   36 QSTTCLDDFERLKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPIIPKCRGPGDTSNFDDYEEEEIRISDTEKCAKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Cavefish
Match: ENSAMXT00000045721.1 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:103029308])

HSP 1 Score: 470.315 bits (1209), Expect = 1.771e-167
Identity = 213/312 (68.27%), Postives = 260/312 (83.33%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            ++  CLDDF RLKTLGTGS+GRV+LV+HK  + YYAMK+L+K  +VK+KQIEHTLNEKRILQA++FPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E+H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A++ ++   P  PK  GP DT NF+DYEE+ ++I+ T K  KE
Sbjct:   17 ESTTCLDDFERLKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPIIPKCRGPGDTSNFDDYEEEEIRISDTEKCAKE 328          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Cavefish
Match: ENSAMXT00000056663.1 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:103029308])

HSP 1 Score: 472.241 bits (1214), Expect = 3.693e-167
Identity = 214/312 (68.59%), Postives = 260/312 (83.33%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            Q+  CLDDF RLKTLGTGS+GRV+LV+HK  + YYAMK+L+K  +VK+KQIEHTLNEKRILQA++FPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E+H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A++ ++   P  PK  GP DT NF+DYEE+ ++I+ T K  KE
Sbjct:   80 QSTTCLDDFERLKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPIIPKCRGPGDTSNFDDYEEEEIRISDTEKCAKE 391          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Cavefish
Match: ENSAMXT00000050990.1 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:103029308])

HSP 1 Score: 470.315 bits (1209), Expect = 6.248e-167
Identity = 213/312 (68.27%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            Q+  CLDDF RLKTLGTGS+GRV+LV+HK  + YYAMK+L+K  +VK+KQIEHTLNEKRILQA++FPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E+H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A++ ++   P  PK  GP DT NF+DYEE+ ++I+ T K   E
Sbjct:   36 QSTTCLDDFERLKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPIIPKCRGPGDTSNFDDYEEEEIRISDTEKLRGE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Cavefish
Match: prkacbb (cAMP-dependent protein kinase catalytic subunit beta [Source:NCBI gene;Acc:103034112])

HSP 1 Score: 466.848 bits (1200), Expect = 1.037e-165
Identity = 212/312 (67.95%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            Q+   LDDF RLKTLGTGS+GRV+LV+HK  + ++AMKVL+K  +VK+KQIEHTLNEKRILQA++FPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A++ ++   PF PK  GP DT NF+DYEE+ ++++ T K  KE
Sbjct:   36 QSTTTLDDFERLKTLGTGSFGRVMLVKHKGTEQFFAMKVLDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEEDIRVSVTEKCAKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 414.075 bits (1063), Expect = 1.246e-146
Identity = 186/277 (67.15%), Postives = 231/277 (83.39%), Query Frame = 2
Query:  158 AMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            ++K  ++  +VK+KQ+EHTLNEKRILQAI+FPFLV+L Y FKDNS LYMV+E++ GGEMF+HLRRIG+F E H +FYA+Q+VLA EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIKNHKWF + +W A+++++   PF PK  GP D  NF+DYEE+ ++I++T K  KE
Sbjct:    8 SLKATKRTKVVKLKQVEHTLNEKRILQAISFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYQRKVEAPFIPKCKGPGDASNFDDYEEEEIRISSTEKCAKE 284          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002200.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.003 bits (676), Expect = 3.138e-87
Identity = 122/291 (41.92%), Postives = 187/291 (64.26%), Query Frame = 2
Query:   86 LKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKG--KTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRG--KVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEE 946
            + TLG G +GRV LV+ K     +A+K L+K  +V+ +Q EH  +EKRILQ  + PF+V+ +  F+D  +++++ME   GGE+++ LR  G F+E   +F  + VV AL YLH   ++YRDLKPEN+L+D  GYIK+ D GFAK++    K WTFCGTPEY+ PE+I+++G+D   D W+LGVL+YE+    PPFSG + +  Y  I+ G  +V  P       +D++R L + + ++R+GN K+GV D++ HKWF   +W ++   +   P K + +GP D  NF+ + E
Sbjct:   37 IATLGVGGFGRVQLVKLKDSDVTFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVRFYRTFRDQKFVFLLMEACLGGELWSVLRDSGGFQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDARGYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVHFPNEVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESLRSNQLASPLKREVSGPTDFKNFDWFPE 327          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 254.218 bits (648), Expect = 6.866e-82
Identity = 128/291 (43.99%), Postives = 181/291 (62.20%), Query Frame = 2
Query:   74 DFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRIL-QAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKR---VKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFN 934
            DF  L  LG GS+G+V+L +HK    +YA+KV++K  I++ K+ +H + E+ +L + +  PFLV LHY F+    LY VM+++ GGE+F HL+R G F E+  QFYA+++  A+ YLH L+++YRDLKPENIL+D  G+I +TD G  K        T TFCGTPEYLAPEV+    YD  VDWW LG ++YEM    PPF  +N   MYE I+   + L    T+    +L  LL  D  +R+G   + + +IKNH +F +INWN +  K    P+ P  +GP D  NF+
Sbjct:   91 DFDFLTVLGKGSFGKVLLAKHKSDGIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLGATSD-ILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFD 380          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 247.284 bits (630), Expect = 1.363e-78
Identity = 127/309 (41.10%), Postives = 185/309 (59.87%), Query Frame = 2
Query:   68 LDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLH-HLDVIYRDLKPENILIDLTGYIKITDMGFAKR--VKGKTW-TFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFN-DYEEQSLKIAATVKY 979
            +++F  LK LG G++G+VILV+ K    YYAMK+L+K  IV   ++ HTL E R+LQ    PFL  L Y F+ +  L  VME++ GGE+F HL R   F E+  +FY +++V AL+YLH   +V+YRDLK EN+++D  G+IKI D G  K     G T  TFCGTPEYLAPEV+    Y  AVDWW LGV++YEM     PF  ++H  ++E I+   +  P   ++D + LL  LL+ D  +R+G   +   +I  H +F  I W  V+ ++   PFKP+     DT  F+ ++  Q++ I    ++
Sbjct:  147 MNNFDYLKLLGKGTFGKVILVREKATGQYYAMKILKKEVIVAKDEVAHTLTENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDEEFTAQTITITPPDRF 455          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004852.1 (pep scaffold:Pmarinus_7.0:GL488704:3417:7135:1 gene:ENSPMAG00000004407.1 transcript:ENSPMAT00000004852.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.106 bits (588), Expect = 3.706e-76
Identity = 103/149 (69.13%), Postives = 128/149 (85.91%), Query Frame = 2
Query:   50 NQNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKI 496
             QN +CLDDF R+KTLGTGS+GRV+LV+HK    Y+AMK+L+K  +VK+KQ+EHTLNEKRILQAI+FPFLV L Y +KDNS LYMV+E++ GGEMF+HLRRIG+F E H +FYA+Q+VLA EYLH LD+IYRDLKPEN+LID  GYI++
Sbjct:   35 QQNTSCLDDFERMKTLGTGSFGRVMLVKHKATDRYFAMKILDKQKVVKLKQVEHTLNEKRILQAISFPFLVSLEYSYKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQV 183          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 318.161 bits (814), Expect = 1.017e-107
Identity = 153/298 (51.34%), Postives = 209/298 (70.13%), Query Frame = 2
Query:   65 CLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPK-SNGPDDTDNFNDYEEQSL 955
             L DF  ++TLGTGS+GRV LV+      YYA+KVL+K  +VKMKQ+EHT +E+R+L+ +  PFL+++   F+D   ++MVM++I GGE+F+ LR+  +F     +FYA++V+LALEYLH  ++IYRDLKPENIL+D  G+IKITD GFAK V+  TWT CGTP+Y+APEVI +K Y+ +VDWWSLGVLIYEM     PF     +  YEKI++GKV  P YF  D+ DLL  L+  DLT+RIGNL++G  DIK H WF  + W  +  K+   P++P  ++G  DT  F+ Y E+ L
Sbjct:   66 TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPEEQL 363          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 308.531 bits (789), Expect = 1.359e-103
Identity = 140/298 (46.98%), Postives = 203/298 (68.12%), Query Frame = 2
Query:   65 CLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPK-SNGPDDTDNFNDYEEQSL 955
             L DF  L+TLGTGS+GRV L++ +    YYAMKVL+K  +V++KQ+EHT +E+ +L  +  PF++++   F+D   ++M+M++I GGE+F+ LR+  +F     +FYA++V LALEYLH  D+IYRDLKPENIL+D  G+IKITD GFAK V   T+T CGTP+Y+APEV+ +K Y+ ++DWWS G+LIYEM     PF   N +  YEKI+  ++  P +F  D+KDLL  L+  DL++R+GNL+NG  D+KNH WF  + W  +  +    P++P    G  DT  F+ Y E+ +
Sbjct:   83 SLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEEDI 380          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 307.76 bits (787), Expect = 2.576e-103
Identity = 143/297 (48.15%), Postives = 204/297 (68.69%), Query Frame = 2
Query:   68 LDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPK-SNGPDDTDNFNDYEEQSL 955
            L DF  L+TLGTGS+GRV L++      +YA+K L+KHTIVK+KQ+EHT +E+R+L  ++ PF++++   F+D+  ++MVM++I GGE+F+ LR+  +F     +FYA++V LALEYLH  D+IYRDLKPENIL+D  G+IKITD GFAK V   T+T CGTP+Y+APEV+ +K Y+ +VDWWS GVLIYEM     PF   N +  YE I+  ++  P +F  D +DLL+ L+  DL++R+GNL+NG  D+KNH WF  + W  +  +    P++P    G  DT  F+ Y E+  
Sbjct:   85 LSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEEF 381          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 272.322 bits (695), Expect = 2.334e-86
Identity = 132/294 (44.90%), Postives = 190/294 (64.63%), Query Frame = 2
Query:   65 CLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAK---RVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFND 937
             +DDF  LK +G GS+G+V+ V+ K  Q  YA+K + K  IV   ++ HTL E+ +L  ++ PF+V L + F+    LY V+ FI GGE+F HL++ G+F  +  +FY ++++ AL+ LH LDV+YRDLKPENIL+D  G+I + D G  K   +   KT TFCGTPEYLAPE++L  GY  AVDWW+LGVL+YEM T  PP+  E+   MY+KI++  +  P  F  D KDLL  LL  D T+R+G   NG ++I+NH +F  ++W  +  K  + P+KP  +   DT NF++
Sbjct:  343 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRLG--YNGADEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDE 634          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 266.929 bits (681), Expect = 2.929e-84
Identity = 132/293 (45.05%), Postives = 186/293 (63.48%), Query Frame = 2
Query:   65 CLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAK---RVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFN 934
             +DDF  LK +G GS+G+V+ V+ K  Q  YA+K L K  IV   ++ HTL E+ +L  ++ PF+V L + F+    LY+V+ FI GGE+F HL+  G+F     +FY ++++ AL+ LH LDVIYRDLKPENIL+D  G+I + D G  K   +   KT TFCGTPEYLAPE++L +GY   VDWW+LG+L+YEM T  PP+  EN   MY+KI++  +  P  F    KDLL  LL  D ++R+G   NG ++I+NH +F  I+W  +  K  + P+KP      DT NF+
Sbjct:  340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLG--VNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFD 630          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Nematostella
Match: EDO35228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM62])

HSP 1 Score: 318.546 bits (815), Expect = 3.887e-108
Identity = 148/305 (48.52%), Postives = 211/305 (69.18%), Query Frame = 2
Query:   62 ACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYF-TSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATV 973
              L DF   KTLGTG++GRV+L + ++   +YA+K++    ++++KQ+EH  NEK IL +I  PF+V L +   D ++LYM++E+  GGE+FT+LR  G+F      F+ S++V A++YLH   ++YRDLKPENIL+D  G++K+TD GFAK V  KTWT CGTPEYLAPE+I SKG++ AVDWW+LG+LIYEM    PPF  +N   +YEKI+ GKV  P +   +  KDL++ LL  D T+R+G++KNG  D+KNHKWF  I+WN V +++   P  PK + P DT NF+DY E+  + A  +
Sbjct:   13 TTLQDFELSKTLGTGTFGRVLLARDRRGGEFYALKIMNISEVIRLKQVEHVQNEKNILMSIEHPFIVNLLWTQHDQTFLYMLLEYACGGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENILLDRDGHVKLTDFGFAKEVHDKTWTLCGTPEYLAPEIIQSKGHNKAVDWWALGILIYEMLVGYPPFFDDNPFGIYEKILSGKVEWPKHMDNTSAKDLIKKLLVHDRTRRLGSMKNGSEDVKNHKWFKVIDWNLVLQRKLKPPINPKISHPGDTRNFDDYPEEDWRGAPPL 317          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 275.404 bits (703), Expect = 3.397e-87
Identity = 132/292 (45.21%), Postives = 190/292 (65.07%), Query Frame = 2
Query:   68 LDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRV--KGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRG--KVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNF 931
            L+D   +KTLG G +GRV LVQ    +  +A+K L+KH IV+ +Q +H ++EK+I+   N PF+V+LH  FKD  YLYM++E   GGE++T LR  G F ++  +FY   V+ A +YLH   ++YRDLKPEN+L+D  GY K+ D GFAK++    KTWTFCGTPEY+APE+IL+KG+D + D+WSLG+L+YE+ T SPPFSG + +  Y  I++G   +  P   T +   L++ L + +  +R+G  K G+ DI  HKWF   NW+ +  ++   P  PK   P D  NF
Sbjct:  349 LEDLTVVKTLGIGGFGRVELVQVAGDKRTFALKTLKKHHIVETRQQDHIMSEKKIMMESNSPFIVRLHKTFKDKKYLYMLLEVCLGGELWTILRDRGSFDDSTTRFYVGCVIEAFQYLHSKGIVYRDLKPENLLLDGHGYCKLVDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMYELLTGSPPFSGTDPMKTYNIILKGIDMIDFPRKITRNAHALIKKLCRDNPVERLGYQKGGLKDIMKHKWFDGFNWDGLRSRKLNSPIAPKIKSPVDASNF 640          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 256.914 bits (655), Expect = 1.015e-82
Identity = 124/295 (42.03%), Postives = 179/295 (60.68%), Query Frame = 2
Query:   71 DDFLRLKTLGTGSYGRVILVQHK---KKQTYYAMKVLEKHTIVK-MKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRV---KGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFN 934
            + F  LK LG G YG+V LV+      K+  +AMKVL+K  I++  K   HT  E+ IL+ +  PF+V L Y F+    LY+++E++ GGE+F  L R G F E+   FY S++ +ALE+LH   ++YRDLKPENIL+D  G++K+TD G  K        T TFCGT EY+APE++   G+  AVDWWSLG L+Y+M T +PPF  +N     +KI++GK+ +P Y T + KD +R LL+     R+G +    N IK H +F  I W  +  K+   PF+P  +G +D   F+
Sbjct:   63 ESFELLKVLGKGGYGKVFLVKKNHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKKTIDKILKGKLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRHICWEDLLAKKVEPPFRPSISGEEDVSQFD 357          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 256.529 bits (654), Expect = 1.153e-82
Identity = 130/311 (41.80%), Postives = 188/311 (60.45%), Query Frame = 2
Query:   20 EVKIQACLLGNQN--VACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRIL-QAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKR---VKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFN 934
            +  ++   LG  N   A   DFL LK +G GS+G+V L ++K++  +YA+KVL K  I K  + +H + E+ +L Q +  PFLV LHY F+    LY V++++ GGE+F HL+R   F E+  +FYA+++  A+ YLH L +IYRDLKPENIL+D  G+I +TD G  K      G T TFCGTPEYLAPEV+  + YD +VDWW LG ++YEM    PPF   +   MY+ I+   + L T  +   + +L  LLQ D TKR+G+ +    DI+ H +F SINW  +  +    P+ P  +G  D  +F+
Sbjct:   53 DADVEKIDLGESNNPKAKPSDFLFLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQLVARGIEPPYNPNVSGQLDLKHFD 363          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Nematostella
Match: EDO31895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWM6])

HSP 1 Score: 246.128 bits (627), Expect = 1.116e-76
Identity = 121/291 (41.58%), Postives = 187/291 (64.26%), Query Frame = 2
Query:   77 FLRLKTLGTGSYGRVILVQH---KKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVK--GKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFN 934
            F  LK LG GS+G+V LV+        T YAMKVL+K T+ K++    T+ E+ IL  +  PF+V+L+Y F+    +Y++++F+ GG++FT L +   F E  V+FY +++ LAL++LH L +IYRDLKPENIL+D +G++ +TD G +K  +   KT++FCGT EY+APEV+  +G+  A DWWS GVL++EM T S PF G++       I++ K+ +P + T + + LLR L + +   R+G    G+ DIK H +F +INW  ++++E   PFKP +   DD   F+
Sbjct:    9 FELLKVLGQGSFGKVFLVRKVIGADAGTLYAMKVLKKATL-KVRDRMRTMKERDILVDVQHPFIVRLNYAFQTEGKVYLILDFLRGGDLFTRLSKEIMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLDASGHVALTDFGLSKESEHDQKTYSFCGTVEYMAPEVVNRRGHSQAADWWSYGVLMFEMLTGSLPFQGKDRKDTMNMILKAKLGMPQFLTPEAQSLLRQLFKRNPLNRLGAGDLGIEDIKKHPFFSTINWELLYKREIKPPFKPAAGRADDAFYFD 298          

HSP 2 Score: 101.293 bits (251), Expect = 1.293e-23
Identity = 65/212 (30.66%), Postives = 108/212 (50.94%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENIL-IDLTG---YIKITDMGFAKRVK---GKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFS 667
            +    LD++   + +G G+Y       +K     YA+K+ EK      +++E       +L+  + P +V L   ++    +Y+VME + GGE+   + +     E         +   + +LH   V++RDLKP NI+  D +G    ++I D GFAK+++   G   T C T  ++APEV+  +GYD A D WSLGVL+Y M +   PF+
Sbjct:  348 RTTCILDEYEIKEEIGKGAYSSCRRCVNKADGKEYAVKIFEKPKKDPSEEMEI------LLRFGHHPNIVHLRDAYEAGKQVYIVMELMRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPESLRIVDFGFAKQMRATNGLLMTPCYTANFVAPEVLKKQGYDAACDIWSLGVLLYTMLSGLTPFA 553          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Medaka
Match: ENSORLT00000033457.1 (cAMP-dependent protein kinase catalytic subunit beta [Source:NCBI gene;Acc:101170876])

HSP 1 Score: 466.077 bits (1198), Expect = 2.054e-165
Identity = 210/312 (67.31%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            Q+  CL+DF R+KTLGTGS+GRV+LV+HK  + Y+AMK+L+K  +VK+KQIEHTLNEKRILQA++FPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIK HKWF + +W A++ ++   PF PK  GP DT NF+DYEE+ ++++ T K  KE
Sbjct:   36 QSTTCLEDFDRIKTLGTGSFGRVMLVKHKSSEQYFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEEEIRVSLTEKCAKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Medaka
Match: ENSORLT00000035979.1 (cAMP-dependent protein kinase catalytic subunit beta [Source:NCBI gene;Acc:101170876])

HSP 1 Score: 466.077 bits (1198), Expect = 2.140e-165
Identity = 210/312 (67.31%), Postives = 259/312 (83.01%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            Q+  CL+DF R+KTLGTGS+GRV+LV+HK  + Y+AMK+L+K  +VK+KQIEHTLNEKRILQA++FPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIK HKWF + +W A++ ++   PF PK  GP DT NF+DYEE+ ++++ T K  KE
Sbjct:   39 QSTTCLEDFDRIKTLGTGSFGRVMLVKHKSSEQYFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEEEIRVSLTEKCAKE 350          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Medaka
Match: ENSORLT00000021648.2 (cAMP-dependent protein kinase catalytic subunit beta [Source:NCBI gene;Acc:101170876])

HSP 1 Score: 462.996 bits (1190), Expect = 1.801e-164
Identity = 209/311 (67.20%), Postives = 258/311 (82.96%), Query Frame = 2
Query:   56 NVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            +  CL+DF R+KTLGTGS+GRV+LV+HK  + Y+AMK+L+K  +VK+KQIEHTLNEKRILQA++FPFLV+L Y FKDNS LYMVME++ GGEMF+HLRRIG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVLIYEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIK HKWF + +W A++ ++   PF PK  GP DT NF+DYEE+ ++++ T K  KE
Sbjct:   23 STTCLEDFDRIKTLGTGSFGRVMLVKHKSSEQYFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEEEIRVSLTEKCAKE 333          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Medaka
Match: ENSORLT00000040528.1 (cAMP-dependent protein kinase catalytic subunit alpha [Source:NCBI gene;Acc:101160964])

HSP 1 Score: 457.218 bits (1175), Expect = 1.856e-162
Identity = 207/313 (66.13%), Postives = 258/313 (82.43%), Query Frame = 2
Query:   50 NQNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            N N A L+ F RLKTLGTGS+GRV+LV+H++   +YAMK+L K  +VK+KQIEHTLNEKRILQA++FPFLV+L + FKDN+ LYMVME++ GGEMF+HLR+IG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVL+YEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIK HKWF + +W A+F+K+   PF PK  GP DT NF+DYEE+ ++++ + K  KE
Sbjct:    4 NSNTANLEQFERLKTLGTGSFGRVMLVKHRETGQHYAMKILNKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEFSFKDNTNLYMVMEYVPGGEMFSHLRKIGRFSEPHARFYATQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFAATDWIAIFQKKVEAPFVPKFKGPGDTSNFDDYEEEEIRVSFSEKCAKE 316          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Medaka
Match: ENSORLT00000040218.1 (cAMP-dependent protein kinase catalytic subunit alpha [Source:NCBI gene;Acc:101160964])

HSP 1 Score: 458.373 bits (1178), Expect = 2.357e-162
Identity = 207/313 (66.13%), Postives = 259/313 (82.75%), Query Frame = 2
Query:   50 NQNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            +QN A L+ F RLKTLGTGS+GRV+LV+H++   +YAMK+L K  +VK+KQIEHTLNEKRILQA++FPFLV+L + FKDN+ LYMVME++ GGEMF+HLR+IG+F E H +FYA+Q+VL  EYLH LD+IYRDLKPEN+LID  GYI++TD GFAKRVKG+TWT CGTPEYLAPE+ILSKGY+ AVDWW+LGVL+YEM+   PPF  +  I +YEKIV GKV  P++F+SDLKDLLR+LLQVDLTKR GNLKNGVNDIK HKWF + +W A+F+K+   PF PK  GP DT NF+DYEE+ ++++ + K  KE
Sbjct:   35 SQNTANLEQFERLKTLGTGSFGRVMLVKHRETGQHYAMKILNKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEFSFKDNTNLYMVMEYVPGGEMFSHLRKIGRFSEPHARFYATQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFAATDWIAIFQKKVEAPFVPKFKGPGDTSNFDDYEEEEIRVSFSEKCAKE 347          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Planmine SMEST
Match: SMESG000048623.1 (SMESG000048623.1)

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 310/312 (99.36%), Postives = 311/312 (99.68%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            +NVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIV GKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE
Sbjct:   58 RNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVSGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 369          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Planmine SMEST
Match: SMESG000048623.1 (SMESG000048623.1)

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 310/312 (99.36%), Postives = 311/312 (99.68%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            +NVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIV GKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE
Sbjct:   56 RNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVSGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 367          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Planmine SMEST
Match: SMESG000043218.1 (SMESG000043218.1)

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 310/312 (99.36%), Postives = 311/312 (99.68%), Query Frame = 2
Query:   53 QNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            +NVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIV GKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE
Sbjct:   38 RNVACLDDFLRLKTLGTGSYGRVILVQHKKKQTYYAMKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVSGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 349          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Planmine SMEST
Match: SMESG000048623.1 (SMESG000048623.1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 275/276 (99.64%), Postives = 275/276 (99.64%), Query Frame = 2
Query:  161 MKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            MKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIV GKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE
Sbjct:    1 MKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVSGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 276          
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Planmine SMEST
Match: SMESG000043218.1 (SMESG000043218.1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 275/276 (99.64%), Postives = 275/276 (99.64%), Query Frame = 2
Query:  161 MKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 988
            MKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIV GKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE
Sbjct:    1 MKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVMEFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPENILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVDWWSLGVLIYEMSTDSPPFSGENHIHMYEKIVSGKVFLPTYFTSDLKDLLRSLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNGPDDTDNFNDYEEQSLKIAATVKYHKE 276          
The following BLAST results are available for this feature:
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKACA6.920e-16567.95protein kinase cAMP-activated catalytic subunit al... [more]
PRKACA6.920e-16567.95protein kinase cAMP-activated catalytic subunit al... [more]
PRKACA7.230e-16567.95protein kinase cAMP-activated catalytic subunit al... [more]
PRKACA7.230e-16567.95protein kinase cAMP-activated catalytic subunit al... [more]
PRKACB7.529e-16566.77protein kinase cAMP-activated catalytic subunit be... [more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kin-17.175e-16869.23cAMP-dependent protein kinase catalytic subunit [... [more]
kin-18.783e-16869.23cAMP-dependent protein kinase catalytic subunit [... [more]
kin-11.173e-16769.23cAMP-dependent protein kinase catalytic subunit [... [more]
kin-11.772e-16769.23cAMP-dependent protein kinase catalytic subunit [... [more]
kin-11.773e-16769.23cAMP-dependent protein kinase catalytic subunit [... [more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pka-C12.826e-16768.49gene:FBgn0000273 transcript:FBtr0335495[more]
Pka-C12.826e-16768.49gene:FBgn0000273 transcript:FBtr0079852[more]
Pka-C12.826e-16768.49gene:FBgn0000273 transcript:FBtr0079851[more]
Pka-C31.354e-10950.00gene:FBgn0000489 transcript:FBtr0075529[more]
Pka-C38.574e-10950.00gene:FBgn0000489 transcript:FBtr0075528[more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkacbb4.163e-16767.73protein kinase, cAMP-dependent, catalytic, beta b ... [more]
prkacab2.548e-16567.31protein kinase, cAMP-dependent, catalytic, alpha, ... [more]
prkacaa2.884e-16366.99protein kinase, cAMP-dependent, catalytic, alpha, ... [more]
prkacba2.525e-15965.50protein kinase, cAMP-dependent, catalytic, beta a ... [more]
prkacba2.525e-15965.50protein kinase, cAMP-dependent, catalytic, beta a ... [more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkacb1.390e-16868.91protein kinase cAMP-activated catalytic subunit be... [more]
prkacb3.012e-16868.91protein kinase cAMP-activated catalytic subunit be... [more]
ints86.515e-16567.95integrator complex subunit 8 [Source:Xenbase;Acc:X... [more]
ints86.808e-16567.95integrator complex subunit 8 [Source:Xenbase;Acc:X... [more]
ints87.113e-16567.95integrator complex subunit 8 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkaca5.327e-16667.73protein kinase, cAMP dependent, catalytic, alpha [... [more]
Prkaca7.155e-16667.73protein kinase, cAMP dependent, catalytic, alpha [... [more]
Prkacb4.609e-16167.31protein kinase, cAMP dependent, catalytic, beta [S... [more]
Prkacb5.192e-16167.31protein kinase, cAMP dependent, catalytic, beta [S... [more]
Prkacb6.244e-16167.31protein kinase, cAMP dependent, catalytic, beta [S... [more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P12370|KAPC1_DROME2.832e-16668.49cAMP-dependent protein kinase catalytic subunit 1 ... [more]
sp|P05132|KAPCA_MOUSE3.726e-16567.73cAMP-dependent protein kinase catalytic subunit al... [more]
sp|P36887|KAPCA_PIG3.397e-16467.95cAMP-dependent protein kinase catalytic subunit al... [more]
sp|P17612|KAPCA_HUMAN3.472e-16467.95cAMP-dependent protein kinase catalytic subunit al... [more]
sp|P27791|KAPCA_RAT5.148e-16467.73cAMP-dependent protein kinase catalytic subunit al... [more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|246581521.305e-17171.79tr|A0A158QTM7|A0A158QTM7_9CEST Uncharacterized pro... [more]
gnl|BL_ORD_ID|193055322.353e-17171.79tr|A0A564Y7G1|A0A564Y7G1_HYMDI Uncharacterized pro... [more]
gnl|BL_ORD_ID|193431793.854e-17171.79tr|A0A564Y900|A0A564Y900_HYMDI Uncharacterized pro... [more]
gnl|BL_ORD_ID|193460135.399e-17171.79tr|A0A564Y8E2|A0A564Y8E2_HYMDI Uncharacterized pro... [more]
gnl|BL_ORD_ID|193314835.487e-17171.79tr|A0A564Y7T1|A0A564Y7T1_HYMDI Uncharacterized pro... [more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050353.19.489e-16868.59protein kinase cAMP-activated catalytic subunit be... [more]
ENSAMXT00000045721.11.771e-16768.27protein kinase cAMP-activated catalytic subunit be... [more]
ENSAMXT00000056663.13.693e-16768.59protein kinase cAMP-activated catalytic subunit be... [more]
ENSAMXT00000050990.16.248e-16768.27protein kinase cAMP-activated catalytic subunit be... [more]
prkacbb1.037e-16567.95cAMP-dependent protein kinase catalytic subunit be... [more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001814.11.246e-14667.15pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
ENSPMAT00000002200.13.138e-8741.92pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 ... [more]
ENSPMAT00000006766.16.866e-8243.99pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000008480.11.363e-7841.10pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
ENSPMAT00000004852.13.706e-7669.13pep scaffold:Pmarinus_7.0:GL488704:3417:7135:1 gen... [more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK21.017e-10751.34cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK11.359e-10346.98cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK32.576e-10348.15cAMP-dependent protein kinase catalytic subunit; p... [more]
YPK12.334e-8644.90S/T protein kinase; phosphorylates, downregulates ... [more]
YPK22.929e-8445.05Protein kinase similar to S/T protein kinase Ypk1p... [more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352283.887e-10848.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384073.397e-8745.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411661.015e-8242.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378001.153e-8241.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318951.116e-7641.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033457.12.054e-16567.31cAMP-dependent protein kinase catalytic subunit be... [more]
ENSORLT00000035979.12.140e-16567.31cAMP-dependent protein kinase catalytic subunit be... [more]
ENSORLT00000021648.21.801e-16467.20cAMP-dependent protein kinase catalytic subunit be... [more]
ENSORLT00000040528.11.856e-16266.13cAMP-dependent protein kinase catalytic subunit al... [more]
ENSORLT00000040218.12.357e-16266.13cAMP-dependent protein kinase catalytic subunit al... [more]
back to top
BLAST of cAMP-dependent protein kinase catalytic subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048623.10.000e+099.36SMESG000048623.1[more]
SMESG000048623.10.000e+099.36SMESG000048623.1[more]
SMESG000043218.10.000e+099.36SMESG000043218.1[more]
SMESG000048623.10.000e+099.64SMESG000048623.1[more]
SMESG000043218.10.000e+099.64SMESG000043218.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007454 ID=SMED30007454|Name=cAMP-dependent protein kinase catalytic subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1036bp
GTTCATTTCATGGATTTAGGAAGTGAAAATTCAAGCGTGCCTTCTAGGAA
ATCAGAATGTGGCTTGTCTTGATGATTTTCTCCGATTGAAAACCCTTGGA
ACCGGTTCATATGGTCGAGTGATTTTAGTCCAACACAAAAAGAAACAGAC
ATATTATGCCATGAAAGTATTAGAAAAGCATACAATTGTCAAAATGAAAC
AAATAGAACATACGTTAAATGAAAAAAGAATTTTACAAGCAATTAATTTT
CCATTTTTAGTTAAATTACATTATCATTTTAAAGATAATAGTTATTTGTA
CATGGTTATGGAATTTATTGGAGGAGGTGAAATGTTCACCCATCTCAGAA
GGATAGGAAAGTTTAGAGAAAATCACGTTCAGTTCTACGCAAGCCAGGTC
GTCCTGGCGCTGGAATATTTGCATCATTTAGATGTGATTTACAGAGATTT
AAAGCCGGAAAACATTTTAATTGATCTCACAGGATATATTAAAATTACAG
ATATGGGATTCGCTAAGCGAGTGAAAGGCAAAACTTGGACGTTCTGTGGC
ACTCCCGAATATCTGGCACCGGAAGTCATTTTGAGTAAAGGATACGATCA
TGCTGTAGATTGGTGGTCACTTGGAGTTTTGATCTACGAAATGTCGACAG
ACAGTCCTCCATTTTCTGGAGAAAATCATATCCATATGTATGAGAAAATC
GTTAGAGGAAAAGTATTTCTCCCAACGTATTTTACCTCAGATCTCAAAGA
TTTACTCAGAAGCTTGTTACAGGTAGACTTGACAAAACGGATTGGCAATC
TTAAAAACGGAGTGAATGATATCAAGAATCATAAATGGTTTCTATCAATC
AACTGGAACGCCGTCTTTAGAAAAGAAGCAGTTGTTCCATTTAAGCCCAA
ATCAAACGGTCCCGATGATACTGACAACTTCAATGACTATGAAGAACAAT
CGTTGAAAATTGCAGCAACTGTAAAATACCACAAAGAATTTCTTGATTTT
TAATTGTTTTTAATTTAATTTTTGATTAATTTAAAA
back to top

protein sequence of SMED30007454-orf-1

>SMED30007454-orf-1 ID=SMED30007454-orf-1|Name=SMED30007454-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=281bp
MKVLEKHTIVKMKQIEHTLNEKRILQAINFPFLVKLHYHFKDNSYLYMVM
EFIGGGEMFTHLRRIGKFRENHVQFYASQVVLALEYLHHLDVIYRDLKPE
NILIDLTGYIKITDMGFAKRVKGKTWTFCGTPEYLAPEVILSKGYDHAVD
WWSLGVLIYEMSTDSPPFSGENHIHMYEKIVRGKVFLPTYFTSDLKDLLR
SLLQVDLTKRIGNLKNGVNDIKNHKWFLSINWNAVFRKEAVVPFKPKSNG
PDDTDNFNDYEEQSLKIAATVKYHKEFLDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0006468protein phosphorylation
GO:0007228positive regulation of hh target transcription factor activity
GO:0007314oocyte anterior/posterior axis specification
GO:0007317regulation of pole plasm oskar mRNA localization
GO:0007448anterior/posterior pattern specification, imaginal disc
GO:0007476imaginal disc-derived wing morphogenesis
GO:0007480imaginal disc-derived leg morphogenesis
GO:0007611learning or memory
GO:0007612learning
GO:0007613memory
GO:0007615anesthesia-resistant memory
GO:0007622rhythmic behavior
GO:0008103oocyte microtubule cytoskeleton polarization
GO:0008355olfactory learning
GO:0008359regulation of bicoid mRNA localization
GO:0016310phosphorylation
GO:0019933cAMP-mediated signaling
GO:0040040thermosensory behavior
GO:0042981regulation of apoptotic process
GO:0045187regulation of circadian sleep/wake cycle, sleep
GO:0045475locomotor rhythm
GO:0045879negative regulation of smoothened signaling pathway
GO:0048149behavioral response to ethanol
GO:0048477oogenesis
GO:0048682sprouting of injured axon
GO:0048749compound eye development
GO:0050804modulation of synaptic transmission
Vocabulary: molecular function
TermDefinition
GO:0034237protein kinase A regulatory subunit binding
GO:0005524ATP binding
GO:0004674protein serine/threonine kinase activity
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004691cAMP-dependent protein kinase activity
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000136whole organism
PLANA:0000421tail
PLANA:0007561head margin
Vocabulary: INTERPRO
TermDefinition
IPR000961AGC-kinase_C
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005952cAMP-dependent protein kinase complex
GO:0030425dendrite
GO:0044297cell body
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 228..280
e-value: 0.003
score: 26.8
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 228..280
score: 11.685
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 1..227
e-value: 1.9E-73
score: 260.0
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 1..227
e-value: 6.6E-63
score: 212.5
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 1..227
score: 42.774
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 1..212
e-value: 1.1E-27
score: 94.5
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 1..258
e-value: 7.0E-111
score: 371.8
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 57..247
e-value: 7.0E-111
score: 371.8
NoneNo IPR availablePANTHERPTHR24353:SF117PROTEIN KINASE CAMP-ACTIVATED CATALYTIC SUBUNIT BETAcoord: 1..278
NoneNo IPR availablePANTHERPTHR24353CYCLIC NUCLEOTIDE-DEPENDENT PROTEIN KINASEcoord: 1..278
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 92..104
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 1..265