RNA-binding protein 5

Overview
NameRNA-binding protein 5
Smed IDSMED30007445
Length (bp)2611
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA-binding protein 5 (SMED30007445) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA-binding protein 5 (SMED30007445) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA-binding protein 5 (SMED30007445) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA-binding protein 5 (SMED30007445) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007445

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007445SMESG000061908.1 SmedASXL_013512SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007445SMESG000061908.1 SmedASXL_013512SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30007445SMESG000061908.1 dd_Smed_v4_2392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007445SMESG000061908.1 dd_Smed_v4_2392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007445SMESG000061908.1 dd_Smed_v4_2392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30007445SMESG000061908.1 dd_Smed_v4_2392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30007445SMESG000061908.1 dd_Smed_v4_2392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007445SMESG000061908.1 Contig49117newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007445SMESG000061908.1 Contig49117uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007445SMESG000061908.1 Contig35202newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007445SMESG000061908.1 Contig35202uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30007445SMESG000061908.1 dd_Smed_v6_2392_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30007445SMESG000061908.1 dd_Smed_v6_2392_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30007445SMESG000061908.1 dd_Smed_v6_2392_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA-binding protein 5 vs. Ensembl Human
Match: RBM10 (RNA binding motif protein 10 [Source:HGNC Symbol;Acc:HGNC:9896])

HSP 1 Score: 164.466 bits (415), Expect = 3.964e-41
Identity = 124/392 (31.63%), Postives = 188/392 (47.96%), Query Frame = 1
Query: 1447 TKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQNNNSRRFEP----------EVKXXXXXXXXXXXXXXXPTFSGLVLDKAAFRNDD-------IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSF--NPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHDA 2538
            +++  PD + + +D+++ YYYDP TGLYYD NSQY+++  SQ+Y+YWD  + TY    VPA   +     +T  P  + K+ K K   K A+++ K  +         + N    F+P          E  TA A  A               +D     +DD       +VAAYSG+SD ++      P R           E+KL +W K+AC LC R F  K  L +H+ +S LHK+N+E  R      + L        +  KYRDRA ERREK+GIP PP  KR+               TA V+ +   +         SRM++ MGW +G GLG+  QG    ++A+    G+G+GA    +    ++SY+E L + M  ++++A
Sbjct:  484 SQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTY----VPALEQSADGHKETGAPSKEGKEKKEKHKTKTAQQIAKDMERWARSLNKQKENFKNSFQPISSLRDDERRESATADAGYAILEKKGALAERQHTSMDLPKLASDDRPSPPRGLVAAYSGESDSEEEQERGGPER-----------EEKLTDWQKLACLLCRRQFPSKEALIRHQQLSGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRR---------KYGGISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLGARGSSYGVTSTESYKETLHKTMVTRFNEA 851          

HSP 2 Score: 91.2781 bits (225), Expect = 3.704e-18
Identity = 59/236 (25.00%), Postives = 108/236 (45.76%), Query Frame = 1
Query:  556 LIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQ---------------------------------IGTSPC-----NTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNT 1149
            L+R+K +G SRGF FVEF  + +A RWME  Q    I   ++ + Y+  +    P  +       DW C +CG  NFKRR+ C+KC + K++++  +      DQ                                  G+ P      +T+ILR+L+  +  D+I+  L     +      +++D  T+++R FAF++L ++  ++ +      +P     + GK + +++AK +
Sbjct:   84 LMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHYSDPK----PKINE------DWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIEAAQLLQILQALHPP--LTIDGKTINVEFAKGS 307          
BLAST of RNA-binding protein 5 vs. Ensembl Human
Match: RBM10 (RNA binding motif protein 10 [Source:HGNC Symbol;Acc:HGNC:9896])

HSP 1 Score: 164.466 bits (415), Expect = 4.016e-41
Identity = 124/392 (31.63%), Postives = 188/392 (47.96%), Query Frame = 1
Query: 1447 TKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQNNNSRRFEP----------EVKXXXXXXXXXXXXXXXPTFSGLVLDKAAFRNDD-------IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSF--NPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHDA 2538
            +++  PD + + +D+++ YYYDP TGLYYD NSQY+++  SQ+Y+YWD  + TY    VPA   +     +T  P  + K+ K K   K A+++ K  +         + N    F+P          E  TA A  A               +D     +DD       +VAAYSG+SD ++      P R           E+KL +W K+AC LC R F  K  L +H+ +S LHK+N+E  R      + L        +  KYRDRA ERREK+GIP PP  KR+               TA V+ +   +         SRM++ MGW +G GLG+  QG    ++A+    G+G+GA    +    ++SY+E L + M  ++++A
Sbjct:  485 SQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTY----VPALEQSADGHKETGAPSKEGKEKKEKHKTKTAQQIAKDMERWARSLNKQKENFKNSFQPISSLRDDERRESATADAGYAILEKKGALAERQHTSMDLPKLASDDRPSPPRGLVAAYSGESDSEEEQERGGPER-----------EEKLTDWQKLACLLCRRQFPSKEALIRHQQLSGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRR---------KYGGISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLGARGSSYGVTSTESYKETLHKTMVTRFNEA 852          

HSP 2 Score: 94.3597 bits (233), Expect = 5.055e-19
Identity = 60/237 (25.32%), Postives = 112/237 (47.26%), Query Frame = 1
Query:  556 LIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQ---------------------------------IGTSPC-----NTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            L+R+K +G SRGF FVEF  + +A RWME  Q    I   ++ + Y+  +    P  +       DW C +CG  NFKRR+ C+KC + K++++  +      DQ                                  G+ P      +T+ILR+L+  +  D+I+  L     +      +++D  T+++R FAF++L ++ E+ ++++  +  +P     + GK + +++AK +
Sbjct:   84 LMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHYSDPK----PKINE------DWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLLQILQALHPP--LTIDGKTINVEFAKGS 308          
BLAST of RNA-binding protein 5 vs. Ensembl Human
Match: RBM5 (RNA binding motif protein 5 [Source:HGNC Symbol;Acc:HGNC:9902])

HSP 1 Score: 139.043 bits (349), Expect = 3.908e-33
Identity = 80/218 (36.70%), Postives = 122/218 (55.96%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNME-QLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKY 2529
            +VAAYSGDSD+++ +              L+ EE+KL +W KMAC LC R F +K  L +H+ +SDLHK+NM+   R +L   +  +     +  KYRDRA ERREK+GIP PP  KRK           +      VN +   K         ++M++ MGW +G GLG+  QG T  ++A+    GAG+GA    +  + +DSY++ +++AM+A++
Sbjct:  616 LVAAYSGDSDNEEELVER-----------LESEEEKLADWKKMACLLCRRQFPNKDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRK-----------KQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARF 811          

HSP 2 Score: 107.457 bits (267), Expect = 3.451e-23
Identity = 68/247 (27.53%), Postives = 128/247 (51.82%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSK-----SVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNTFNTIMQS 1170
            E+ + T+MLRG+   ++E+++R  +            +  +KTG+SRGF FVEF  + +A  WME  Q   VI    + + Y++ R    P  +       DW C +C  +NF++R  C++C   K  S+        E++   D      C+T+ILR++   T+ D+I+  L     + V    +++D  T+ +R FAFV+L S  ++ ++++  ++ +P    ++ GK + +D+AK+    ++ S
Sbjct:   94 ERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPR----PKFE-------DWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYY----CDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPP--LKIDGKTIGVDFAKSARKDLVLS 323          

HSP 3 Score: 85.5001 bits (210), Expect = 2.399e-16
Identity = 35/68 (51.47%), Postives = 50/68 (73.53%), Query Frame = 1
Query: 1414 ANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            A+P  +  +  TK+  PDT+ + +D+S+ YYYDP TGLYYD NSQY+++ L+Q+Y+YWD  K TYVP 
Sbjct:  443 ASPTGV--VPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPA 508          

HSP 4 Score: 64.3142 bits (155), Expect = 8.914e-10
Identity = 58/198 (29.29%), Postives = 98/198 (49.49%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVA-VRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYG------------------YNVKEEVDRYDAEKTNSWRYEKP------------TNTVMLRGVS-NMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQ 651
            TIM+RGLP  ITE DIR  ++  +    A VRL+K R+TG ++G AFVEF  + DA + M   + +L I G    + Y                   +  + +  R  A+K +S +   P             +T++LR ++ + + ++ + +     S  V ++RLI+DK+T  +RGF FV+  S  +A + ++  Q
Sbjct:   99 TIMLRGLPITITESDIREMMESFEGPQPADVRLMK-RKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQ 295          
BLAST of RNA-binding protein 5 vs. Ensembl Human
Match: RBM10 (RNA binding motif protein 10 [Source:HGNC Symbol;Acc:HGNC:9896])

HSP 1 Score: 122.479 bits (306), Expect = 9.349e-28
Identity = 76/222 (34.23%), Postives = 113/222 (50.90%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSF--NPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHDA 2538
            +VAAYSG+SD ++      P R           E+KL +W K+AC LC R F  K  L +H+ +S LHK+N+E  R      + L        +  KYRDRA ERREK+GIP PP  KR+               TA V+ +   +         SRM++ MGW +G GLG+  QG    ++A+    G+G+GA    +    ++SY+E L + M  ++++A
Sbjct:  728 LVAAYSGESDSEEEQERGGPER-----------EEKLTDWQKLACLLCRRQFPSKEALIRHQQLSGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRR---------KYGGISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLGARGSSYGVTSTESYKETLHKTMVTRFNEA 929          

HSP 2 Score: 102.064 bits (253), Expect = 2.191e-21
Identity = 70/272 (25.74%), Postives = 130/272 (47.79%), Query Frame = 1
Query:  451 KPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQ---------------------------------IGTSPC-----NTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            K +N VMLR +    +E+++R  +        +VRL+R+K +G SRGF FVEF  + +A RWME  Q    I   ++ + Y+  +    P  +       DW C +CG  NFKRR+ C+KC + K++++  +      DQ                                  G+ P      +T+ILR+L+  +  D+I+  L     +      +++D  T+++R FAF++L ++ E+ ++++  +  +P     + GK + +++AK +
Sbjct:  126 KASNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHYSDPK----PKINE------DWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLLQILQALHPP--LTIDGKTINVEFAKGS 385          

HSP 3 Score: 75.485 bits (184), Expect = 2.841e-13
Identity = 28/57 (49.12%), Postives = 43/57 (75.44%), Query Frame = 1
Query: 1447 TKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            +++  PD + + +D+++ YYYDP TGLYYD NSQY+++  SQ+Y+YWD  + TYVP 
Sbjct:  562 SQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTYVPA 618          

HSP 4 Score: 58.5362 bits (140), Expect = 5.682e-8
Identity = 29/78 (37.18%), Postives = 42/78 (53.85%), Query Frame = 1
Query:  151 NTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSY 384
            N +M+R LP   TEDDIR  L         VRL++++ +G ++G AFVEF  + DA   M   +  L+I G    + Y
Sbjct:  129 NIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHY 206          
BLAST of RNA-binding protein 5 vs. Ensembl Human
Match: RBM10 (RNA binding motif protein 10 [Source:HGNC Symbol;Acc:HGNC:9896])

HSP 1 Score: 122.094 bits (305), Expect = 1.403e-27
Identity = 76/222 (34.23%), Postives = 113/222 (50.90%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSF--NPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHDA 2538
            +VAAYSG+SD ++      P R           E+KL +W K+AC LC R F  K  L +H+ +S LHK+N+E  R      + L        +  KYRDRA ERREK+GIP PP  KR+               TA V+ +   +         SRM++ MGW +G GLG+  QG    ++A+    G+G+GA    +    ++SY+E L + M  ++++A
Sbjct:  793 LVAAYSGESDSEEEQERGGPER-----------EEKLTDWQKLACLLCRRQFPSKEALIRHQQLSGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRR---------KYGGISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLGARGSSYGVTSTESYKETLHKTMVTRFNEA 994          

HSP 2 Score: 101.679 bits (252), Expect = 2.677e-21
Identity = 70/272 (25.74%), Postives = 130/272 (47.79%), Query Frame = 1
Query:  451 KPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQ---------------------------------IGTSPC-----NTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            K +N VMLR +    +E+++R  +        +VRL+R+K +G SRGF FVEF  + +A RWME  Q    I   ++ + Y+  +    P  +       DW C +CG  NFKRR+ C+KC + K++++  +      DQ                                  G+ P      +T+ILR+L+  +  D+I+  L     +      +++D  T+++R FAF++L ++ E+ ++++  +  +P     + GK + +++AK +
Sbjct:  191 KASNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHYSDPK----PKINE------DWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLLQILQALHPP--LTIDGKTINVEFAKGS 450          

HSP 3 Score: 75.8702 bits (185), Expect = 2.310e-13
Identity = 28/57 (49.12%), Postives = 43/57 (75.44%), Query Frame = 1
Query: 1447 TKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            +++  PD + + +D+++ YYYDP TGLYYD NSQY+++  SQ+Y+YWD  + TYVP 
Sbjct:  627 SQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTYVPA 683          

HSP 4 Score: 58.5362 bits (140), Expect = 6.109e-8
Identity = 29/78 (37.18%), Postives = 42/78 (53.85%), Query Frame = 1
Query:  151 NTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSY 384
            N +M+R LP   TEDDIR  L         VRL++++ +G ++G AFVEF  + DA   M   +  L+I G    + Y
Sbjct:  194 NIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHY 271          
BLAST of RNA-binding protein 5 vs. Ensembl Celegans
Match: rbm-5 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:Q86NK0])

HSP 1 Score: 103.219 bits (256), Expect = 2.320e-22
Identity = 71/213 (33.33%), Postives = 99/213 (46.48%), Query Frame = 1
Query: 1966 PRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFN--------PPTKATKYRDRAKERREKFGI------------PSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVKV-SRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAA-PKFNSAPSDSYRENLKRAMYAKYHDA 2538
            PR  +   +    E  L +  K  C LC R F D   L KH   SDLH+ N+E  R + G                P      YRDRAKERR +FGI            P  PT+ R       E  + ++   A   P  E  + +R+++ MGW +GQG+GK  QG    ++AE    GAG+GAA  K       S++E  ++A+Y++YHDA
Sbjct:  489 PRKSTLQDVRDAMERALYDETKKTCMLCKRAFSDVEVLRKHVEKSDLHRNNLEAKRAEWGRETAAKLQEEEEDASAPDLPKIVYRDRAKERRRQFGIDSTGYAFDVMGGPPGPTSVRH------EETIRKVSEEASKRPLDESNIGNRLLKSMGWKEGQGVGKHAQGIVNPIEAERFVQGAGLGAAGSKMRHGAEASHKEKTRQALYSRYHDA 695          

HSP 2 Score: 82.4185 bits (202), Expect = 8.040e-16
Identity = 56/203 (27.59%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  565 DKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESE-MKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKV-QFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQ 1167
            DK T   R F FVEF +   A++WM   +G+  + +   + + Y      G P          DW CA C  +NF +R  C+KC +SK QS  + +   G   +G +PC+TL++R      L D I   L     G +V    I    +++  R FA++++ S  E++ ++     +P RI +   K V + + +++ + ++Q
Sbjct:   31 DKNTKQIRTFAFVEFSNRETAEQWMTDYEGWLTLDDGRTLAVEYAK----GDPAAG-SGNKGDDWICAHCSMNNFVKRQTCFKCEISKDQSMELEKL--GAHMVGMTPCDTLLIRG-----LPDGINNSLIFDSLGALVCLSSISMIKLSESKR-FAYLQMKSADEAKMLLNLTYKSPIRIKD---KDVQVSWCRDSMSKLIQ 217          

HSP 3 Score: 58.9214 bits (141), Expect = 1.552e-8
Identity = 22/60 (36.67%), Postives = 35/60 (58.33%), Query Frame = 1
Query: 1450 KFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPA 1629
            +++PP+   F  D +  YY DP+T   YDS + Y+F+  + ++  WD    TY PV+ PA
Sbjct:  321 RYLPPNPLTFAHDPNLGYYVDPITKFCYDSATGYYFNNATSQWCNWDLTHHTYFPVETPA 380          
BLAST of RNA-binding protein 5 vs. Ensembl Celegans
Match: rbm-5 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:Q86NK0])

HSP 1 Score: 103.219 bits (256), Expect = 2.320e-22
Identity = 71/213 (33.33%), Postives = 99/213 (46.48%), Query Frame = 1
Query: 1966 PRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFN--------PPTKATKYRDRAKERREKFGI------------PSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVKV-SRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAA-PKFNSAPSDSYRENLKRAMYAKYHDA 2538
            PR  +   +    E  L +  K  C LC R F D   L KH   SDLH+ N+E  R + G                P      YRDRAKERR +FGI            P  PT+ R       E  + ++   A   P  E  + +R+++ MGW +GQG+GK  QG    ++AE    GAG+GAA  K       S++E  ++A+Y++YHDA
Sbjct:  489 PRKSTLQDVRDAMERALYDETKKTCMLCKRAFSDVEVLRKHVEKSDLHRNNLEAKRAEWGRETAAKLQEEEEDASAPDLPKIVYRDRAKERRRQFGIDSTGYAFDVMGGPPGPTSVRH------EETIRKVSEEASKRPLDESNIGNRLLKSMGWKEGQGVGKHAQGIVNPIEAERFVQGAGLGAAGSKMRHGAEASHKEKTRQALYSRYHDA 695          

HSP 2 Score: 82.4185 bits (202), Expect = 8.040e-16
Identity = 56/203 (27.59%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  565 DKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESE-MKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKV-QFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQ 1167
            DK T   R F FVEF +   A++WM   +G+  + +   + + Y      G P          DW CA C  +NF +R  C+KC +SK QS  + +   G   +G +PC+TL++R      L D I   L     G +V    I    +++  R FA++++ S  E++ ++     +P RI +   K V + + +++ + ++Q
Sbjct:   31 DKNTKQIRTFAFVEFSNRETAEQWMTDYEGWLTLDDGRTLAVEYAK----GDPAAG-SGNKGDDWICAHCSMNNFVKRQTCFKCEISKDQSMELEKL--GAHMVGMTPCDTLLIRG-----LPDGINNSLIFDSLGALVCLSSISMIKLSESKR-FAYLQMKSADEAKMLLNLTYKSPIRIKD---KDVQVSWCRDSMSKLIQ 217          

HSP 3 Score: 58.9214 bits (141), Expect = 1.552e-8
Identity = 22/60 (36.67%), Postives = 35/60 (58.33%), Query Frame = 1
Query: 1450 KFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPA 1629
            +++PP+   F  D +  YY DP+T   YDS + Y+F+  + ++  WD    TY PV+ PA
Sbjct:  321 RYLPPNPLTFAHDPNLGYYVDPITKFCYDSATGYYFNNATSQWCNWDLTHHTYFPVETPA 380          
BLAST of RNA-binding protein 5 vs. Ensembl Celegans
Match: rbm-5 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:Q86NK0])

HSP 1 Score: 102.449 bits (254), Expect = 4.870e-22
Identity = 71/213 (33.33%), Postives = 99/213 (46.48%), Query Frame = 1
Query: 1966 PRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFN--------PPTKATKYRDRAKERREKFGI------------PSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVKV-SRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAA-PKFNSAPSDSYRENLKRAMYAKYHDA 2538
            PR  +   +    E  L +  K  C LC R F D   L KH   SDLH+ N+E  R + G                P      YRDRAKERR +FGI            P  PT+ R       E  + ++   A   P  E  + +R+++ MGW +GQG+GK  QG    ++AE    GAG+GAA  K       S++E  ++A+Y++YHDA
Sbjct:  632 PRKSTLQDVRDAMERALYDETKKTCMLCKRAFSDVEVLRKHVEKSDLHRNNLEAKRAEWGRETAAKLQEEEEDASAPDLPKIVYRDRAKERRRQFGIDSTGYAFDVMGGPPGPTSVRH------EETIRKVSEEASKRPLDESNIGNRLLKSMGWKEGQGVGKHAQGIVNPIEAERFVQGAGLGAAGSKMRHGAEASHKEKTRQALYSRYHDA 838          

HSP 2 Score: 82.8037 bits (203), Expect = 5.793e-16
Identity = 56/203 (27.59%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  565 DKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESE-MKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKV-QFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQ 1167
            DK T   R F FVEF +   A++WM   +G+  + +   + + Y      G P          DW CA C  +NF +R  C+KC +SK QS  + +   G   +G +PC+TL++R      L D I   L     G +V    I    +++  R FA++++ S  E++ ++     +P RI +   K V + + +++ + ++Q
Sbjct:  174 DKNTKQIRTFAFVEFSNRETAEQWMTDYEGWLTLDDGRTLAVEYAK----GDPAAG-SGNKGDDWICAHCSMNNFVKRQTCFKCEISKDQSMELEKL--GAHMVGMTPCDTLLIRG-----LPDGINNSLIFDSLGALVCLSSISMIKLSESKR-FAYLQMKSADEAKMLLNLTYKSPIRIKD---KDVQVSWCRDSMSKLIQ 360          

HSP 3 Score: 58.5362 bits (140), Expect = 1.743e-8
Identity = 22/60 (36.67%), Postives = 35/60 (58.33%), Query Frame = 1
Query: 1450 KFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPA 1629
            +++PP+   F  D +  YY DP+T   YDS + Y+F+  + ++  WD    TY PV+ PA
Sbjct:  464 RYLPPNPLTFAHDPNLGYYVDPITKFCYDSATGYYFNNATSQWCNWDLTHHTYFPVETPA 523          
BLAST of RNA-binding protein 5 vs. Ensembl Celegans
Match: rbm-5 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:Q86NK0])

HSP 1 Score: 102.449 bits (254), Expect = 4.870e-22
Identity = 71/213 (33.33%), Postives = 99/213 (46.48%), Query Frame = 1
Query: 1966 PRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFN--------PPTKATKYRDRAKERREKFGI------------PSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVKV-SRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAA-PKFNSAPSDSYRENLKRAMYAKYHDA 2538
            PR  +   +    E  L +  K  C LC R F D   L KH   SDLH+ N+E  R + G                P      YRDRAKERR +FGI            P  PT+ R       E  + ++   A   P  E  + +R+++ MGW +GQG+GK  QG    ++AE    GAG+GAA  K       S++E  ++A+Y++YHDA
Sbjct:  632 PRKSTLQDVRDAMERALYDETKKTCMLCKRAFSDVEVLRKHVEKSDLHRNNLEAKRAEWGRETAAKLQEEEEDASAPDLPKIVYRDRAKERRRQFGIDSTGYAFDVMGGPPGPTSVRH------EETIRKVSEEASKRPLDESNIGNRLLKSMGWKEGQGVGKHAQGIVNPIEAERFVQGAGLGAAGSKMRHGAEASHKEKTRQALYSRYHDA 838          

HSP 2 Score: 82.8037 bits (203), Expect = 5.793e-16
Identity = 56/203 (27.59%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  565 DKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESE-MKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKV-QFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQ 1167
            DK T   R F FVEF +   A++WM   +G+  + +   + + Y      G P          DW CA C  +NF +R  C+KC +SK QS  + +   G   +G +PC+TL++R      L D I   L     G +V    I    +++  R FA++++ S  E++ ++     +P RI +   K V + + +++ + ++Q
Sbjct:  174 DKNTKQIRTFAFVEFSNRETAEQWMTDYEGWLTLDDGRTLAVEYAK----GDPAAG-SGNKGDDWICAHCSMNNFVKRQTCFKCEISKDQSMELEKL--GAHMVGMTPCDTLLIRG-----LPDGINNSLIFDSLGALVCLSSISMIKLSESKR-FAYLQMKSADEAKMLLNLTYKSPIRIKD---KDVQVSWCRDSMSKLIQ 360          

HSP 3 Score: 58.5362 bits (140), Expect = 1.743e-8
Identity = 22/60 (36.67%), Postives = 35/60 (58.33%), Query Frame = 1
Query: 1450 KFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPA 1629
            +++PP+   F  D +  YY DP+T   YDS + Y+F+  + ++  WD    TY PV+ PA
Sbjct:  464 RYLPPNPLTFAHDPNLGYYVDPITKFCYDSATGYYFNNATSQWCNWDLTHHTYFPVETPA 523          
BLAST of RNA-binding protein 5 vs. Ensembl Celegans
Match: rbm-5 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:Q86NK0])

HSP 1 Score: 102.449 bits (254), Expect = 5.934e-22
Identity = 71/213 (33.33%), Postives = 99/213 (46.48%), Query Frame = 1
Query: 1966 PRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFN--------PPTKATKYRDRAKERREKFGI------------PSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVKV-SRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAA-PKFNSAPSDSYRENLKRAMYAKYHDA 2538
            PR  +   +    E  L +  K  C LC R F D   L KH   SDLH+ N+E  R + G                P      YRDRAKERR +FGI            P  PT+ R       E  + ++   A   P  E  + +R+++ MGW +GQG+GK  QG    ++AE    GAG+GAA  K       S++E  ++A+Y++YHDA
Sbjct:  718 PRKSTLQDVRDAMERALYDETKKTCMLCKRAFSDVEVLRKHVEKSDLHRNNLEAKRAEWGRETAAKLQEEEEDASAPDLPKIVYRDRAKERRRQFGIDSTGYAFDVMGGPPGPTSVRH------EETIRKVSEEASKRPLDESNIGNRLLKSMGWKEGQGVGKHAQGIVNPIEAERFVQGAGLGAAGSKMRHGAEASHKEKTRQALYSRYHDA 924          

HSP 2 Score: 83.1889 bits (204), Expect = 5.111e-16
Identity = 56/203 (27.59%), Postives = 98/203 (48.28%), Query Frame = 1
Query:  565 DKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESE-MKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKV-QFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQ 1167
            DK T   R F FVEF +   A++WM   +G+  + +   + + Y      G P          DW CA C  +NF +R  C+KC +SK QS  + +   G   +G +PC+TL++R      L D I   L     G +V    I    +++  R FA++++ S  E++ ++     +P RI +   K V + + +++ + ++Q
Sbjct:  260 DKNTKQIRTFAFVEFSNRETAEQWMTDYEGWLTLDDGRTLAVEYAK----GDPAAG-SGNKGDDWICAHCSMNNFVKRQTCFKCEISKDQSMELEKL--GAHMVGMTPCDTLLIRG-----LPDGINNSLIFDSLGALVCLSSISMIKLSESKR-FAYLQMKSADEAKMLLNLTYKSPIRIKD---KDVQVSWCRDSMSKLIQ 446          

HSP 3 Score: 58.151 bits (139), Expect = 2.311e-8
Identity = 22/60 (36.67%), Postives = 35/60 (58.33%), Query Frame = 1
Query: 1450 KFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPA 1629
            +++PP+   F  D +  YY DP+T   YDS + Y+F+  + ++  WD    TY PV+ PA
Sbjct:  550 RYLPPNPLTFAHDPNLGYYVDPITKFCYDSATGYYFNNATSQWCNWDLTHHTYFPVETPA 609          
BLAST of RNA-binding protein 5 vs. Ensembl Fly
Match: CG4896 (gene:FBgn0031319 transcript:FBtr0344790)

HSP 1 Score: 119.398 bits (298), Expect = 4.107e-27
Identity = 68/216 (31.48%), Postives = 113/216 (52.31%), Query Frame = 1
Query:  433 NSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETI-DGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKV---QFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKV 1068
            NS    +P N ++L G+   ++E ++   +  V      +R++R ++TG SR F FVEF ++ EA RWME  QG   +G+  + + Y+ TR               DW+C +CG  NFKRR  CY C+ S+A+S++ +    +G D+I       ++LR LDALT E+ ++  L+    +    V +  + RD +T  SR   ++   +L +S  V
Sbjct:  202 NSGSSVEPLNNIILFGLKKHVTEADIMGELIKVDLEPTSIRVMRKQQTGASRCFAFVEFKTVEEATRWMELTQGVLQLGDHRVTMQYSHTR-------------ISDWTCIKCGASNFKRRFQCYMCNASRAESENALYGAGEGVDEISQILTKKIMLRGLDALTNEEGVLTALQQRLPELAKTVSKVLVSRDALTNASRGICYLNFDTLIDSMNV 404          

HSP 2 Score: 119.398 bits (298), Expect = 4.401e-27
Identity = 76/224 (33.93%), Postives = 117/224 (52.23%), Query Frame = 1
Query: 1906 IVAAYSG--DSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKA-----TKYRDRAKERREKFGI--PSPPTNKRKYXXXXXXXXXXXXXXT---APVNPQPEVKV-SRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHDA 2538
            +V AY G  DS+DD+         +      + DE D  +++ K+ C LC R F+    L+KH  +S+LHK+N+++L+           NP  +A       YRDRAKERR K+G   P PP   R+   +  +        +       P     V SR+M+KMGW++GQGLGK NQGRTEI++A+  ++  G+G     + AP + Y+  +K+ M  +Y +A
Sbjct:  736 LVGAYGGPSDSEDDNSANQKALEASVGTKRAISDESD-YVDFQKLTCLLCMRAFQSLDILQKHLKMSNLHKENLDKLKR----------NPAVEAGTDEGLSYRDRAKERRLKYGESDPPPPNRSRERFEQEIKTLQSRQKDSFGATAAMPISSTNVGSRLMQKMGWSEGQGLGKKNQGRTEIIEADGRSNNVGLGNNTG-HMAPGNDYKSYIKKMMKQRYENA 947          

HSP 3 Score: 71.633 bits (174), Expect = 2.523e-12
Identity = 31/65 (47.69%), Postives = 47/65 (72.31%), Query Frame = 1
Query: 1450 KFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANT 1644
            K+  PD +K+ +D+++ YYYD VTGLYYD++SQY+++  +  Y+YWD  +STY    V A PA+T
Sbjct:  558 KYDTPDVSKYQYDETSGYYYDHVTGLYYDAHSQYYYNNETGAYLYWDQKRSTY----VLATPAST 618          

HSP 4 Score: 50.8322 bits (120), Expect = 5.694e-6
Identity = 49/191 (25.65%), Postives = 82/191 (42.93%), Query Frame = 1
Query:  151 NTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGY--------------NVKEEVDRYDAEKTNSWRYEKP-----------------TNTVMLRGVSNMLSENEXXXXXXXX----XXXXXXXXLIRDKKTGMSRGFGFVEFDSI 618
            N I++ GL  H+TE DI   L        ++R+++ ++TG+++  AFVEF  V +A   M  T+G L +  +   + Y +              N K    R+     N+ R E                   T  +MLRG+  + +E  V + +       +K V  V + RD  T  SRG  ++ FD++
Sbjct:  211 NNIILFGLKKHVTEADIMGELIKVDLEPTSIRVMRKQQTGASRCFAFVEFKTVEEATRWMELTQGVLQLGDHRVTMQYSHTRISDWTCIKCGASNFKR---RFQCYMCNASRAESENALYGAGEGVDEISQILTKKIMLRGLDALTNEEGVLTALQQRLPELAKTVSKVLVSRDALTNASRGICYLNFDTL 398          
BLAST of RNA-binding protein 5 vs. Ensembl Fly
Match: CG4896 (gene:FBgn0031319 transcript:FBtr0077968)

HSP 1 Score: 119.398 bits (298), Expect = 4.153e-27
Identity = 68/216 (31.48%), Postives = 113/216 (52.31%), Query Frame = 1
Query:  433 NSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETI-DGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKV---QFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKV 1068
            NS    +P N ++L G+   ++E ++   +  V      +R++R ++TG SR F FVEF ++ EA RWME  QG   +G+  + + Y+ TR               DW+C +CG  NFKRR  CY C+ S+A+S++ +    +G D+I       ++LR LDALT E+ ++  L+    +    V +  + RD +T  SR   ++   +L +S  V
Sbjct:  204 NSGSSVEPLNNIILFGLKKHVTEADIMGELIKVDLEPTSIRVMRKQQTGASRCFAFVEFKTVEEATRWMELTQGVLQLGDHRVTMQYSHTR-------------ISDWTCIKCGASNFKRRFQCYMCNASRAESENALYGAGEGVDEISQILTKKIMLRGLDALTNEEGVLTALQQRLPELAKTVSKVLVSRDALTNASRGICYLNFDTLIDSMNV 406          

HSP 2 Score: 119.398 bits (298), Expect = 4.450e-27
Identity = 76/224 (33.93%), Postives = 117/224 (52.23%), Query Frame = 1
Query: 1906 IVAAYSG--DSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKA-----TKYRDRAKERREKFGI--PSPPTNKRKYXXXXXXXXXXXXXXT---APVNPQPEVKV-SRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHDA 2538
            +V AY G  DS+DD+         +      + DE D  +++ K+ C LC R F+    L+KH  +S+LHK+N+++L+           NP  +A       YRDRAKERR K+G   P PP   R+   +  +        +       P     V SR+M+KMGW++GQGLGK NQGRTEI++A+  ++  G+G     + AP + Y+  +K+ M  +Y +A
Sbjct:  738 LVGAYGGPSDSEDDNSANQKALEASVGTKRAISDESD-YVDFQKLTCLLCMRAFQSLDILQKHLKMSNLHKENLDKLKR----------NPAVEAGTDEGLSYRDRAKERRLKYGESDPPPPNRSRERFEQEIKTLQSRQKDSFGATAAMPISSTNVGSRLMQKMGWSEGQGLGKKNQGRTEIIEADGRSNNVGLGNNTG-HMAPGNDYKSYIKKMMKQRYENA 949          

HSP 3 Score: 71.633 bits (174), Expect = 2.569e-12
Identity = 31/65 (47.69%), Postives = 47/65 (72.31%), Query Frame = 1
Query: 1450 KFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANT 1644
            K+  PD +K+ +D+++ YYYD VTGLYYD++SQY+++  +  Y+YWD  +STY    V A PA+T
Sbjct:  560 KYDTPDVSKYQYDETSGYYYDHVTGLYYDAHSQYYYNNETGAYLYWDQKRSTY----VLATPAST 620          

HSP 4 Score: 50.8322 bits (120), Expect = 5.601e-6
Identity = 49/191 (25.65%), Postives = 82/191 (42.93%), Query Frame = 1
Query:  151 NTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGY--------------NVKEEVDRYDAEKTNSWRYEKP-----------------TNTVMLRGVSNMLSENEXXXXXXXX----XXXXXXXXLIRDKKTGMSRGFGFVEFDSI 618
            N I++ GL  H+TE DI   L        ++R+++ ++TG+++  AFVEF  V +A   M  T+G L +  +   + Y +              N K    R+     N+ R E                   T  +MLRG+  + +E  V + +       +K V  V + RD  T  SRG  ++ FD++
Sbjct:  213 NNIILFGLKKHVTEADIMGELIKVDLEPTSIRVMRKQQTGASRCFAFVEFKTVEEATRWMELTQGVLQLGDHRVTMQYSHTRISDWTCIKCGASNFKR---RFQCYMCNASRAESENALYGAGEGVDEISQILTKKIMLRGLDALTNEEGVLTALQQRLPELAKTVSKVLVSRDALTNASRGICYLNFDTL 400          
BLAST of RNA-binding protein 5 vs. Ensembl Fly
Match: CG4887 (gene:FBgn0031318 transcript:FBtr0077966)

HSP 1 Score: 114.39 bits (285), Expect = 1.469e-25
Identity = 69/219 (31.51%), Postives = 114/219 (52.05%), Query Frame = 1
Query: 1906 IVAAYSG--DSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGI--PSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVKVS----RMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHDA 2538
            +V AY G  DS++D+  +S     +   S     EE   +++ K+ C LC R F+    L+KH  +S LHK+N+ +L +        + +   +A  YRDRAKERR K+G   P PP   R+   +  +        +    P   +  S    R+++KMGW++GQGLG+ NQGRT+I++A+  ++  G+G        P + Y+  +K+ M  +Y +A
Sbjct:  794 LVNAYGGTSDSEEDNAASSQNTQSSAVVSGGGGAEESDYVDFHKLTCLLCKRAFQSLEILQKHLKMSTLHKENLAKLNQN-------TSSSIEEALAYRDRAKERRLKYGESDPPPPNRSRERFEQEIKTLQSRQKQSTSATPAMPISSSNVGSRLLQKMGWSEGQGLGRKNQGRTQIIEADGRSNYVGLGNKSG-QMIPGNDYKSYIKKMMKQRYENA 1004          

HSP 2 Score: 103.99 bits (258), Expect = 2.686e-22
Identity = 54/175 (30.86%), Postives = 94/175 (53.71%), Query Frame = 1
Query:  556 LIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMET-IDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVI---VKQCEIMRDDVTKVSRCFAFVELGSLSESRKV 1068
            +IR + T  SRG  FVEF+++ EA++WM+  QG   + +  + + Y+  R               DW+C +CG  NFK R +C+ C  S+  S++   +  +G D++ T     ++LR+LDALT E+A++  L++    +   V +  I RD +T+ SR   ++   +L +S  V
Sbjct:  289 IIRKQGTDSSRGIAFVEFNTVEEAKQWMDITQGVLKLNDERVSMRYSHKR-------------IQDWNCNKCGVCNFKFRFYCFVCKTSREDSETTFSSGSEGVDEVSTILTKKIMLRNLDALTNEEAVLTALQLHLKDLSKTVSKVLISRDSLTQASRGICYLHFDTLVDSMNV 450          

HSP 3 Score: 67.3958 bits (163), Expect = 5.243e-11
Identity = 30/66 (45.45%), Postives = 46/66 (69.70%), Query Frame = 1
Query: 1450 KFIP-PDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANT 1644
            K  P PD T++ +D+++ YYYD  TGLYY+++SQY+++  +  Y+YWD  +STY    V A PA+T
Sbjct:  620 KIYPTPDVTQYQYDETSGYYYDSTTGLYYNAHSQYYYNNETGAYLYWDQRRSTY----VLATPAST 681          
BLAST of RNA-binding protein 5 vs. Ensembl Fly
Match: CG4887 (gene:FBgn0031318 transcript:FBtr0331288)

HSP 1 Score: 114.39 bits (285), Expect = 1.469e-25
Identity = 69/219 (31.51%), Postives = 114/219 (52.05%), Query Frame = 1
Query: 1906 IVAAYSG--DSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGI--PSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVKVS----RMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHDA 2538
            +V AY G  DS++D+  +S     +   S     EE   +++ K+ C LC R F+    L+KH  +S LHK+N+ +L +        + +   +A  YRDRAKERR K+G   P PP   R+   +  +        +    P   +  S    R+++KMGW++GQGLG+ NQGRT+I++A+  ++  G+G        P + Y+  +K+ M  +Y +A
Sbjct:  794 LVNAYGGTSDSEEDNAASSQNTQSSAVVSGGGGAEESDYVDFHKLTCLLCKRAFQSLEILQKHLKMSTLHKENLAKLNQN-------TSSSIEEALAYRDRAKERRLKYGESDPPPPNRSRERFEQEIKTLQSRQKQSTSATPAMPISSSNVGSRLLQKMGWSEGQGLGRKNQGRTQIIEADGRSNYVGLGNKSG-QMIPGNDYKSYIKKMMKQRYENA 1004          

HSP 2 Score: 103.99 bits (258), Expect = 2.686e-22
Identity = 54/175 (30.86%), Postives = 94/175 (53.71%), Query Frame = 1
Query:  556 LIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMET-IDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVI---VKQCEIMRDDVTKVSRCFAFVELGSLSESRKV 1068
            +IR + T  SRG  FVEF+++ EA++WM+  QG   + +  + + Y+  R               DW+C +CG  NFK R +C+ C  S+  S++   +  +G D++ T     ++LR+LDALT E+A++  L++    +   V +  I RD +T+ SR   ++   +L +S  V
Sbjct:  289 IIRKQGTDSSRGIAFVEFNTVEEAKQWMDITQGVLKLNDERVSMRYSHKR-------------IQDWNCNKCGVCNFKFRFYCFVCKTSREDSETTFSSGSEGVDEVSTILTKKIMLRNLDALTNEEAVLTALQLHLKDLSKTVSKVLISRDSLTQASRGICYLHFDTLVDSMNV 450          

HSP 3 Score: 67.3958 bits (163), Expect = 5.243e-11
Identity = 30/66 (45.45%), Postives = 46/66 (69.70%), Query Frame = 1
Query: 1450 KFIP-PDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANT 1644
            K  P PD T++ +D+++ YYYD  TGLYY+++SQY+++  +  Y+YWD  +STY    V A PA+T
Sbjct:  620 KIYPTPDVTQYQYDETSGYYYDSTTGLYYNAHSQYYYNNETGAYLYWDQRRSTY----VLATPAST 681          
BLAST of RNA-binding protein 5 vs. Ensembl Zebrafish
Match: rbm5 (RNA binding motif protein 5 [Source:ZFIN;Acc:ZDB-GENE-030131-3022])

HSP 1 Score: 182.57 bits (462), Expect = 3.077e-47
Identity = 133/420 (31.67%), Postives = 209/420 (49.76%), Query Frame = 1
Query: 1351 GTESGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTID-LTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQNNNSRRFEPEVKXXXXXXXXXXX-----XXXXPTFSGLVLDKAAFRNDD-------IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPT-NKRKYXXXXXXXXXXXXXXTAP---VNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKY 2529
            G    IT    ++    S+V A    I      +   PDT+ + +D+S+ YYYDP+TGLYYD N+QY+++  +Q+Y+YWD  K  Y    +PA  +N  + +  T+ P+ + K+ K K   K A+++ K  +         + N    F+P  +    + A A                LV + +    ++       +VAAYSGDS+ ++ +                D EDKL +W K+AC LC R F  K  L +H+ +SDLH++N+E +R  KL   +           KYRDRA ERREK+GIP PP   KRKY              TAP   VN +   K         ++M++ MGW +G+GLG++ QG T  ++A+    GAG+G     +N   SD+Y++ +++AM+A++
Sbjct:  440 GKAQSITATATISAPATSAVSATATAISTSQENQANVPDTSSYQYDESSGYYYDPITGLYYDPNTQYYYNSQTQQYLYWDGEKQAY----LPAVDSNAQNAMASTSTPQKEGKEKKEKPKSKTAQQIAKDMERWAKSLNKQKENFKSSFQPISQEERREAAAADAGFTLFEKKPGALERLVTEASKMAEEESCSSKVGLVAAYSGDSEPEELIDG-------------DDREDKLTDWKKLACLLCRRQFPSKEALIRHQQLSDLHRQNLEVMRRSKLSEAELEELERKETEMKYRDRAAERREKYGIPEPPVPKKRKY--------------TAPTPVVNYEQPTKDGLNSDNIGNKMLQAMGWKEGKGLGRNQQGITTPIEAQLRAKGAGLGTKGSSYNLTASDTYKDAVRKAMFARF 828          

HSP 2 Score: 95.9005 bits (237), Expect = 9.602e-20
Identity = 64/201 (31.84%), Postives = 102/201 (50.75%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQ-IGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGS 1047
            EK + T+MLRG+    SE ++R+ +  +         +  K+TG+SRGF FVEF  +  A RWME  Q    +    + + Y++ R               DW C  CG +NF+RR  C++C  +KA S+S   T   + Q  G    +T+ILR++  L+  +AI+  L     ++     +++D  T  +R FAFV+L S
Sbjct:  111 EKESKTIMLRGLPMNTSEADIRAAIDLLEGPKPMDVRLMKKRTGISRGFAFVEFYHLQAATRWMETNQKLLCVQGKPVVVHYSNNRH-----------KFEDWLCNSCGLYNFRRRLKCFRCGAAKADSESSSTTGTTETQPSGDYYGDTIILRNIAPLSTVEAILGALAPFANLLPGNIRLIKDKQTGQNRGFAFVQLAS 300          
BLAST of RNA-binding protein 5 vs. Ensembl Zebrafish
Match: rbm10 (RNA binding motif protein 10 [Source:ZFIN;Acc:ZDB-GENE-100922-245])

HSP 1 Score: 165.622 bits (418), Expect = 1.109e-41
Identity = 172/702 (24.50%), Postives = 304/702 (43.30%), Query Frame = 1
Query:  400 EEVDRYDAE-KTNSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSK--------------------------SVMETIDGKDQIGTSP------CNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSE-SRKVVEYYRNNPDRIFELSGKAVTIDYAKNT-----------------FNTIMQSYKEALAKRFEDTYEAPVHETSNYDXXXXXXXXXXXLSQKKLQKKGXXXXXXXXXXXXHGNGTESGITFDLIVNGQRISSVPAN---PFNIKAIGSTK---FIPPDTTKFLFDQSTQYYYDP---------VTGLYY--------DSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQNNNSRRFEPEVKXXXXXXXXXXXXXXXPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTR----SPSTLLKDE----EDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRK 2259
            EE + +D + ++++   +KP+N VMLR +    + NE+R+ + +      +VRL+R+K +G SRGF FVEF+ + EA RWME  Q    I    + + Y+  +    P  +       DW C +CG  NFKRR+ C+KC + K++++                          ++ +T      + +SP       +TLILR+L   T  +AI+  L     +      +++D  T+++R FAF++L ++ E S+ +       P     + GK +++++AK +                  +T + + + A+++         +       A  +   + +  ++ +  K     L + +     G  T + I        Q +SS P+      +++ IG  +    + P T     +   Q Y DP          +G YY        D NSQY+F+  +Q+Y+YWD  K TYVP   P+   ++     +  P     K    + K   +  +  E+   S     +N  S    P + T +              ++ L +  A      I+       +D +     +PP+      S  T  +DE    +++L +W K+AC LC R F  K  L +H+ +S+LH++N+EQ R +  + +T   +      KYRDRA ERREK  IP  P  K++
Sbjct:  180 EEAEVHDQDYRSDADALQKPSNIVMLRMLPLNATVNEIRARLQEQGIQPREVRLMRNKSSGQSRGFAFVEFNHLQEASRWMETNQKVLTILGQRVSMHYSDPK----PRAN------EDWLCNKCGVQNFKRREKCFKCGVPKSEAELKLPLVPKILPLCQLKDSTQGLLPLPAIFQTATSILNLSSSPQPSEAANDTLILRNLGPHTTLEAILSALAPFATLSPSNVRLIKDKQTQLNRGFAFLQLTTIVEASQLLQILQALQPP--LSIDGKLISVEFAKGSKRDVFLTDGSRVSVATVASTAIAAAQWAVSQTASGAQSGDLSVLQQGAAAFSQDGSQSRTAETQAFKGPVTTLLTPADRAVAGETTAASILTHAASQIQLVSSTPSTQDRQTSVEIIGKPQPAACVQPATPGTALE--CQQYPDPDVSTYQYDESSGYYYDPFTGLYYDPNSQYYFNPHTQQYMYWDGEKHTYVP--APSQSEDSAGNELSGAPNSSKDKKDKPKNKSAQQIAKDMERWAKSLNRQKENGRSVNTNPRLMTHSRSDDRRESASADAGYAVLEMKGALLERPQILMEQIKHPEDRE-----SPPQALLAGCSVETDSEDESSEKQERLTDWCKLACLLCRRQFPSKEALIRHQQLSELHRQNLEQKRSRTTVSNTQEGS--ETELKYRDRAAERREKGIIPQQPDAKKR 858          
BLAST of RNA-binding protein 5 vs. Ensembl Zebrafish
Match: rbm10 (RNA binding motif protein 10 [Source:ZFIN;Acc:ZDB-GENE-100922-245])

HSP 1 Score: 165.622 bits (418), Expect = 1.341e-41
Identity = 172/702 (24.50%), Postives = 304/702 (43.30%), Query Frame = 1
Query:  400 EEVDRYDAE-KTNSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSK--------------------------SVMETIDGKDQIGTSP------CNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSE-SRKVVEYYRNNPDRIFELSGKAVTIDYAKNT-----------------FNTIMQSYKEALAKRFEDTYEAPVHETSNYDXXXXXXXXXXXLSQKKLQKKGXXXXXXXXXXXXHGNGTESGITFDLIVNGQRISSVPAN---PFNIKAIGSTK---FIPPDTTKFLFDQSTQYYYDP---------VTGLYY--------DSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQNNNSRRFEPEVKXXXXXXXXXXXXXXXPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTR----SPSTLLKDE----EDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRK 2259
            EE + +D + ++++   +KP+N VMLR +    + NE+R+ + +      +VRL+R+K +G SRGF FVEF+ + EA RWME  Q    I    + + Y+  +    P  +       DW C +CG  NFKRR+ C+KC + K++++                          ++ +T      + +SP       +TLILR+L   T  +AI+  L     +      +++D  T+++R FAF++L ++ E S+ +       P     + GK +++++AK +                  +T + + + A+++         +       A  +   + +  ++ +  K     L + +     G  T + I        Q +SS P+      +++ IG  +    + P T     +   Q Y DP          +G YY        D NSQY+F+  +Q+Y+YWD  K TYVP   P+   ++     +  P     K    + K   +  +  E+   S     +N  S    P + T +              ++ L +  A      I+       +D +     +PP+      S  T  +DE    +++L +W K+AC LC R F  K  L +H+ +S+LH++N+EQ R +  + +T   +      KYRDRA ERREK  IP  P  K++
Sbjct:  191 EEAEVHDQDYRSDADALQKPSNIVMLRMLPLNATVNEIRARLQEQGIQPREVRLMRNKSSGQSRGFAFVEFNHLQEASRWMETNQKVLTILGQRVSMHYSDPK----PRAN------EDWLCNKCGVQNFKRREKCFKCGVPKSEAELKLPLVPKILPLCQLKDSTQGLLPLPAIFQTATSILNLSSSPQPSEAANDTLILRNLGPHTTLEAILSALAPFATLSPSNVRLIKDKQTQLNRGFAFLQLTTIVEASQLLQILQALQPP--LSIDGKLISVEFAKGSKRDVFLTDGSRVSVATVASTAIAAAQWAVSQTASGAQSGDLSVLQQGAAAFSQDGSQSRTAETQAFKGPVTTLLTPADRAVAGETTAASILTHAASQIQLVSSTPSTQDRQTSVEIIGKPQPAACVQPATPGTALE--CQQYPDPDVSTYQYDESSGYYYDPFTGLYYDPNSQYYFNPHTQQYMYWDGEKHTYVP--APSQSEDSAGNELSGAPNSSKDKKDKPKNKSAQQIAKDMERWAKSLNRQKENGRSVNTNPRLMTHSRSDDRRESASADAGYAVLEMKGALLERPQILMEQIKHPEDRE-----SPPQALLAGCSVETDSEDESSEKQERLTDWCKLACLLCRRQFPSKEALIRHQQLSELHRQNLEQKRSRTTVSNTQEGS--ETELKYRDRAAERREKGIIPQQPDAKKR 869          
BLAST of RNA-binding protein 5 vs. Ensembl Zebrafish
Match: rbm10 (RNA binding motif protein 10 [Source:ZFIN;Acc:ZDB-GENE-100922-245])

HSP 1 Score: 164.851 bits (416), Expect = 2.316e-41
Identity = 172/702 (24.50%), Postives = 304/702 (43.30%), Query Frame = 1
Query:  400 EEVDRYDAE-KTNSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSK--------------------------SVMETIDGKDQIGTSP------CNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSE-SRKVVEYYRNNPDRIFELSGKAVTIDYAKNT-----------------FNTIMQSYKEALAKRFEDTYEAPVHETSNYDXXXXXXXXXXXLSQKKLQKKGXXXXXXXXXXXXHGNGTESGITFDLIVNGQRISSVPAN---PFNIKAIGSTK---FIPPDTTKFLFDQSTQYYYDP---------VTGLYY--------DSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQNNNSRRFEPEVKXXXXXXXXXXXXXXXPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTR----SPSTLLKDE----EDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRK 2259
            EE + +D + ++++   +KP+N VMLR +    + NE+R+ + +      +VRL+R+K +G SRGF FVEF+ + EA RWME  Q    I    + + Y+  +    P  +       DW C +CG  NFKRR+ C+KC + K++++                          ++ +T      + +SP       +TLILR+L   T  +AI+  L     +      +++D  T+++R FAF++L ++ E S+ +       P     + GK +++++AK +                  +T + + + A+++         +       A  +   + +  ++ +  K     L + +     G  T + I        Q +SS P+      +++ IG  +    + P T     +   Q Y DP          +G YY        D NSQY+F+  +Q+Y+YWD  K TYVP   P+   ++     +  P     K    + K   +  +  E+   S     +N  S    P + T +              ++ L +  A      I+       +D +     +PP+      S  T  +DE    +++L +W K+AC LC R F  K  L +H+ +S+LH++N+EQ R +  + +T   +      KYRDRA ERREK  IP  P  K++
Sbjct:  191 EEAEVHDQDYRSDADALQKPSNIVMLRMLPLNATVNEIRARLQEQGIQPREVRLMRNKSSGQSRGFAFVEFNHLQEASRWMETNQKVLTILGQRVSMHYSDPK----PRAN------EDWLCNKCGVQNFKRREKCFKCGVPKSEAELKLPLVPKILPLCQLKDSTQGLLPLPAIFQTATSILNLSSSPQPSEAANDTLILRNLGPHTTLEAILSALAPFATLSPSNVRLIKDKQTQLNRGFAFLQLTTIVEASQLLQILQALQPP--LSIDGKLISVEFAKGSKRDVFLTDGSRVSVATVASTAIAAAQWAVSQTASGAQSGDLSVLQQGAAAFSQDGSQSRTAETQAFKGPVTTLLTPADRAVAGETTAASILTHAASQIQLVSSTPSTQDRQTSVEIIGKPQPAACVQPATPGTALE--CQQYPDPDVSTYQYDESSGYYYDPFTGLYYDPNSQYYFNPHTQQYMYWDGEKHTYVP--APSQSEDSAGNELSGAPNSSKDKKDKPKNKSAQQIAKDMERWAKSLNRQKENGRSVNTNPRLMTHSRSDDRRESASADAGYAVLEMKGALLERPQILMEQIKHPEDRE-----SPPQALLAGCSVETDSEDESSEKQERLTDWCKLACLLCRRQFPSKEALIRHQQLSELHRQNLEQKRSRTTVSNTQEGS--ETELKYRDRAAERREKGIIPQQPDAKKR 869          
BLAST of RNA-binding protein 5 vs. Ensembl Zebrafish
Match: rbm10 (RNA binding motif protein 10 [Source:ZFIN;Acc:ZDB-GENE-100922-245])

HSP 1 Score: 124.02 bits (310), Expect = 2.028e-28
Identity = 89/291 (30.58%), Postives = 140/291 (48.11%), Query Frame = 1
Query: 1411 PANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQNNNSRRFEPEVKXXXXXXXXXXXXXXXPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTR----SPSTLLKDE----EDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRK 2259
            PA P    A+   ++  PD + + +D+S+ YYYDP TGLYYD NSQY+F+  +Q+Y+YWD  K TYVP   P+   ++     +  P     K    + K   +  +  E+   S     +N  S    P + T +              ++ L +  A      I+       +D +     +PP+      S  T  +DE    +++L +W K+AC LC R F  K  L +H+ +S+LH++N+EQ R +  + +T   +      KYRDRA ERREK  IP  P  K++
Sbjct:  590 PATPGT--ALECQQYPDPDVSTYQYDESSGYYYDPFTGLYYDPNSQYYFNPHTQQYMYWDGEKHTYVP--APSQSEDSAGNELSGAPNSSKDKKDKPKNKSAQQIAKDMERWAKSLNRQKENGRSVNTNPRLMTHSRSDDRRESASADAGYAVLEMKGALLERPQILMEQIKHPEDRE-----SPPQALLAGCSVETDSEDESSEKQERLTDWCKLACLLCRRQFPSKEALIRHQQLSELHRQNLEQKRSRTTVSNTQEGS--ETELKYRDRAAERREKGIIPQQPDAKKR 869          

HSP 2 Score: 107.842 bits (268), Expect = 2.171e-23
Identity = 78/284 (27.46%), Postives = 141/284 (49.65%), Query Frame = 1
Query:  400 EEVDRYDAE-KTNSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSK--------------------------SVMETIDGKDQIGTSP------CNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSE-SRKVVEYYRNNPDRIFELSGKAVTIDYAKNT 1149
            EE + +D + ++++   +KP+N VMLR +    + NE+R+ + +      +VRL+R+K +G SRGF FVEF+ + EA RWME  Q    I    + + Y+  +    P  +       DW C +CG  NFKRR+ C+KC + K++++                          ++ +T      + +SP       +TLILR+L   T  +AI+  L     +      +++D  T+++R FAF++L ++ E S+ +       P     + GK +++++AK +
Sbjct:  191 EEAEVHDQDYRSDADALQKPSNIVMLRMLPLNATVNEIRARLQEQGIQPREVRLMRNKSSGQSRGFAFVEFNHLQEASRWMETNQKVLTILGQRVSMHYSDPK----PRAN------EDWLCNKCGVQNFKRREKCFKCGVPKSEAELKLPLVPKILPLCQLKDSTQGLLPLPAIFQTATSILNLSSSPQPSEAANDTLILRNLGPHTTLEAILSALAPFATLSPSNVRLIKDKQTQLNRGFAFLQLTTIVEASQLLQILQALQPP--LSIDGKLISVEFAKGS 462          
BLAST of RNA-binding protein 5 vs. Ensembl Xenopus
Match: rbm5 (RNA binding motif protein 5 [Source:NCBI gene;Acc:550032])

HSP 1 Score: 171.4 bits (433), Expect = 1.263e-43
Identity = 115/391 (29.41%), Postives = 191/391 (48.85%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHETSNYDXXXXXXXXXXXLSQKKLQKKGXXXXXXXXXXXXHGNGTESGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            EK + T+MLRG+   ++EN++R  V            +  +KTG+SRGF FVEF  + +A RWME  Q   VI    + + Y++ R    P  +       DW C +CG +NF+RR  C++C  +KA  +       G   +G    + +ILR++   T+ D+I+  L     ++V    +++D  T+ +R FAFV+L S  E+ ++++  +  +P    ++ GK V +D+AK+    ++            D +       ++       A+A A  S  + Q+ G     +       G       + D              PF     G+ +   PDT+ + +D+S+ YYYDP TGLYYD NSQY+++ L+Q+Y+YWD  K TY+P 
Sbjct:  116 EKESKTIMLRGLPININENDIRELVESFEGPQPADVRLMKRKTGLSRGFAFVEFYHLQDATRWMEANQKKLVIQGKTIAMHYSNPR----PKFE-------DWLCNKCGLYNFRRRLKCFRCGAAKAGEQL------GVTLLGGYVSSAIILRNIGPHTVVDSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLEASQLLQILQTLHPP--LKIDGKTVGVDFAKSARKDLV----------LPDGHRVSAFSVAS------TAIAAAQWSSTQAQQSGEGGEYAYLQPGQEGYANYGQCSQDY------------QPFYQAQTGAAEQTVPDTSTYQYDESSGYYYDPQTGLYYDPNSQYYYNSLTQQYLYWDGEKQTYLPA 459          

HSP 2 Score: 140.969 bits (354), Expect = 7.662e-34
Identity = 81/220 (36.82%), Postives = 122/220 (55.45%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHD 2535
            +VAAYSGDSD+++           S   L   +E+KL++W K+AC LC R F +K  L +H+ +SDLHK+N+E  R  K+   +  +     +  KYRDRA ERREK+GIP PP  KRK                  VN +   K         ++M++ MGW +G GLG+ +QG T  +QA+    GAG+GA    +    SDSY++ +++AM+A++ +
Sbjct:  561 LVAAYSGDSDNEE----------ESERLLGAVDEEKLLDWKKLACLLCRRQFPNKDALTRHQQLSDLHKQNLEVYRRSKMSEQELEALELKEREAKYRDRAAERREKYGIPEPPEPKRK------------RFDPTVVNYEQPTKDGIDNSNIGNKMLQAMGWKEGSGLGRKSQGITAPIQAQVRMRGAGLGAKGSSYGVNTSDSYKDAVRKAMFARFSE 758          

HSP 3 Score: 61.2326 bits (147), Expect = 5.927e-9
Identity = 55/192 (28.65%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVA-VRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEK------------------------PTNTVMLRGVS-NMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQ 651
            TIM+RGLP +I E+DIR  ++  +    A VRL+K R+TG ++G AFVEF  + DA   M   + +L I G    + Y  N + + + +   K   + + +                         ++ ++LR +  + + ++ + +    VS  V ++RLI+DK+T  +RGF FV+  S  EA + ++  Q
Sbjct:  121 TIMLRGLPININENDIRELVESFEGPQPADVRLMK-RKTGLSRGFAFVEFYHLQDATRWMEANQKKLVIQGKTIAMHYS-NPRPKFEDWLCNKCGLYNFRRRLKCFRCGAAKAGEQLGVTLLGGYVSSAIILRNIGPHTVVDSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLEASQLLQILQ 310          
BLAST of RNA-binding protein 5 vs. Ensembl Xenopus
Match: rbm5 (RNA binding motif protein 5 [Source:NCBI gene;Acc:550032])

HSP 1 Score: 145.976 bits (367), Expect = 2.362e-35
Identity = 112/414 (27.05%), Postives = 193/414 (46.62%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNTF-NTIMQSYKEALAKRFEDTYEAPVHETSNYDXXXXXXXXXXXLSQKKLQKKGX--------XXXXXXXXXXXHGNGTESGITFDLIVNGQRISSVPANPFN--IKAIGSTKFIPPDT----TKFLFDQSTQYYYD--------PVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            EK + T+MLRG+   ++EN++R  V            +  +KTG+SRGF FVEF  + +A RWME  Q   VI    + + Y++ R    P  +       DW C +CG +NF+RR  C++C  +KA  +       G   +G    + +ILR++   T+ D+I+  L     ++V    +++D  T+ +R FAFV+L S  E+ ++++  +  +P    ++ GK V +D+AK+   + ++       A     T  A    +S   +      A+    Q+     G             + ++  S G+      T  ++    ++   P +P         + +  PP+      K+    ++ Y YD        P TGLYYD NSQY+++ L+Q+Y+YWD  K TY+P 
Sbjct:   95 EKESKTIMLRGLPININENDIRELVESFEGPQPADVRLMKRKTGLSRGFAFVEFYHLQDATRWMEANQKKLVIQGKTIAMHYSNPR----PKFE-------DWLCNKCGLYNFRRRLKCFRCGAAKAGEQL------GVTLLGGYVSSAIILRNIGPHTVVDSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLEASQLLQILQTLHPP--LKIDGKTVGVDFAKSARKDLVLPDGHRVSAFSVASTAIAAAQWSSTQQSGEGGEYAYLQPGQEGYANYGQCSQDYQPFYQAQTGAAEQSTGSAPVPATTSAVVCQSPQMYQQPGSPTQSASTTSTTEEAAPPNAVIPGVKYSVPDTSTYQYDESSGYYYDPQTGLYYDPNSQYYYNSLTQQYLYWDGEKQTYLPA 489          

HSP 2 Score: 140.969 bits (354), Expect = 8.496e-34
Identity = 82/223 (36.77%), Postives = 123/223 (55.16%), Query Frame = 1
Query: 1897 NDDIVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHD 2535
            N  +VAAYSGDSD+++           S   L   +E+KL++W K+AC LC R F +K  L +H+ +SDLHK+N+E  R  K+   +  +     +  KYRDRA ERREK+GIP PP  KRK                  VN +   K         ++M++ MGW +G GLG+ +QG T  +QA+    GAG+GA    +    SDSY++ +++AM+A++ +
Sbjct:  600 NKALVAAYSGDSDNEE----------ESERLLGAVDEEKLLDWKKLACLLCRRQFPNKDALTRHQQLSDLHKQNLEVYRRSKMSEQELEALELKEREAKYRDRAAERREKYGIPEPPEPKRK------------RFDPTVVNYEQPTKDGIDNSNIGNKMLQAMGWKEGSGLGRKSQGITAPIQAQVRMRGAGLGAKGSSYGVNTSDSYKDAVRKAMFARFSE 800          

HSP 3 Score: 61.6178 bits (148), Expect = 4.622e-9
Identity = 55/192 (28.65%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVA-VRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEK------------------------PTNTVMLRGVS-NMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQ 651
            TIM+RGLP +I E+DIR  ++  +    A VRL+K R+TG ++G AFVEF  + DA   M   + +L I G    + Y  N + + + +   K   + + +                         ++ ++LR +  + + ++ + +    VS  V ++RLI+DK+T  +RGF FV+  S  EA + ++  Q
Sbjct:  100 TIMLRGLPININENDIRELVESFEGPQPADVRLMK-RKTGLSRGFAFVEFYHLQDATRWMEANQKKLVIQGKTIAMHYS-NPRPKFEDWLCNKCGLYNFRRRLKCFRCGAAKAGEQLGVTLLGGYVSSAIILRNIGPHTVVDSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLEASQLLQILQ 289          
BLAST of RNA-binding protein 5 vs. Ensembl Xenopus
Match: rbm5 (RNA binding motif protein 5 [Source:NCBI gene;Acc:550032])

HSP 1 Score: 141.354 bits (355), Expect = 4.472e-34
Identity = 81/220 (36.82%), Postives = 122/220 (55.45%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHD 2535
            +VAAYSGDSD+++           S   L   +E+KL++W K+AC LC R F +K  L +H+ +SDLHK+N+E  R  K+   +  +     +  KYRDRA ERREK+GIP PP  KRK                  VN +   K         ++M++ MGW +G GLG+ +QG T  +QA+    GAG+GA    +    SDSY++ +++AM+A++ +
Sbjct:  494 LVAAYSGDSDNEE----------ESERLLGAVDEEKLLDWKKLACLLCRRQFPNKDALTRHQQLSDLHKQNLEVYRRSKMSEQELEALELKEREAKYRDRAAERREKYGIPEPPEPKRK------------RFDPTVVNYEQPTKDGIDNSNIGNKMLQAMGWKEGSGLGRKSQGITAPIQAQVRMRGAGLGAKGSSYGVNTSDSYKDAVRKAMFARFSE 691          

HSP 2 Score: 109.383 bits (272), Expect = 6.775e-24
Identity = 76/265 (28.68%), Postives = 129/265 (48.68%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGS-------------------LSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNTFNTIMQSYKEA 1182
            EK + T+MLRG+   ++EN++R  V            +  +KTG+SRGF FVEF  + +A RWME  Q   VI    + + Y++ R    P  +       DW C +CG +NF+RR  C++C  +KA  +       G   +G    + +ILR++   T+ D+I+  L     ++V    +++D  T+ +R FAFV+L S                     E+ ++++  +  +P    ++ GK V +D+AK   +T    Y E+
Sbjct:  103 EKESKTIMLRGLPININENDIRELVESFEGPQPADVRLMKRKTGLSRGFAFVEFYHLQDATRWMEANQKKLVIQGKTIAMHYSNPR----PKFE-------DWLCNKCGLYNFRRRLKCFRCGAAKAGEQL------GVTLLGGYVSSAIILRNIGPHTVVDSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLVSCPNLTLVLLLSSPLFYQEASQLLQILQTLHPP--LKIDGKTVGVDFAKTVPDTSTYQYDES 348          

HSP 3 Score: 78.1814 bits (191), Expect = 3.919e-14
Identity = 30/52 (57.69%), Postives = 42/52 (80.77%), Query Frame = 1
Query: 1462 PDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            PDT+ + +D+S+ YYYDP TGLYYD NSQY+++ L+Q+Y+YWD  K TY+P 
Sbjct:  338 PDTSTYQYDESSGYYYDPQTGLYYDPNSQYYYNSLTQQYLYWDGEKQTYLPA 389          

HSP 4 Score: 58.151 bits (139), Expect = 6.219e-8
Identity = 52/180 (28.89%), Postives = 90/180 (50.00%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVA-VRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEK------------------------PTNTVMLRGVS-NMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDS 615
            TIM+RGLP +I E+DIR  ++  +    A VRL+K R+TG ++G AFVEF  + DA   M   + +L I G    + Y  N + + + +   K   + + +                         ++ ++LR +  + + ++ + +    VS  V ++RLI+DK+T  +RGF FV+  S
Sbjct:  108 TIMLRGLPININENDIRELVESFEGPQPADVRLMK-RKTGLSRGFAFVEFYHLQDATRWMEANQKKLVIQGKTIAMHYS-NPRPKFEDWLCNKCGLYNFRRRLKCFRCGAAKAGEQLGVTLLGGYVSSAIILRNIGPHTVVDSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPS 285          
BLAST of RNA-binding protein 5 vs. Ensembl Xenopus
Match: rbm5 (RNA binding motif protein 5 [Source:NCBI gene;Acc:550032])

HSP 1 Score: 140.969 bits (354), Expect = 4.781e-34
Identity = 81/220 (36.82%), Postives = 122/220 (55.45%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHD 2535
            +VAAYSGDSD+++           S   L   +E+KL++W K+AC LC R F +K  L +H+ +SDLHK+N+E  R  K+   +  +     +  KYRDRA ERREK+GIP PP  KRK                  VN +   K         ++M++ MGW +G GLG+ +QG T  +QA+    GAG+GA    +    SDSY++ +++AM+A++ +
Sbjct:  450 LVAAYSGDSDNEE----------ESERLLGAVDEEKLLDWKKLACLLCRRQFPNKDALTRHQQLSDLHKQNLEVYRRSKMSEQELEALELKEREAKYRDRAAERREKYGIPEPPEPKRK------------RFDPTVVNYEQPTKDGIDNSNIGNKMLQAMGWKEGSGLGRKSQGITAPIQAQVRMRGAGLGAKGSSYGVNTSDSYKDAVRKAMFARFSE 647          

HSP 2 Score: 105.145 bits (261), Expect = 1.184e-22
Identity = 71/245 (28.98%), Postives = 121/245 (49.39%), Query Frame = 1
Query:  469 MLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQS-----------------KSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            MLRG+   ++EN++R  V            +  +KTG+SRGF FVEF  + +A RWME  Q   VI    + + Y++ R    P  +       DW C +CG +NF+RR  C++C  +KA+                  K       G   +G    + +ILR++   T+ D+I+  L     ++V    +++D  T+ +R FAFV+L S  E+ ++++  +  +P    ++ GK V +D+AK+ 
Sbjct:    1 MLRGLPININENDIRELVESFEGPQPADVRLMKRKTGLSRGFAFVEFYHLQDATRWMEANQKKLVIQGKTIAMHYSNPR----PKFE-------DWLCNKCGLYNFRRRLKCFRCGAAKAEKNLGVYIFFKCWVCGLPWKLPFYRQLGVTLLGGYVSSAIILRNIGPHTVVDSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLEASQLLQILQTLHPP--LKIDGKTVGVDFAKSA 232          

HSP 3 Score: 78.1814 bits (191), Expect = 3.502e-14
Identity = 30/52 (57.69%), Postives = 42/52 (80.77%), Query Frame = 1
Query: 1462 PDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            PDT+ + +D+S+ YYYDP TGLYYD NSQY+++ L+Q+Y+YWD  K TY+P 
Sbjct:  302 PDTSTYQYDESSGYYYDPQTGLYYDPNSQYYYNSLTQQYLYWDGEKQTYLPA 353          
BLAST of RNA-binding protein 5 vs. Ensembl Xenopus
Match: rbm5 (RNA binding motif protein 5 [Source:NCBI gene;Acc:550032])

HSP 1 Score: 141.354 bits (355), Expect = 8.262e-34
Identity = 82/223 (36.77%), Postives = 123/223 (55.16%), Query Frame = 1
Query: 1897 NDDIVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHD 2535
            N  +VAAYSGDSD+++           S   L   +E+KL++W K+AC LC R F +K  L +H+ +SDLHK+N+E  R  K+   +  +     +  KYRDRA ERREK+GIP PP  KRK                  VN +   K         ++M++ MGW +G GLG+ +QG T  +QA+    GAG+GA    +    SDSY++ +++AM+A++ +
Sbjct:  616 NKALVAAYSGDSDNEE----------ESERLLGAVDEEKLLDWKKLACLLCRRQFPNKDALTRHQQLSDLHKQNLEVYRRSKMSEQELEALELKEREAKYRDRAAERREKYGIPEPPEPKRK------------RFDPTVVNYEQPTKDGIDNSNIGNKMLQAMGWKEGSGLGRKSQGITAPIQAQVRMRGAGLGAKGSSYGVNTSDSYKDAVRKAMFARFSE 816          

HSP 2 Score: 92.0485 bits (227), Expect = 2.147e-18
Identity = 66/235 (28.09%), Postives = 112/235 (47.66%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            EK + T+MLRG+   ++EN++R  V            +  +KTG+SRGF FVEF  + +A RWME  Q   VI    + + Y++ R    P  +       DW C +              C   K   K       G   +G    + +ILR++   T+ D+I+  L     ++V    +++D  T+ +R FAFV+L S  E+ ++++  +  +P    ++ GK V +D+AK+ 
Sbjct:   99 EKESKTIMLRGLPININENDIRELVESFEGPQPADVRLMKRKTGLSRGFAFVEFYHLQDATRWMEANQKKLVIQGKTIAMHYSNPR----PKFE-------DWLCNKV-------------CSTLKFPLKGTFNKQLGVTLLGGYVSSAIILRNIGPHTVVDSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLEASQLLQILQTLHPP--LKIDGKTVGVDFAKSA 307          

HSP 3 Score: 80.8777 bits (198), Expect = 5.579e-15
Identity = 32/60 (53.33%), Postives = 45/60 (75.00%), Query Frame = 1
Query: 1438 IGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            I   K+  PDT+ + +D+S+ YYYDP TGLYYD NSQY+++ L+Q+Y+YWD  K TY+P 
Sbjct:  445 IPGVKYSVPDTSTYQYDESSGYYYDPQTGLYYDPNSQYYYNSLTQQYLYWDGEKQTYLPA 504          

HSP 4 Score: 61.2326 bits (147), Expect = 6.127e-9
Identity = 57/185 (30.81%), Postives = 96/185 (51.89%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVA-VRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNS-------WRYEKP----------TNTVMLRGVS-NMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQ 651
            TIM+RGLP +I E+DIR  ++  +    A VRL+K R+TG ++G AFVEF  + DA   M   + +L I G    + Y  N + + + +   K  S         + K           ++ ++LR +  + + ++ + +    VS  V ++RLI+DK+T  +RGF FV+  S  EA + ++  Q
Sbjct:  104 TIMLRGLPININENDIRELVESFEGPQPADVRLMK-RKTGLSRGFAFVEFYHLQDATRWMEANQKKLVIQGKTIAMHYS-NPRPKFEDWLCNKVCSTLKFPLKGTFNKQLGVTLLGGYVSSAIILRNIGPHTVVDSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLEASQLLQILQ 286          
BLAST of RNA-binding protein 5 vs. Ensembl Mouse
Match: Rbm5 (RNA binding motif protein 5 [Source:MGI Symbol;Acc:MGI:1933204])

HSP 1 Score: 138.272 bits (347), Expect = 5.853e-33
Identity = 79/218 (36.24%), Postives = 122/218 (55.96%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKY 2529
            +VAAYSGDSD+++ +              L+ EE+KL +W KMAC LC R F ++  L +H+ +SDLHK+NM+  R  +L   +  +     +  KYRDRA ERREK+GIP PP  KRK           +      VN +   K         ++M++ MGW +G GLG+  QG T  ++A+    GAG+GA    +  + +DSY++ +++AM+A++
Sbjct:  616 LVAAYSGDSDNEEELVER-----------LESEEEKLADWKKMACLLCRRQFPNRDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRK-----------KQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARF 811          

HSP 2 Score: 107.457 bits (267), Expect = 2.816e-23
Identity = 68/238 (28.57%), Postives = 125/238 (52.52%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSP---CNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            E+ + T+MLRG+   ++E+++R  +            +  +KTG+SRGF FVEF  + +A  WME  Q   VI    + + Y++ R    P  +       DW C +C  +NF++R  C++C   K  S+   E   G  +   S    C+T+ILR++   T+ D+I+  L     + V    +++D  T+ +R FAFV+L S  ++ ++++  ++ +P    ++ GK + +D+AK+ 
Sbjct:   94 ERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPR----PKFE-------DWLCNKCCLNNFRKRLKCFRCGADKFDSE--QEVPPGTTESAQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPP--LKIDGKTIGVDFAKSA 316          

HSP 3 Score: 85.1149 bits (209), Expect = 2.076e-16
Identity = 35/68 (51.47%), Postives = 50/68 (73.53%), Query Frame = 1
Query: 1414 ANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            A+P  +  +  TK+  PDT+ + +D+S+ YYYDP TGLYYD NSQY+++ L+Q+Y+YWD  K TYVP 
Sbjct:  443 ASPTGV--VPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPA 508          

HSP 4 Score: 64.6994 bits (156), Expect = 4.986e-10
Identity = 57/198 (28.79%), Postives = 101/198 (51.01%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVA-VRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYG----------------YNVKEEV-------DRYDAEK-------TNSWRYEKPTNTVMLRGVS-NMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQ 651
            TIM+RGLP  ITE DIR  ++  +    A VRL+K R+TG ++G AFVEF  + DA + M   + +L I G    + Y                  N ++ +       D++D+E+        ++   +   +T++LR ++ + + ++ + +     S  V ++RLI+DK+T  +RGF FV+  S  +A + ++  Q
Sbjct:   99 TIMLRGLPITITESDIREMMESFEGPQPADVRLMK-RKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESAQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQ 295          
BLAST of RNA-binding protein 5 vs. Ensembl Mouse
Match: Rbm5 (RNA binding motif protein 5 [Source:MGI Symbol;Acc:MGI:1933204])

HSP 1 Score: 137.887 bits (346), Expect = 6.371e-33
Identity = 79/218 (36.24%), Postives = 122/218 (55.96%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKY 2529
            +VAAYSGDSD+++ +              L+ EE+KL +W KMAC LC R F ++  L +H+ +SDLHK+NM+  R  +L   +  +     +  KYRDRA ERREK+GIP PP  KRK           +      VN +   K         ++M++ MGW +G GLG+  QG T  ++A+    GAG+GA    +  + +DSY++ +++AM+A++
Sbjct:  615 LVAAYSGDSDNEEELVER-----------LESEEEKLADWKKMACLLCRRQFPNRDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRK-----------KQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARF 810          

HSP 2 Score: 107.071 bits (266), Expect = 3.039e-23
Identity = 68/238 (28.57%), Postives = 125/238 (52.52%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSP---CNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            E+ + T+MLRG+   ++E+++R  +            +  +KTG+SRGF FVEF  + +A  WME  Q   VI    + + Y++ R    P  +       DW C +C  +NF++R  C++C   K  S+   E   G  +   S    C+T+ILR++   T+ D+I+  L     + V    +++D  T+ +R FAFV+L S  ++ ++++  ++ +P    ++ GK + +D+AK+ 
Sbjct:   94 ERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPR----PKFE-------DWLCNKCCLNNFRKRLKCFRCGADKFDSE--QEVPPGTTESAQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPP--LKIDGKTIGVDFAKSA 316          

HSP 3 Score: 83.1889 bits (204), Expect = 8.327e-16
Identity = 35/68 (51.47%), Postives = 51/68 (75.00%), Query Frame = 1
Query: 1414 ANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            A+P  +  +  TK++P DT+ + +D+S+ YYYDP TGLYYD NSQY+++ L+Q+Y+YWD  K TYVP 
Sbjct:  443 ASPTGV--VPGTKYVP-DTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPA 507          

HSP 4 Score: 64.3142 bits (155), Expect = 5.245e-10
Identity = 57/198 (28.79%), Postives = 101/198 (51.01%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVA-VRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYG----------------YNVKEEV-------DRYDAEK-------TNSWRYEKPTNTVMLRGVS-NMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQ 651
            TIM+RGLP  ITE DIR  ++  +    A VRL+K R+TG ++G AFVEF  + DA + M   + +L I G    + Y                  N ++ +       D++D+E+        ++   +   +T++LR ++ + + ++ + +     S  V ++RLI+DK+T  +RGF FV+  S  +A + ++  Q
Sbjct:   99 TIMLRGLPITITESDIREMMESFEGPQPADVRLMK-RKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESAQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQ 295          
BLAST of RNA-binding protein 5 vs. Ensembl Mouse
Match: Rbm10 (RNA binding motif protein 10 [Source:MGI Symbol;Acc:MGI:2384310])

HSP 1 Score: 122.479 bits (306), Expect = 4.960e-28
Identity = 76/222 (34.23%), Postives = 113/222 (50.90%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSF--NPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHDA 2538
            +VAAYSG+SD ++      P R           E+KL +W K+AC LC R F  K  L +H+ +S LHK+N+E  R      + L        +  KYRDRA ERREK+GIP PP  KR+               TA V+ +   +         SRM++ MGW +G GLG+  QG    ++A+    G+G+GA    +    ++SY+E L + M  ++++A
Sbjct:  651 LVAAYSGESDSEEEQERGGPER-----------EEKLTDWQKLACLLCRRQFPSKEALIRHQQLSGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRR---------KYGGISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLGARGSSYGVTSTESYKETLHKTMVTRFNEA 852          

HSP 2 Score: 94.3597 bits (233), Expect = 3.051e-19
Identity = 60/237 (25.32%), Postives = 112/237 (47.26%), Query Frame = 1
Query:  556 LIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQ---------------------------------IGTSPC-----NTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            L+R+K +G SRGF FVEF  + +A RWME  Q    I   ++ + Y+  +    P  +       DW C +CG  NFKRR+ C+KC + K++++  +      DQ                                  G+ P      +T+ILR+L+  +  D+I+  L     +      +++D  T+++R FAF++L ++ E+ ++++  +  +P     + GK + +++AK +
Sbjct:   84 LMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHYSDPK----PKINE------DWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQALPLGGRELSQGLLPLPQPYQAQGVLTSQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLLQILQALHPP--LTIDGKTINVEFAKGS 308          

HSP 3 Score: 75.0998 bits (183), Expect = 2.512e-13
Identity = 27/57 (47.37%), Postives = 43/57 (75.44%), Query Frame = 1
Query: 1447 TKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            +++  PD + + +D+++ YYYDP TGLYYD NSQY+++  SQ+Y+YWD  + TY+P 
Sbjct:  485 SQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTYIPA 541          
BLAST of RNA-binding protein 5 vs. Ensembl Mouse
Match: Rbm10 (RNA binding motif protein 10 [Source:MGI Symbol;Acc:MGI:2384310])

HSP 1 Score: 122.479 bits (306), Expect = 4.960e-28
Identity = 76/222 (34.23%), Postives = 113/222 (50.90%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSF--NPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHDA 2538
            +VAAYSG+SD ++      P R           E+KL +W K+AC LC R F  K  L +H+ +S LHK+N+E  R      + L        +  KYRDRA ERREK+GIP PP  KR+               TA V+ +   +         SRM++ MGW +G GLG+  QG    ++A+    G+G+GA    +    ++SY+E L + M  ++++A
Sbjct:  651 LVAAYSGESDSEEEQERGGPER-----------EEKLTDWQKLACLLCRRQFPSKEALIRHQQLSGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRR---------KYGGISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLGARGSSYGVTSTESYKETLHKTMVTRFNEA 852          

HSP 2 Score: 94.3597 bits (233), Expect = 3.051e-19
Identity = 60/237 (25.32%), Postives = 112/237 (47.26%), Query Frame = 1
Query:  556 LIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQ---------------------------------IGTSPC-----NTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            L+R+K +G SRGF FVEF  + +A RWME  Q    I   ++ + Y+  +    P  +       DW C +CG  NFKRR+ C+KC + K++++  +      DQ                                  G+ P      +T+ILR+L+  +  D+I+  L     +      +++D  T+++R FAF++L ++ E+ ++++  +  +P     + GK + +++AK +
Sbjct:   84 LMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHYSDPK----PKINE------DWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQALPLGGRELSQGLLPLPQPYQAQGVLTSQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLLQILQALHPP--LTIDGKTINVEFAKGS 308          

HSP 3 Score: 75.0998 bits (183), Expect = 2.512e-13
Identity = 27/57 (47.37%), Postives = 43/57 (75.44%), Query Frame = 1
Query: 1447 TKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            +++  PD + + +D+++ YYYDP TGLYYD NSQY+++  SQ+Y+YWD  + TY+P 
Sbjct:  485 SQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTYIPA 541          
BLAST of RNA-binding protein 5 vs. Ensembl Mouse
Match: Rbm10 (RNA binding motif protein 10 [Source:MGI Symbol;Acc:MGI:2384310])

HSP 1 Score: 122.479 bits (306), Expect = 6.938e-28
Identity = 76/222 (34.23%), Postives = 113/222 (50.90%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSF--NPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHDA 2538
            +VAAYSG+SD ++      P R           E+KL +W K+AC LC R F  K  L +H+ +S LHK+N+E  R      + L        +  KYRDRA ERREK+GIP PP  KR+               TA V+ +   +         SRM++ MGW +G GLG+  QG    ++A+    G+G+GA    +    ++SY+E L + M  ++++A
Sbjct:  728 LVAAYSGESDSEEEQERGGPER-----------EEKLTDWQKLACLLCRRQFPSKEALIRHQQLSGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRR---------KYGGISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLGARGSSYGVTSTESYKETLHKTMVTRFNEA 929          

HSP 2 Score: 102.064 bits (253), Expect = 1.530e-21
Identity = 70/272 (25.74%), Postives = 130/272 (47.79%), Query Frame = 1
Query:  451 KPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQ---------------------------------IGTSPC-----NTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            K +N VMLR +    +E+++R  +        +VRL+R+K +G SRGF FVEF  + +A RWME  Q    I   ++ + Y+  +    P  +       DW C +CG  NFKRR+ C+KC + K++++  +      DQ                                  G+ P      +T+ILR+L+  +  D+I+  L     +      +++D  T+++R FAF++L ++ E+ ++++  +  +P     + GK + +++AK +
Sbjct:  126 KASNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHYSDPK----PKINE------DWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQALPLGGRELSQGLLPLPQPYQAQGVLTSQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLLQILQALHPP--LTIDGKTINVEFAKGS 385          

HSP 3 Score: 75.0998 bits (183), Expect = 2.816e-13
Identity = 27/57 (47.37%), Postives = 43/57 (75.44%), Query Frame = 1
Query: 1447 TKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            +++  PD + + +D+++ YYYDP TGLYYD NSQY+++  SQ+Y+YWD  + TY+P 
Sbjct:  562 SQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTYIPA 618          

HSP 4 Score: 58.151 bits (139), Expect = 4.248e-8
Identity = 29/78 (37.18%), Postives = 42/78 (53.85%), Query Frame = 1
Query:  151 NTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSY 384
            N +M+R LP   TEDDIR  L         VRL++++ +G ++G AFVEF  + DA   M   +  L+I G    + Y
Sbjct:  129 NIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHY 206          
BLAST of RNA-binding protein 5 vs. UniProt/SwissProt
Match: sp|A4IGK4|RBM5_XENTR (RNA-binding protein 5 OS=Xenopus tropicalis OX=8364 GN=rbm5 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 5.827e-33
Identity = 82/223 (36.77%), Postives = 123/223 (55.16%), Query Frame = 1
Query: 1897 NDDIVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHD 2535
            N  +VAAYSGDSD+++           S   L   +E+KL++W K+AC LC R F +K  L +H+ +SDLHK+N+E  R  K+   +  +     +  KYRDRA ERREK+GIP PP  KRK                  VN +   K         ++M++ MGW +G GLG+ +QG T  +QA+    GAG+GA    +    SDSY++ +++AM+A++ +
Sbjct:  636 NKALVAAYSGDSDNEE----------ESERLLGAVDEEKLLDWKKLACLLCRRQFPNKDALTRHQQLSDLHKQNLEVYRRSKMSEQELEALELKEREAKYRDRAAERREKYGIPEPPEPKRK------------RFDPTVVNYEQPTKDGIDNSNIGNKMLQAMGWKEGSGLGRKSQGITAPIQAQVRMRGAGLGAKGSSYGVNTSDSYKDAVRKAMFARFSE 836          

HSP 2 Score: 117.472 bits (293), Expect = 1.518e-25
Identity = 75/244 (30.74%), Postives = 127/244 (52.05%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSP---------CNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            EK + T+MLRG+   ++EN++R  V            +  +KTG+SRGF FVEF  + +A RWME  Q   VI    + + Y++ R    P  +       DW C +CG +NF+RR  C++C  +KA+S   +E   G      S           + +ILR++   T+ D+I+  L     ++V    +++D  T+ +R FAFV+L S  E+ ++++  +  +P    ++ GK V +D+AK+ 
Sbjct:   99 EKESKTIMLRGLPININENDIRELVESFEGPQPADVRLMKRKTGLSRGFAFVEFYHLQDATRWMEANQKKLVIQGKTIAMHYSNPR----PKFE-------DWLCNKCGLYNFRRRLKCFRCGAAKAESD--LEAPSGSSDAPQSTDYYSDSGYVSSAIILRNIGPHTVVDSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLEASQLLQILQTLHPP--LKIDGKTVGVDFAKSA 327          

HSP 3 Score: 80.8777 bits (198), Expect = 3.136e-14
Identity = 32/60 (53.33%), Postives = 45/60 (75.00%), Query Frame = 1
Query: 1438 IGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            I   K+  PDT+ + +D+S+ YYYDP TGLYYD NSQY+++ L+Q+Y+YWD  K TY+P 
Sbjct:  465 IPGVKYSVPDTSTYQYDESSGYYYDPQTGLYYDPNSQYYYNSLTQQYLYWDGEKQTYLPA 524          

HSP 4 Score: 60.077 bits (144), Expect = 8.600e-8
Identity = 61/205 (29.76%), Postives = 97/205 (47.32%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVA-VRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYG----------------YNVKEEVD--RYDAEKTNSWRYEKPTNT-------------------VMLRGVS-NMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQ 651
            TIM+RGLP +I E+DIR  ++  +    A VRL+K R+TG ++G AFVEF  + DA   M   + +L I G    + Y                 YN +  +   R  A K  S   E P+ +                   ++LR +  + + ++ + +    VS  V ++RLI+DK+T  +RGF FV+  S  EA + ++  Q
Sbjct:  104 TIMLRGLPININENDIRELVESFEGPQPADVRLMK-RKTGLSRGFAFVEFYHLQDATRWMEANQKKLVIQGKTIAMHYSNPRPKFEDWLCNKCGLYNFRRRLKCFRCGAAKAES-DLEAPSGSSDAPQSTDYYSDSGYVSSAIILRNIGPHTVVDSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLEASQLLQILQ 306          
BLAST of RNA-binding protein 5 vs. UniProt/SwissProt
Match: sp|P52756|RBM5_HUMAN (RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5 PE=1 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 1.877e-32
Identity = 80/218 (36.70%), Postives = 122/218 (55.96%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNME-QLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKY 2529
            +VAAYSGDSD+++ +              L+ EE+KL +W KMAC LC R F +K  L +H+ +SDLHK+NM+   R +L   +  +     +  KYRDRA ERREK+GIP PP  KRK           +      VN +   K         ++M++ MGW +G GLG+  QG T  ++A+    GAG+GA    +  + +DSY++ +++AM+A++
Sbjct:  616 LVAAYSGDSDNEEELVER-----------LESEEEKLADWKKMACLLCRRQFPNKDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRK-----------KQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARF 811          

HSP 2 Score: 107.457 bits (267), Expect = 1.657e-22
Identity = 68/247 (27.53%), Postives = 128/247 (51.82%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSK-----SVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNTFNTIMQS 1170
            E+ + T+MLRG+   ++E+++R  +            +  +KTG+SRGF FVEF  + +A  WME  Q   VI    + + Y++ R    P  +       DW C +C  +NF++R  C++C   K  S+        E++   D      C+T+ILR++   T+ D+I+  L     + V    +++D  T+ +R FAFV+L S  ++ ++++  ++ +P    ++ GK + +D+AK+    ++ S
Sbjct:   94 ERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPR----PKFE-------DWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYY----CDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPP--LKIDGKTIGVDFAKSARKDLVLS 323          

HSP 3 Score: 85.5001 bits (210), Expect = 1.152e-15
Identity = 35/68 (51.47%), Postives = 50/68 (73.53%), Query Frame = 1
Query: 1414 ANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            A+P  +  +  TK+  PDT+ + +D+S+ YYYDP TGLYYD NSQY+++ L+Q+Y+YWD  K TYVP 
Sbjct:  443 ASPTGV--VPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPA 508          

HSP 4 Score: 64.3142 bits (155), Expect = 4.281e-9
Identity = 58/198 (29.29%), Postives = 98/198 (49.49%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVA-VRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYG------------------YNVKEEVDRYDAEKTNSWRYEKP------------TNTVMLRGVS-NMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQ 651
            TIM+RGLP  ITE DIR  ++  +    A VRL+K R+TG ++G AFVEF  + DA + M   + +L I G    + Y                   +  + +  R  A+K +S +   P             +T++LR ++ + + ++ + +     S  V ++RLI+DK+T  +RGF FV+  S  +A + ++  Q
Sbjct:   99 TIMLRGLPITITESDIREMMESFEGPQPADVRLMK-RKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQ 295          
BLAST of RNA-binding protein 5 vs. UniProt/SwissProt
Match: sp|Q1RMU5|RBM5_BOVIN (RNA-binding protein 5 OS=Bos taurus OX=9913 GN=RBM5 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.085e-32
Identity = 80/218 (36.70%), Postives = 122/218 (55.96%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKY 2529
            +VAAYSGDSD+++ +              L+ EE+KL +W KMAC LC R F +K  L +H+ +SDLHK+NM+  R  +L   +  +     +  KYRDRA ERREK+GIP PP  KRK           +      VN +   K         ++M++ MGW +G GLG+  QG T  ++A+    GAG+GA    +  + +DSY++ +++AM+A++
Sbjct:  616 LVAAYSGDSDNEEELVER-----------LESEEEKLADWKKMACLLCRRQFPNKDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRK-----------KQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARF 811          

HSP 2 Score: 107.071 bits (266), Expect = 2.021e-22
Identity = 67/240 (27.92%), Postives = 125/240 (52.08%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSK-----SVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            E+ + T+MLRG+   ++E+++R  +            +  +KTG+SRGF FVEF  + +A  WME  Q   VI    + + Y++ R    P  +       DW C +C  +NF++R  C++C   K  S+        E++   D      C+T+ILR++   T+ D+I+  L     + V    +++D  T+ +R FAFV+L S  ++ ++++  ++ +P    ++ GK + +D+AK+ 
Sbjct:   94 ERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPR----PKFE-------DWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYY----CDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPP--LKIDGKTIGVDFAKSA 316          

HSP 3 Score: 80.8777 bits (198), Expect = 2.923e-14
Identity = 33/66 (50.00%), Postives = 49/66 (74.24%), Query Frame = 1
Query: 1414 ANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYV 1611
            A+P  +  +  TK+  PDT+ + +D+S+ YYYDP TGLYYD NSQY+++ L+Q+Y+YWD  K TY+
Sbjct:  443 ASPTGV--VPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYM 506          

HSP 4 Score: 64.3142 bits (155), Expect = 4.468e-9
Identity = 58/198 (29.29%), Postives = 98/198 (49.49%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVA-VRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYG------------------YNVKEEVDRYDAEKTNSWRYEKP------------TNTVMLRGVS-NMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQ 651
            TIM+RGLP  ITE DIR  ++  +    A VRL+K R+TG ++G AFVEF  + DA + M   + +L I G    + Y                   +  + +  R  A+K +S +   P             +T++LR ++ + + ++ + +     S  V ++RLI+DK+T  +RGF FV+  S  +A + ++  Q
Sbjct:   99 TIMLRGLPITITESDIREMMESFEGPQPADVRLMK-RKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQ 295          
BLAST of RNA-binding protein 5 vs. UniProt/SwissProt
Match: sp|Q91YE7|RBM5_MOUSE (RNA-binding protein 5 OS=Mus musculus OX=10090 GN=Rbm5 PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 4.094e-32
Identity = 79/218 (36.24%), Postives = 122/218 (55.96%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKY 2529
            +VAAYSGDSD+++ +              L+ EE+KL +W KMAC LC R F ++  L +H+ +SDLHK+NM+  R  +L   +  +     +  KYRDRA ERREK+GIP PP  KRK           +      VN +   K         ++M++ MGW +G GLG+  QG T  ++A+    GAG+GA    +  + +DSY++ +++AM+A++
Sbjct:  616 LVAAYSGDSDNEEELVER-----------LESEEEKLADWKKMACLLCRRQFPNRDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRK-----------KQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARF 811          

HSP 2 Score: 107.457 bits (267), Expect = 1.970e-22
Identity = 68/238 (28.57%), Postives = 125/238 (52.52%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSP---CNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            E+ + T+MLRG+   ++E+++R  +            +  +KTG+SRGF FVEF  + +A  WME  Q   VI    + + Y++ R    P  +       DW C +C  +NF++R  C++C   K  S+   E   G  +   S    C+T+ILR++   T+ D+I+  L     + V    +++D  T+ +R FAFV+L S  ++ ++++  ++ +P    ++ GK + +D+AK+ 
Sbjct:   94 ERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPR----PKFE-------DWLCNKCCLNNFRKRLKCFRCGADKFDSE--QEVPPGTTESAQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPP--LKIDGKTIGVDFAKSA 316          

HSP 3 Score: 85.1149 bits (209), Expect = 1.452e-15
Identity = 35/68 (51.47%), Postives = 50/68 (73.53%), Query Frame = 1
Query: 1414 ANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            A+P  +  +  TK+  PDT+ + +D+S+ YYYDP TGLYYD NSQY+++ L+Q+Y+YWD  K TYVP 
Sbjct:  443 ASPTGV--VPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPA 508          

HSP 4 Score: 64.6994 bits (156), Expect = 3.487e-9
Identity = 57/198 (28.79%), Postives = 101/198 (51.01%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVA-VRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYG----------------YNVKEEV-------DRYDAEK-------TNSWRYEKPTNTVMLRGVS-NMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQ 651
            TIM+RGLP  ITE DIR  ++  +    A VRL+K R+TG ++G AFVEF  + DA + M   + +L I G    + Y                  N ++ +       D++D+E+        ++   +   +T++LR ++ + + ++ + +     S  V ++RLI+DK+T  +RGF FV+  S  +A + ++  Q
Sbjct:   99 TIMLRGLPITITESDIREMMESFEGPQPADVRLMK-RKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESAQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQ 295          
BLAST of RNA-binding protein 5 vs. UniProt/SwissProt
Match: sp|B2GV05|RBM5_RAT (RNA-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Rbm5 PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 4.241e-32
Identity = 79/218 (36.24%), Postives = 122/218 (55.96%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKY 2529
            +VAAYSGDSD+++ +              L+ EE+KL +W KMAC LC R F ++  L +H+ +SDLHK+NM+  R  +L   +  +     +  KYRDRA ERREK+GIP PP  KRK           +      VN +   K         ++M++ MGW +G GLG+  QG T  ++A+    GAG+GA    +  + +DSY++ +++AM+A++
Sbjct:  616 LVAAYSGDSDNEEELVER-----------LESEEEKLADWKKMACLLCRRQFPNRDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRK-----------KQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARF 811          

HSP 2 Score: 107.071 bits (266), Expect = 2.021e-22
Identity = 67/240 (27.92%), Postives = 125/240 (52.08%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSK-----SVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNT 1149
            E+ + T+MLRG+   ++E+++R  +            +  +KTG+SRGF FVEF  + +A  WME  Q   VI    + + Y++ R    P  +       DW C +C  +NF++R  C++C   K  S+        E++   D      C+T+ILR++   T+ D+I+  L     + V    +++D  T+ +R FAFV+L S  ++ ++++  ++ +P    ++ GK + +D+AK+ 
Sbjct:   94 ERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPR----PKFE-------DWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYY----CDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPP--LKIDGKTIGVDFAKSA 316          

HSP 3 Score: 85.1149 bits (209), Expect = 1.477e-15
Identity = 35/68 (51.47%), Postives = 50/68 (73.53%), Query Frame = 1
Query: 1414 ANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            A+P  +  +  TK+  PDT+ + +D+S+ YYYDP TGLYYD NSQY+++ L+Q+Y+YWD  K TYVP 
Sbjct:  443 ASPTGV--VPGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPA 508          

HSP 4 Score: 63.929 bits (154), Expect = 4.908e-9
Identity = 58/198 (29.29%), Postives = 98/198 (49.49%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVA-VRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYG------------------YNVKEEVDRYDAEKTNSWRYEKP------------TNTVMLRGVS-NMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQ 651
            TIM+RGLP  ITE DIR  ++  +    A VRL+K R+TG ++G AFVEF  + DA + M   + +L I G    + Y                   +  + +  R  A+K +S +   P             +T++LR ++ + + ++ + +     S  V ++RLI+DK+T  +RGF FV+  S  +A + ++  Q
Sbjct:   99 TIMLRGLPITITESDIREMMESFEGPQPADVRLMK-RKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYYCDTIILRNIAPHTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQ 295          
BLAST of RNA-binding protein 5 vs. TrEMBL
Match: A0A3Q0KL44 (Putative rna binding protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 502.286 bits (1292), Expect = 6.911e-161
Identity = 334/912 (36.62%), Postives = 481/912 (52.74%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQ---------GGAP--------MT---DFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHETSNYD---XXXXXXXXXXXLSQKKLQKKGXXXXXXXXXXXXHGNGTE--------------SGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPP------------------DTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQNNNS----RRFEPEVKXXXXXXXXXXXXXXXPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTR--------SPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIP---------------------DTLSF------------------------NPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXX------XXTAPVNPQPEVKVSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHD 2535
            TIM+RGL S  TE D+R +LD   ANY  VRL++D++TG  + I FV+F++ NDAK  M D +GE++I   I +L+Y  N KE+ D           ++  + T+MLRG+   L   ++R  + D     +DVR+I+DK TG+S+GFGFV+F S+ EA+RWM++Q+G F +   E++L Y++ R          G AP        MT          GDW C+RC  HNF+RRD CYKC L ++Q +S+  ++DG D IGT+PCNTL+LR LDALT ED I +V +    V V+QC +MRD+VT  SRCFAF EL +++++ KV++   N   ++FE+ GKAVT+ YAKNTFNTIM + K       E +Y A ++ + N     A+AA A  +  +S   +     A     S T ++G                  S +T  L  + +   S    P     + S + +PP                  DT+K+++D+ST++YYDPVTGL Y+ NS+YF+DR SQ+Y YWD  KSTY+PV    P +N++D   +N   D     K K+ +    +    E    +KK   Q   S    +R +     A+             + + L  D     +  +VA Y G  D DD     T    +           T + +EE+KL++W K+AC LC+RGFKD ATL+KHR+ S LH +N+ +LR K G+P                     ++LS                         + P+ + +YRDRAKERREK+GIPSPP  K             +       PI  P    P V  SR+MEKMGW  GQGLG+SNQGRT+IV+AEF  +G G+G         SD+Y++N+KRAM+A++H+
Sbjct:    7 TIMLRGLTSSTTERDVRRTLDSEHANYTDVRLVRDKKTG--RWIGFVDFVSANDAKQFMRDCQGEIEIRKTIIRLNYS-NPKEKRDD---------EFDDASPTIMLRGIPTSLDHRDIRDALDDARVSYLDVRVIKDKTTGISKGFGFVDFASVHEARRWMDHQKGIFRVRRYEIRLMYSTPRNQLDSLIHHSGDAPGLLGPSSFMTRPPALSEVSTGDWICSRCSSHNFRRRDQCYKCQLPRSQVQSLTNSVDGVDLIGTTPCNTLVLRCLDALTTEDDICQVFQDTADVKVRQCHVMRDEVTHASRCFAFAELPTVADAYKVMDIV-NKEFKLFEVGGKAVTVSYAKNTFNTIMATLKT------EGSYNAQLNSSRNLALDLAHAAMAAQNNNISPDTVAMNAVAASALLSQTSNNGAAVAQAAIQQKQTEQHVLSALTKSLRNHSEHTVSSNYAPSMAALVASGQQLPPPSFPFNAVTASTTTYPFPDTSKYIYDESTRFYYDPVTGLMYEPNSKYFYDRGSQQYYYWDQTKSTYLPVPQTNPQSNSVDNAASNSQTDTSDAPKNKDDRGKTAQQIAREMEKWAKKMNAQKKASSSVGQRSDVITSEASRTADTGYAILEASSNNPLTSDSHTPESASLVAEYGGVEDSDDSGQDETHSEKQDSLLSFDAEAETKVSEEENKLLDWAKLACMLCSRGFKDAATLQKHRAFSGLHYENLNKLRGKYGLPAIPVPTPVQNQEASTAVNSPKNSLSIASLMQIGAQTASNHAKSVASRQVSSRPSASGQYRDRAKERREKYGIPSPPRMKSVESQPSVVQIEQDSFVPPLPPIPPPPQSAPNVG-SRLMEKMGWQAGQGLGRSNQGRTQIVEAEFREAGVGLGIKTSKRGPQSDNYKDNVKRAMFARFHE 898          
BLAST of RNA-binding protein 5 vs. TrEMBL
Match: A0A4Z2DM91 (RNA-binding protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_011058 PE=4 SV=1)

HSP 1 Score: 495.738 bits (1275), Expect = 2.352e-158
Identity = 330/912 (36.18%), Postives = 478/912 (52.41%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDA---------------------GDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHETSNYD---XXXXXXXXXXXLSQKKLQKKGXXXXXXXXXXXXHGNGTE--------------SGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPP------------------DTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQ----NNNSRRFEPEVKXXXXXXXXXXXXXXXPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTRSPSTLLK--------DEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIP-----------DTLSFNPP---------------------------------TKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXX------XXXTAPVNPQPEVKVSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHD 2535
            TIM+RGL S  TE D+R +LD  +ANY  VRL++D++TG  + I FV+F++ NDAK  M D +GE+++     +L+Y  N+KE+ D           Y+  ++T+MLRG+   L   ++R  + D     +DVR+I+DK TG+S+GFGFV+F S+ EA+RWM+YQ+G F +   E++L Y++ R     +   +++DA                     GDW C+RC  HNF+RRD CYKC L ++Q +S+  ++DG D IGT+PCNTL+LR LDALT ED I +V +    V V+QC +MRD++T  SRCFAF EL +++++ KV++   N   ++FE+ GKAVT+ YAKNTFNTIM + K       E +Y A ++ + N     A+AA A  +  +S   +     A     S T ++G                  S +T  L  + +   S    P       S + +PP                  DT+K+++D+ST++YYDPVTGL Y+ NS+YF+DR SQ+Y YWD  KSTY+PV    P ++++D T ++   D     K+K+ +    +    E    +KK   Q    +N  +R +     A+               S L  D     +  +VA Y G  D DD             S  L         +EE KL++W K+AC LC+RGFKD  TL+KHR+ S LH +N+ +LR K G+P           +T   N P                                 T + +YRDRAKERREK+GIPSPP  K             E        I  P    P V  SR+MEKMGW  GQGLG+SNQGRT+IV+AEF  +G G+G         SD+Y++N+KRAM+A++H+
Sbjct:    7 TIMLRGLTSSTTERDVRRTLDSERANYTDVRLVRDKKTG--RWIGFVDFVSANDAKQFMRDCQGEIEVRKTTIRLNYS-NLKEKRDE---------EYDDASSTIMLRGIPTSLDHRDIRDALDDARVSYLDVRVIKDKVTGISKGFGFVDFASVHEARRWMDYQKGVFRVRRYEVRLMYSTPRNQLDSLI-HHSSDAPGLLGPSSFMIRPPTLSEVSTGDWICSRCSSHNFRRRDQCYKCQLPRSQVQSLTNSVDGVDLIGTTPCNTLVLRCLDALTTEDDICQVFQDTADVKVRQCHVMRDEITHASRCFAFAELPTVADAYKVMDIV-NKEFKLFEVGGKAVTVSYAKNTFNTIMATLKT------EGSYNAQLNSSRNLALDLAHAAMAAQNNNISPDTVAMNAVAASALLSQTSNNGAAVAQAAIQQKQTEQHVLSALTKSLRNHSEHTVSSNYAPSMAALAASGQQLPPPSFPFNAATASTTTYPFPDTSKYIYDESTRFYYDPVTGLMYEPNSKYFYDRGSQQYYYWDQTKSTYLPVPQSNPKSSSVDNTASDSQTDTSDALKSKDDRGKTAQQIAREMEKWAKKMNAQKKASSNVGQRSDVSTSEASRTADTGYAILEASAGSVLTCDSRTPESTSLVAEYGGVEDSDDSGQDEVHSEKHDSSLSLNTEAEAKVAEEESKLLDWTKLACMLCSRGFKDATTLQKHRAFSGLHYENLNKLRGKYGLPPIPAPTPTQNQETPVVNSPKNSLSIASLLQIGAQTASNHAKSVASRQTTSRSTTSNQYRDRAKERREKYGIPSPPRMKTVENQPSTVQIDQEVFIPPLTHIPPPSQSAPNVG-SRLMEKMGWQAGQGLGRSNQGRTQIVEAEFREAGVGLGIKTSKRGPQSDNYKDNVKRAMFARFHE 897          

HSP 2 Score: 68.1662 bits (165), Expect = 7.789e-8
Identity = 32/78 (41.03%), Postives = 52/78 (66.67%), Query Frame = 1
Query:  151 NTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSY 384
            +TIM+RG+P+ +   DIR +LDD + +Y+ VR++KD+ TG +KG  FV+F +V++A+  M   KG   +  Y  +L Y
Sbjct:   97 STIMLRGIPTSLDHRDIRDALDDARVSYLDVRVIKDKVTGISKGFGFVDFASVHEARRWMDYQKGVFRVRRYEVRLMY 174          
BLAST of RNA-binding protein 5 vs. TrEMBL
Match: A0A4Z2DM97 (RNA-binding protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_011058 PE=4 SV=1)

HSP 1 Score: 492.656 bits (1267), Expect = 2.439e-157
Identity = 328/910 (36.04%), Postives = 476/910 (52.31%), Query Frame = 1
Query:  160 MIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDA---------------------GDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHETSNYD---XXXXXXXXXXXLSQKKLQKKGXXXXXXXXXXXXHGNGTE--------------SGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPP------------------DTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQ----NNNSRRFEPEVKXXXXXXXXXXXXXXXPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTRSPSTLLK--------DEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIP-----------DTLSFNPP---------------------------------TKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXX------XXXTAPVNPQPEVKVSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHD 2535
            M+RGL S  TE D+R +LD  +ANY  VRL++D++TG  + I FV+F++ NDAK  M D +GE+++     +L+Y  N+KE+ D           Y+  ++T+MLRG+   L   ++R  + D     +DVR+I+DK TG+S+GFGFV+F S+ EA+RWM+YQ+G F +   E++L Y++ R     +   +++DA                     GDW C+RC  HNF+RRD CYKC L ++Q +S+  ++DG D IGT+PCNTL+LR LDALT ED I +V +    V V+QC +MRD++T  SRCFAF EL +++++ KV++   N   ++FE+ GKAVT+ YAKNTFNTIM + K       E +Y A ++ + N     A+AA A  +  +S   +     A     S T ++G                  S +T  L  + +   S    P       S + +PP                  DT+K+++D+ST++YYDPVTGL Y+ NS+YF+DR SQ+Y YWD  KSTY+PV    P ++++D T ++   D     K+K+ +    +    E    +KK   Q    +N  +R +     A+               S L  D     +  +VA Y G  D DD             S  L         +EE KL++W K+AC LC+RGFKD  TL+KHR+ S LH +N+ +LR K G+P           +T   N P                                 T + +YRDRAKERREK+GIPSPP  K             E        I  P    P V  SR+MEKMGW  GQGLG+SNQGRT+IV+AEF  +G G+G         SD+Y++N+KRAM+A++H+
Sbjct:    1 MLRGLTSSTTERDVRRTLDSERANYTDVRLVRDKKTG--RWIGFVDFVSANDAKQFMRDCQGEIEVRKTTIRLNYS-NLKEKRDE---------EYDDASSTIMLRGIPTSLDHRDIRDALDDARVSYLDVRVIKDKVTGISKGFGFVDFASVHEARRWMDYQKGVFRVRRYEVRLMYSTPRNQLDSLI-HHSSDAPGLLGPSSFMIRPPTLSEVSTGDWICSRCSSHNFRRRDQCYKCQLPRSQVQSLTNSVDGVDLIGTTPCNTLVLRCLDALTTEDDICQVFQDTADVKVRQCHVMRDEITHASRCFAFAELPTVADAYKVMDIV-NKEFKLFEVGGKAVTVSYAKNTFNTIMATLKT------EGSYNAQLNSSRNLALDLAHAAMAAQNNNISPDTVAMNAVAASALLSQTSNNGAAVAQAAIQQKQTEQHVLSALTKSLRNHSEHTVSSNYAPSMAALAASGQQLPPPSFPFNAATASTTTYPFPDTSKYIYDESTRFYYDPVTGLMYEPNSKYFYDRGSQQYYYWDQTKSTYLPVPQSNPKSSSVDNTASDSQTDTSDALKSKDDRGKTAQQIAREMEKWAKKMNAQKKASSNVGQRSDVSTSEASRTADTGYAILEASAGSVLTCDSRTPESTSLVAEYGGVEDSDDSGQDEVHSEKHDSSLSLNTEAEAKVAEEESKLLDWTKLACMLCSRGFKDATTLQKHRAFSGLHYENLNKLRGKYGLPPIPAPTPTQNQETPVVNSPKNSLSIASLLQIGAQTASNHAKSVASRQTTSRSTTSNQYRDRAKERREKYGIPSPPRMKTVENQPSTVQIDQEVFIPPLTHIPPPSQSAPNVG-SRLMEKMGWQAGQGLGRSNQGRTQIVEAEFREAGVGLGIKTSKRGPQSDNYKDNVKRAMFARFHE 889          

HSP 2 Score: 68.1662 bits (165), Expect = 7.308e-8
Identity = 32/78 (41.03%), Postives = 52/78 (66.67%), Query Frame = 1
Query:  151 NTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSY 384
            +TIM+RG+P+ +   DIR +LDD + +Y+ VR++KD+ TG +KG  FV+F +V++A+  M   KG   +  Y  +L Y
Sbjct:   89 STIMLRGIPTSLDHRDIRDALDDARVSYLDVRVIKDKVTGISKGFGFVDFASVHEARRWMDYQKGVFRVRRYEVRLMY 166          
BLAST of RNA-binding protein 5 vs. TrEMBL
Match: H2KSC4 (RNA-binding protein 5/10 OS=Clonorchis sinensis OX=79923 GN=CLF_108860 PE=4 SV=1)

HSP 1 Score: 478.789 bits (1231), Expect = 4.317e-151
Identity = 327/944 (34.64%), Postives = 488/944 (51.69%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRV----------SLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTK-----------GELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRY------EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQG-------GAPMTDFYA-------TDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHETSNY------------------DXXXXXXXXXXXL-----------SQKKLQKKGXXX------XXXXXXXXXHGNGTESGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQNNNSRRFEP--EVKXXXXXXXXXXXXXXXPTF-----SGLVLDKAAF-------------RNDDIVAAYSGDSDDDDCVAS-LTPPRTRSPSTL-------LKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGI------------------PDTLSFNPPTK------------------ATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPV--------NPQPEVKV--SRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHD 2535
            T+M+R L +   E D+            +L++ +A Y  VRL++D++ G  +  AFV+F ++NDA+  M D +           GE++I   + +++Y  N KE   R D ++   +R       ++P+ T+MLRG+   +   ++R  + D   + VDVR+IRDK TG+++GFGFV+F +I +A+RWME+Q+G   +   E++L Y++ RQ        G P+               GDW C+RC  HNF+RR+ CYKC L ++Q +S+  ++DG D +GT+PCNTL+LR LDALT E+ I KV +    V V+QC +MRD+VT  SRCFAF EL +++++ KV++   +   ++FE+ GKAVT+ YAKNTFNTIM + K       E +Y A ++ + N                   DA A  AVA +AL           +   +Q+K +          S  +   H      G +   IV   +    P+ PF+      T F  PDTTK+++D+ST++YYDPVTGL Y+ NS+YF+DR+SQ+Y YWD  +STY PV  P P +     T + P  +     +    K  + +    E    +K+   Q  N     P  E  + +     +    T+ TF     +G  L +AA              RN  +VA Y G  D DD   + L   R +  S         + DEE KL++W K+AC LC+RGFKD ATL+KHR+ S LH +N+ +LR K G+                     LS +   +                  A +YRDRA+ERREK+G+PSPP  +RKY+               P+         PQP      SR+MEKMGW  GQGLG+ NQGRT+I++AEF  +G G+G  P     PSD+Y++N+KRAM+A++ +
Sbjct:   43 TLMLRNLSNSTVERDVGTFPLLFSKVHRALENERARYTEVRLVRDKKNG--RLNAFVDFCSINDARQFMKDCRVGLVNDVRSFQGEIEIRKSVIRMTYS-NPKE---RRDDDRVGCFRALFTVKSDEPSPTIMLRGIPPSMDSRDIRDALDDNRINYVDVRVIRDKNTGVTKGFGFVDFATIHDAKRWMEFQKGILRVRRHELRLTYSAPRQADELPYGSGPPVPPLMGRPGPLSEVSTGDWICSRCSSHNFRRREQCYKCQLPRSQVQSLTNSVDGVDLVGTTPCNTLVLRCLDALTTEEDICKVFEDTADVKVRQCHVMRDEVTHTSRCFAFAELPTVADAYKVMDIV-SKEYKLFEIGGKAVTVSYAKNTFNTIMATLKT------EGSYNAQLNSSRNLALDLAHAAMAAQNSNITPDAIAMNAVAASALLSQGPTSGPAVAHAAIQQKQTEQHLISAIAKSMRAAQDHSQSNSYGTSVARIVAAGQTLPPPSLPFHAATAAMTVFPYPDTTKYIYDESTRFYYDPVTGLLYEPNSKYFYDRVSQRYYYWDQTRSTYFPV--PQPGSTE---TASKPETEGTNSDQNAATKSKSAQQIAKEMEKWAKRMNAQKKNPIAVAPRNETSSVSFLGQSSFRACTSITFHRTADTGYALFEAAVSAPPTSETRPGADRNSSLVAQYGGAEDSDDSGPNDLLINRQKELSDADLEAEGKVADEEAKLLDWAKLACLLCSRGFKDAATLQKHRAFSALHIENLNKLRAKHGLQPLPTQKTESTAGAAVANSGNLSISSLIQIGADAANDHAKSVAARQGAPQYRDRARERREKYGMPSPP--RRKYDRSPAHTAPLPPAEPMPMLGVAPAFAPPQPTGPSVGSRLMEKMGWQAGQGLGRENQGRTQIIEAEFREAGVGLGIKPLKRGPPSDNYKDNVKRAMFARFRE 966          
BLAST of RNA-binding protein 5 vs. TrEMBL
Match: C7TZR7 (RNA-binding protein 5 (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 1.033e-125
Identity = 266/734 (36.24%), Postives = 396/734 (53.95%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDA---------------------GDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHETSNYD---XXXXXXXXXXXLSQKKLQKKGXXXXXXXXXXXXHGNGTE--------------SGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPP------------------DTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQ----NNNSRRFEPEVKXXXXXXXXXXXXXXXPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTRSPSTLLK--------DEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIP 2151
            TIM+RGL S  TE D+R +LD  +ANY  VRL++D++TG  + I FV+F++ NDAK  M D +GE+++     +L+Y  N+KE+ D           Y+  ++T+MLRG+   L   ++R  + D     +DVR+I+DK TG+S+GFGFV+F S+ EA+RWM+YQ+G F +   E++L Y++ R     +   +++DA                     GDW C+RC  HNF+RRD CYKC L ++Q +S+  ++DG D IGT+PCNTL+LR LDALT ED I +V +    V V+QC +MRD++T  SRCFAF EL +++++ KV++   N   ++FE+ GKAVT+ YAKNTFNTIM + K       E +Y A ++ + N     A+AA A  +  +S   +     A     S T ++G                  S +T  L  + +   S    P       S + +PP                  DT+K+++D+ST++YYDPVTGL Y+ NS+YF+DR SQ+Y YWD  KSTY+PV    P ++++D T ++   D     K+K+ +    +    E    +KK   Q    +N  +R +     A+               S L  D     +  +VA Y G  D DD             S  L         +EE KL++W K+AC LC+RGFKD  TL+KHR+ S LH +N+ +LR K G+P
Sbjct:    7 TIMLRGLTSSTTERDVRRTLDSERANYTDVRLVRDKKTG--RWIGFVDFVSANDAKQFMRDCQGEIEVRKTTIRLNYS-NLKEKRDE---------EYDDASSTIMLRGIPTSLDHRDIRDALDDARVSYLDVRVIKDKVTGISKGFGFVDFASVHEARRWMDYQKGVFRVRRYEVRLMYSTPRNQLDSLI-HHSSDAPGLLGPSSFMIRPPTLSEVSTGDWICSRCSSHNFRRRDQCYKCQLPRSQVQSLTNSVDGVDLIGTTPCNTLVLRCLDALTTEDDICQVFQDTADVKVRQCHVMRDEITHASRCFAFAELPTVADAYKVMDIV-NKEFKLFEVGGKAVTVSYAKNTFNTIMATLKT------EGSYNAQLNSSRNLALDLAHAAMAAQNNNISPDTVAMNAVAASALLSQTSNNGAAVAQAAIQQKQTEQHVLSALTKSLRNHSEHTVSSNYAPSMAALAASGQQLPPPSFPFNAATASTTTYPFPDTSKYIYDESTRFYYDPVTGLMYEPNSKYFYDRGSQQYYYWDQTKSTYLPVPQSNPKSSSVDNTASDSQTDTSDALKSKDDRGKTAQQIAREMEKWAKKMNAQKKASSNVGQRSDVSTSEASRTADTGYAILEASAGSVLTCDSRTPESTSLVAEYGGVEDSDDSGQDEVHSEKHDSSLSLNTEAEAKVAEEESKLLDWTKLACMLCSRGFKDATTLQKHRAFSGLHYENLNKLRGKYGLP 720          

HSP 2 Score: 68.1662 bits (165), Expect = 8.346e-8
Identity = 32/79 (40.51%), Postives = 52/79 (65.82%), Query Frame = 1
Query:  151 NTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYG 387
            +TIM+RG+P+ +   DIR +LDD + +Y+ VR++KD+ TG +KG  FV+F +V++A+  M   KG   +  Y  +L Y 
Sbjct:   97 STIMLRGIPTSLDHRDIRDALDDARVSYLDVRVIKDKVTGISKGFGFVDFASVHEARRWMDYQKGVFRVRRYEVRLMYS 175          
BLAST of RNA-binding protein 5 vs. Ensembl Cavefish
Match: rbm5 (RNA-binding protein 5 [Source:NCBI gene;Acc:103023872])

HSP 1 Score: 134.035 bits (336), Expect = 6.556e-32
Identity = 78/213 (36.62%), Postives = 120/213 (56.34%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNME-QLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPT-NKRKYXXXXXXXXXXXXXXTAPVNPQPEVKVSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHD 2535
            +VAAYSGDS+ ++                  + EDKL +W KMAC LC R F +K  L +H+ +SDLHK+N+E   R KL   +           KYRDRA ERREK+GIP PP   KRK+      +   E P    +N   +   ++M++ MGW +G+GLG++ QG T  ++A+    GAG+G     +  + SD+Y++ +++AM+A++ +
Sbjct:  508 LVAAYSGDSEPEEAPEG-------------DEREDKLTDWRKMACLLCRRQFPNKEALIRHQQLSDLHKQNLEVHRRSKLSEAELEELERKETEMKYRDRAAERREKYGIPEPPAPKKRKFTQPATPVVNYEQPTKDGLN--SDNIGNKMLQAMGWKEGKGLGRNQQGITAPIEAQLRMKGAGLGTKGSNYTLSASDTYKDAVRKAMFARFTE 705          

HSP 2 Score: 97.4413 bits (241), Expect = 2.204e-20
Identity = 60/206 (29.13%), Postives = 104/206 (50.49%), Query Frame = 1
Query:  559 IRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSP---CNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNTFNTIM 1164
            +  K++G+SRGF FVEF  + +A RWME  Q    I    + + Y +  +              DW C  CG +NF+RR  C++C  +K+ S+S   +I G  +  +S     +T+ILR++  L+  + I+  L     +      +++D  T  +R FAFV+L S  E+ +++   +   P    +L GK + +DYAK+    ++
Sbjct:    5 LMKKRSGISRGFAFVEFYHLQDATRWMETNQKLLTIQGKSVAMQYNTRHK------------FEDWLCNSCGLYNFRRRLKCFRCGAAKSDSES--SSITGGTETQSSGDFYGDTIILRNIAPLSTVEGIMTALAPYANLSAGNIRLIKDKQTGHNRGFAFVQLSSPLEASQLLTILQGLQPP--LKLDGKTIGVDYAKSARKDLL 194          

HSP 3 Score: 71.633 bits (174), Expect = 2.250e-12
Identity = 25/52 (48.08%), Postives = 39/52 (75.00%), Query Frame = 1
Query: 1462 PDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            PDT+ + +D+++ YYYDP TGLYYD N+ Y+++  +Q+Y+YWD  K  Y+P 
Sbjct:  350 PDTSTYQYDEASGYYYDPQTGLYYDPNTHYYYNSYTQQYLYWDSEKQAYLPA 401          
BLAST of RNA-binding protein 5 vs. Ensembl Cavefish
Match: rbm6 (RNA-binding protein 6 [Source:NCBI gene;Acc:103026575])

HSP 1 Score: 72.0182 bits (175), Expect = 2.283e-12
Identity = 27/53 (50.94%), Postives = 40/53 (75.47%), Query Frame = 1
Query: 1462 PDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVD 1620
            PD + FL+D ++ +YYDP T LYYD NS+YF++  +Q+Y+YWD    TY+PV+
Sbjct:  961 PDLSAFLYDATSGFYYDPQTTLYYDPNSRYFYNAQTQQYLYWDSTSKTYIPVE 1013          

HSP 2 Score: 60.4622 bits (145), Expect = 8.964e-9
Identity = 24/43 (55.81%), Postives = 33/43 (76.74%), Query Frame = 1
Query: 1996 KDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNME 2124
            +D+ED+L +W KMAC LC R F +K  L +H+ +SDLHK+NME
Sbjct: 1200 EDKEDRLTDWKKMACLLCRRQFPNKDALIRHQQLSDLHKQNME 1242          
BLAST of RNA-binding protein 5 vs. Ensembl Cavefish
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 50.8322 bits (120), Expect = 3.672e-6
Identity = 47/153 (30.72%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  157 IMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDS 615
            I++  L    TED ++   +      V++R+ ++   G +KG AFVEF   +D+K  + ++    DI G   +L Y       + R   E         PT T+ ++G    LSE+     + D  +  V  R+  DK+TG S+GFGFV+FDS
Sbjct:  152 IVVNNLAFSATEDTLQSVFE----KAVSIRIPQN--NGRSKGYAFVEFENTDDSKEAL-ESCNNTDIEGRSVRLEY-------MSRDRGEGFGGKGSSGPTKTLFVKG----LSEDTTDESLKDSFEGAVAARIATDKETGASKGFGFVDFDS 286          
BLAST of RNA-binding protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002233.1 (pep scaffold:Pmarinus_7.0:GL477379:17971:46302:-1 gene:ENSPMAG00000001998.1 transcript:ENSPMAT00000002233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 3.467e-26
Identity = 78/216 (36.11%), Postives = 121/216 (56.02%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQ-LREKLGIPDTLSFNPPTKA----TKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVKVSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKYHD 2535
            +VA+Y G SD ++  ++             +  E+KL +W K+AC LC R F  K  L +H+ +SDLHK+N+EQ  R K+   +        +      KYRDRA ERREK+GIP PP  K+K     P I   +           +   S+M++ MGWT+G GLGK +QG T  V+A+  T GAG+GA    + ++ +D+Y++ ++RAM A++++
Sbjct:  699 LVASYGGGSDSEEDNSA-------------EAREEKLTDWVKLACLLCRRMFPSKEALLRHQQLSDLHKQNLEQHRRSKMTAAEIEEMEKKEREVKLKAKYRDRAAERREKYGIPEPPEPKKKKVVPEPTIDYEQPTKAGIGG---DNIGSKMLQAMGWTEGSGLGKKHQGITLPVEAKKRTQGAGLGARGATYGASAADTYKDQVRRAMMARFNE 898          

HSP 2 Score: 102.449 bits (254), Expect = 1.608e-22
Identity = 80/275 (29.09%), Postives = 128/275 (46.55%), Query Frame = 1
Query:  451 KPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSV-----METIDGKD--QIGTSPCN-----------------------------------TLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYR--NNPDRIFELSGKAVTIDYAK 1143
            +P+  ++LR +   L+++E+ S +  V   + DVRLI++K TG SRGF FVEF  + +A RWME  Q  F +    + + Y+  +    P        A DW C+ CG  NF RRD C KC + ++    +     + ++D      +G SP +                                    LI+R+L A T  +AI++ L     +      +++D +T  +R FAFVELGS+ E+ ++++       P RI     K V +DYAK
Sbjct:   99 QPSTVIILRNLPLSLTKSELESEMQKVGPPLRDVRLIQNKVTGQSRGFAFVEFIHLQDATRWMEANQHNFTMQGQRVSVDYSHMK----PKL------AEDWICSTCGYQNFSRRDHCLKCGIPRSSVAQLTVPYPVRSLDDSHFPALGLSPVSPVLHSSQHYLCENLHHFFSGSWKHFPKFSSSVPLTALIIRNLGAQTTVEAIIQALLPYAMLTPTNIRLIKDRMTNYNRGFAFVELGSVLEASQLLQILTTLQPPLRI---DNKTVNVDYAK 360          

HSP 3 Score: 51.2174 bits (121), Expect = 1.081e-6
Identity = 30/71 (42.25%), Postives = 46/71 (64.79%), Query Frame = 1
Query: 1405 SVPANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            + PA P         K+  PD + + +D+S+ YYYDP  GLYYDS+SQY+++  +Q+Y+YWD  + TY+P 
Sbjct:  529 ATPAVPAPTGTQPYQKYPVPDVSTYQYDESSGYYYDPQIGLYYDSSSQYYYNSQTQEYLYWDSERQTYLPA 599          
BLAST of RNA-binding protein 5 vs. Ensembl Sea Lamprey
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 64.6994 bits (156), Expect = 5.828e-11
Identity = 46/173 (26.59%), Postives = 85/173 (49.13%), Query Frame = 1
Query:  151 NTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIG 669
            NT+M+R L     ED +R   ++ +A    VR+L DR TG  +G+AFV+F +++DAK  M    G  ++ G   +L +            +    +    + ++T+ +RG    L E+     + D  +     R++ D+ +G S+G+ +V+F S  EA+  +   +G  + G
Sbjct:  459 NTLMVRNLSFQADEDSLRSVFENAEA----VRVLMDRETGKPRGMAFVDFASIDDAKAAMKAHSG-AEVEGRAIRLEF------------STPRGTPGPSEASSTLFVRG----LGEDTSEDTLMDSFEGATAARIVTDRDSGQSKGYAYVDFSSADEAKSALNAMKGVEIDG 610          

HSP 2 Score: 53.1434 bits (126), Expect = 2.139e-7
Identity = 45/152 (29.61%), Postives = 79/152 (51.97%), Query Frame = 1
Query:  268 GSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKP-TNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAP 720
            G ++GIA+VEF +  DA+  M + +G  D+ G    L Y             +K+N  + + P +NT+M+R +S    E+     +  V ++   VR++ D++TG  RG  FV+F SI +A+  M+   G  V G + ++L +++ R    P
Sbjct:  406 GKSRGIAYVEFPSEEDAEAAMKEYQG-ADVDGRAVLLDY-----------VGDKSNKAKPQGPESNTLMVRNLSFQADED----SLRSVFENAEAVRVLMDRETGKPRGMAFVDFASIDDAKAAMKAHSGAEVEGRA-IRLEFSTPRGTPGP 540          
BLAST of RNA-binding protein 5 vs. Ensembl Sea Lamprey
Match: aggf1 (angiogenic factor with G patch and FHA domains 1 [Source:ZFIN;Acc:ZDB-GENE-060929-836])

HSP 1 Score: 50.447 bits (119), Expect = 1.480e-6
Identity = 35/131 (26.72%), Postives = 60/131 (45.80%), Query Frame = 1
Query: 2113 KNMEQLREKLGIPDTLSFNPPT-KATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEV----KVSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDS 2490
            K ++Q++ K G+  +   +      +KY +RA++RR   G   P                      AP +   E+    K  +++EKMGW  G+GLG+ + G  E ++       AG+G+AP+    P+DS
Sbjct:  386 KELKQMKAKYGLQGSAHEDQEVLNNSKYANRAEQRRRTVGSEHP-----------------HHKDDAPASLHEEIDRGNKGRKLLEKMGWKHGEGLGRDSAGIKEPIKPHAMNKQAGLGSAPQL---PADS 496          
BLAST of RNA-binding protein 5 vs. Ensembl Nematostella
Match: EDO48106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK53])

HSP 1 Score: 118.242 bits (295), Expect = 4.065e-27
Identity = 78/257 (30.35%), Postives = 131/257 (50.97%), Query Frame = 1
Query:  454 PTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQG--YFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNF--KRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTY 1209
            PT+ +ML G+ + +SE++V   +        DVR++R+K  G +RGFGFVEFD+   A+ WM+Y +G    V+G + + + Y+  ++G             DW+C +CG  NF  +RR  C+ C   K  S +  +           PC  ++ + LD LT EDAI   L     + +    +++D VT  SR F FVEL ++ E+ +++E     NP   F + G+ +T  YA+ +  + + + K    +  + TY
Sbjct:  215 PTSVIMLHGLRDEISEDDVLQELYAAEVAFRDVRIVRNK-IGYTRGFGFVEFDTPEAAKEWMDYLKGGPLKVLGYN-IGVEYSRPKEG----------QEKDWNCVKCGTQNFSSRRRRTCFSCGTPKDDSGNKEDKEKENSSYSAPPCKVVMFKGLDVLTNEDAIQAALSAITVLPIYDIRLIKDKVTGTSRGFCFVELATIEEATQLLELIAAMNPP--FMIDGRVITTLYARKSEPSPVPTTKSTRYRLLKKTY 457          

HSP 2 Score: 98.9821 bits (245), Expect = 3.250e-21
Identity = 63/185 (34.05%), Postives = 96/185 (51.89%), Query Frame = 1
Query: 2032 MACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGI--PDTLSFNPPTKATKYRDRAKERREKFGIP------SPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVKV------SRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAP-SDSYRENLKRAMYAKYHDA 2538
            MAC LC R    +  L+KH   SDLHK+N+E + +K+ +       +    +  KYRDRAKERREK+G P      +PP  KRK               T+P     + K+      ++M++ MGW++G+GLGK  QG    +QA   +  AG+G+    + S    +S RE  ++  Y+++HDA
Sbjct:  812 MACLLCKRQLPSREALDKHMQFSDLHKQNLE-IHKKMSMTEEQREEYERKEREAKYRDRAKERREKYGQPDSSSNYAPPNRKRK----------AGFTPTSPYEQPTKAKIPENNIGNQMLKAMGWSEGRGLGKEGQGIVNPIQATMRSQNAGLGSRGSSYGSVTGGESDRERQRKLAYSRFHDA 985          

HSP 3 Score: 60.8474 bits (146), Expect = 2.165e-9
Identity = 22/49 (44.90%), Postives = 34/49 (69.39%), Query Frame = 1
Query: 1471 TKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            + F++D S+ YYYD  TG YYD+N+QY+++  + +Y YWD     Y+PV
Sbjct:  574 SSFVYDPSSGYYYDSTTGFYYDANTQYYYNPATAQYFYWDDTTQQYIPV 622          
BLAST of RNA-binding protein 5 vs. Ensembl Medaka
Match: ENSORLT00000001301.2 (RNA-binding protein 5-B [Source:NCBI gene;Acc:101169440])

HSP 1 Score: 127.487 bits (319), Expect = 1.058e-29
Identity = 77/220 (35.00%), Postives = 118/220 (53.64%), Query Frame = 1
Query: 1903 DIVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNME-QLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAP-VNPQPEVK--------VSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGA-APKFNSAPSDSYRENLKRAMYAKY 2529
            ++ A+  GD+D    V S    +  S    L+ EE+KL +W K+ C LC R F  K  L +H+ +SDLHK+N++ Q R KL   +           KYRDRA ERREK+G+  PP  KRK+              +AP VN +   K         S+M++ MGW +G+GLG+  QG T  + A     G G+G+    +  +PSD+Y++ +++AM+A++
Sbjct:  613 ELDASTKGDADPVRVVES---DQEESGMERLEGEEEKLTDWKKLLCLLCRRQFPTKEALLRHQQLSDLHKQNLDIQKRSKLSETELEDLERKEAELKYRDRAAERREKYGVTEPPAPKRKF-----------YQASAPVVNYEQPTKDGLTSDNIGSKMLQAMGWQEGRGLGRHQQGITTPIAASLRAKGTGLGSKGSSYELSPSDTYKDAVRKAMFARF 818          

HSP 2 Score: 102.449 bits (254), Expect = 6.653e-22
Identity = 65/240 (27.08%), Postives = 120/240 (50.00%), Query Frame = 1
Query:  457 TNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETID-GKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNTFNTIMQS 1170
            +NT+MLRG+   ++E ++   + ++         +  K+ G+SRGF FVEF  + ++ RWME  Q   +I    + + Y++ RQ       F      +W C  CG +NF++R  CY+C   K         ++    Q G  P +T+ILR++   +  + I+ +L     +      +++D  T  +R FAFV+L +  E+ +++   ++  P    +L GK V +D+AK+     +Q+
Sbjct:   85 SNTIMLRGLPPSVTEEDIGKALEELQGPQPVDIRLMKKRAGISRGFAFVEFYHLQDSTRWMETNQKKLLIQGKSVAVQYSNRRQ------KFE-----NWLCNSCGLYNFRKRVKCYRCGTCKTGESPGGNGLNIEAQQAGEIPGDTIILRNIAPTSTVEGILTILAPFANLSTSNVRLIKDKQTGQNRGFAFVQLSTPLEASQLLTILQSLQPP--LKLDGKTVGVDFAKSARKDSVQT 311          

HSP 3 Score: 70.8626 bits (172), Expect = 4.432e-12
Identity = 59/199 (29.65%), Postives = 95/199 (47.74%), Query Frame = 1
Query:  151 NTIMIRGLPSHITEDDIRVSLDDTQA-NYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYG----------------YNVKEEVDRY--------DAEKTNSWRYEK------PTNTVMLRGVSNMLS-ENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQ 651
            NTIM+RGLP  +TE+DI  +L++ Q    V +RL+K +R G ++G AFVEF  + D+   M   + +L I G    + Y                 YN ++ V  Y        ++   N    E       P +T++LR ++   + E  +       +    +VRLI+DK+TG +RGF FV+  +  EA + +   Q
Sbjct:   86 NTIMLRGLPPSVTEEDIGKALEELQGPQPVDIRLMK-KRAGISRGFAFVEFYHLQDSTRWMETNQKKLLIQGKSVAVQYSNRRQKFENWLCNSCGLYNFRKRVKCYRCGTCKTGESPGGNGLNIEAQQAGEIPGDTIILRNIAPTSTVEGILTILAPFANLSTSNVRLIKDKQTGQNRGFAFVQLSTPLEASQLLTILQ 283          
BLAST of RNA-binding protein 5 vs. Ensembl Medaka
Match: ENSORLT00000004188.2 (RNA-binding protein 5 [Source:NCBI gene;Acc:101165877])

HSP 1 Score: 112.849 bits (281), Expect = 4.598e-25
Identity = 70/182 (38.46%), Postives = 99/182 (54.40%), Query Frame = 1
Query: 1906 IVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLRE-KLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPV----NPQPEVKVS-----RMMEKMGWTQGQGLGKSNQGRTEIVQ 2421
            +VAAYSGDSD ++  A         P    +  +DKL +W K+AC LC R F +K +L +H+ +SDLHKKN+E LR  K+   +           KYRDRA ERREK+GIP PP +K+K           +    APV     P  +   S     +M++ MGW +G+GLG++ QG T  ++
Sbjct:  644 LVAAYSGDSDPEEGGAE--------PDG--EGGQDKLTDWKKLACLLCRRQFPNKESLVRHQQLSDLHKKNLEVLRRSKMTEAELEELERKESEQKYRDRAAERREKYGIPEPPVSKKK-----------KFSQPAPVINYEQPTKDGLSSDNIGNKMLQAMGWKEGKGLGRNQQGITAPIE 804          

HSP 2 Score: 105.531 bits (262), Expect = 7.226e-23
Identity = 70/245 (28.57%), Postives = 124/245 (50.61%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSK-----SVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRN-NPDRIFELSGKAVTIDYAKNTFNTIM 1164
            +K + T+ML G++  ++E ++R  +  +         +  K+TG+SRGF FV+F  + +A RWME  Q   VI    + + Y+  R               DW C  CG +NF+RR  C++C  +K++S+     +V ET    D  G    +T+ILR++  LT  ++I+  L     +      +++D  T  +R FAFV+L S  E+ +++   +   P    +L GK + +D+AK+    ++
Sbjct:   99 DKKSKTIMLGGLAPHVTEEDIRFSIDQLEGPQPVDVRLMKKRTGISRGFAFVDFYHLQDATRWMETNQKRLVIQGKVVDMHYSHPR-----------NKYEDWLCNTCGLYNFRRRLKCFRCGAAKSESEVTNNTAVSETQPSGDFYG----DTIILRNIAPLTTVESILTALAPYANLSANNIRLIKDKQTGQNRGFAFVQLSSPLEASQLLTILQGLQPP--LKLDGKTIGVDFAKSARKDLL 326          

HSP 3 Score: 74.7146 bits (182), Expect = 3.160e-13
Identity = 31/60 (51.67%), Postives = 42/60 (70.00%), Query Frame = 1
Query: 1462 PDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPAN 1641
            PD + + +D+S+ YYYDP TGLYYD NS Y+++  +Q+Y+YWD  K TYVP      PAN
Sbjct:  477 PDISTYQYDESSGYYYDPQTGLYYDPNSHYYYNVQTQQYLYWDTEKQTYVPA-----PAN 531          

HSP 4 Score: 74.3294 bits (181), Expect = 3.815e-13
Identity = 60/199 (30.15%), Postives = 101/199 (50.75%), Query Frame = 1
Query:  154 TIMIRGLPSHITEDDIRVSLDDTQA-NYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYG----------------YNVKEEVD-------RYDAEKTNSWRYE--KPT-----NTVMLRGVSNMLS-ENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQG 654
            TIM+ GL  H+TE+DIR S+D  +    V VRL+K +RTG ++G AFV+F  + DA   M   +  L I G +  + Y                 YN +  +        + ++E TN+      +P+     +T++LR ++ + + E+ + +     +    ++RLI+DK+TG +RGF FV+  S  EA + +   QG
Sbjct:  104 TIMLGGLAPHVTEEDIRFSIDQLEGPQPVDVRLMK-KRTGISRGFAFVDFYHLQDATRWMETNQKRLVIQGKVVDMHYSHPRNKYEDWLCNTCGLYNFRRRLKCFRCGAAKSESEVTNNTAVSETQPSGDFYGDTIILRNIAPLTTVESILTALAPYANLSANNIRLIKDKQTGQNRGFAFVQLSSPLEASQLLTILQG 301          
BLAST of RNA-binding protein 5 vs. Ensembl Medaka
Match: rbm10 (RNA-binding protein 10 [Source:NCBI gene;Acc:101158854])

HSP 1 Score: 100.908 bits (250), Expect = 2.501e-21
Identity = 71/267 (26.59%), Postives = 129/267 (48.31%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETI----------DGKDQIGTSPC----------------------NTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSE-SRKVVEYYRNNPDRIFELSGKAVTIDYAKNT 1149
            ++P+N +MLR +    + +E+R+ + +      +VRL+R+K +G SRGF FVEF+ I EA  WME  QG   I   ++ + Y++ +    P  +       DW C +CG  NFKRR+ C+KC + K++++  +  +          +G   +   P                       +TLILR+L   T  ++I+  L     +      +++D  T ++R FAF++L ++ E S+ +       P     + GK + +++AK +
Sbjct:  219 QRPSNIIMLRMLPPTATASEIRAQLLEQGVQPREVRLMRNKSSGQSRGFAFVEFNLIQEATSWMETNQGTLSILGHKVSMHYSNPK----PRAN------EDWLCNKCGVQNFKRREKCFKCSVPKSEAELKLPQMQRDLPAGLQKEGGQGLLPLPVPYHSSGVSVTPGQAIQQTDVANDTLILRNLGPHTSLESILAALAPFATLTPSNIRLIKDKHTHLNRGFAFLQLSTIVEASQLLQILQALQPP--LSIEGKTIVVEFAKGS 473          

HSP 2 Score: 72.0182 bits (175), Expect = 1.914e-12
Identity = 32/71 (45.07%), Postives = 45/71 (63.38%), Query Frame = 1
Query: 1411 PANPFNIKAIGST----KFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYV 1611
            PA P      G+     ++  PD + + +D S+ +YYDP TGLYYD NSQY+++  SQ+Y+YWD  K TYV
Sbjct:  605 PATPSQPATPGTEHELKQYPVPDVSTYHYDDSSGFYYDPFTGLYYDPNSQYYYNPHSQQYMYWDGEKHTYV 675          

HSP 3 Score: 56.225 bits (134), Expect = 1.280e-7
Identity = 27/78 (34.62%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  151 NTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSY 384
            N IM+R LP   T  +IR  L +       VRL++++ +G ++G AFVEF  + +A + M   +G L I G+   + Y
Sbjct:  223 NIIMLRMLPPTATASEIRAQLLEQGVQPREVRLMRNKSSGQSRGFAFVEFNLIQEATSWMETNQGTLSILGHKVSMHY 300          

HSP 4 Score: 52.7582 bits (125), Expect = 1.565e-6
Identity = 26/63 (41.27%), Postives = 37/63 (58.73%), Query Frame = 1
Query: 2014 LINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQL--------REKLGIPDT--LSFNP 2172
            + +W K+AC LC R F  K  L +H+ +S+LHK+N+EQ         RE+L  PD+    FNP
Sbjct:  829 MTDWVKLACLLCRRQFPSKEALIRHQQLSELHKQNLEQRKKQLDAVSRERLEPPDSRKRKFNP 891          
BLAST of RNA-binding protein 5 vs. Ensembl Medaka
Match: rbm10 (RNA-binding protein 10 [Source:NCBI gene;Acc:101158854])

HSP 1 Score: 100.523 bits (249), Expect = 3.501e-21
Identity = 71/267 (26.59%), Postives = 129/267 (48.31%), Query Frame = 1
Query:  448 EKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETI----------DGKDQIGTSPC----------------------NTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSE-SRKVVEYYRNNPDRIFELSGKAVTIDYAKNT 1149
            ++P+N +MLR +    + +E+R+ + +      +VRL+R+K +G SRGF FVEF+ I EA  WME  QG   I   ++ + Y++ +    P  +       DW C +CG  NFKRR+ C+KC + K++++  +  +          +G   +   P                       +TLILR+L   T  ++I+  L     +      +++D  T ++R FAF++L ++ E S+ +       P     + GK + +++AK +
Sbjct:  219 QRPSNIIMLRMLPPTATASEIRAQLLEQGVQPREVRLMRNKSSGQSRGFAFVEFNLIQEATSWMETNQGTLSILGHKVSMHYSNPK----PRAN------EDWLCNKCGVQNFKRREKCFKCSVPKSEAELKLPQMQRDLPAGLQKEGGQGLLPLPVPYHSSGVSVTPGQAIQQTDVANDTLILRNLGPHTSLESILAALAPFATLTPSNIRLIKDKHTHLNRGFAFLQLSTIVEASQLLQILQALQPP--LSIEGKTIVVEFAKGS 473          

HSP 2 Score: 72.0182 bits (175), Expect = 2.171e-12
Identity = 33/77 (42.86%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 1384 VNGQRISSVPANPFNIKAIGSTKFIP-PDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYV 1611
            + G+   + P+ P         K  P PD + + +D S+ +YYDP TGLYYD NSQY+++  SQ+Y+YWD  K TYV
Sbjct:  599 IVGKPQPATPSQPATPGTEHELKQYPVPDVSTYHYDDSSGFYYDPFTGLYYDPNSQYYYNPHSQQYMYWDGEKHTYV 675          

HSP 3 Score: 56.6102 bits (135), Expect = 1.208e-7
Identity = 27/78 (34.62%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  151 NTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSY 384
            N IM+R LP   T  +IR  L +       VRL++++ +G ++G AFVEF  + +A + M   +G L I G+   + Y
Sbjct:  223 NIIMLRMLPPTATASEIRAQLLEQGVQPREVRLMRNKSSGQSRGFAFVEFNLIQEATSWMETNQGTLSILGHKVSMHY 300          

HSP 4 Score: 51.6026 bits (122), Expect = 4.275e-6
Identity = 19/43 (44.19%), Postives = 31/43 (72.09%), Query Frame = 1
Query: 2014 LINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKL 2142
            + +W K+AC LC R F  K  L +H+ +S+LHK+N+EQ +++L
Sbjct:  829 MTDWVKLACLLCRRQFPSKEALIRHQQLSELHKQNLEQRKKQL 871          
BLAST of RNA-binding protein 5 vs. Ensembl Medaka
Match: rbm6 (RNA-binding protein 6 [Source:NCBI gene;Acc:101163139])

HSP 1 Score: 68.1662 bits (165), Expect = 3.275e-11
Identity = 25/52 (48.08%), Postives = 39/52 (75.00%), Query Frame = 1
Query: 1462 PDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            PD + +L+D ++ +YYDP T LYYD +S+YF++  +Q+Y+YWD    TY+PV
Sbjct:  900 PDMSSYLYDSTSGFYYDPETTLYYDPHSRYFYNAQTQEYLYWDAASKTYIPV 951          

HSP 2 Score: 57.7658 bits (138), Expect = 4.715e-8
Identity = 23/43 (53.49%), Postives = 33/43 (76.74%), Query Frame = 1
Query: 1996 KDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNME 2124
            ++++DKL +W KMAC LC R F +K  L +H+ +SDLHK+NME
Sbjct: 1153 EEKDDKLTDWKKMACLLCRRQFPNKDALIRHQQLSDLHKQNME 1195          
BLAST of RNA-binding protein 5 vs. Planmine SMEST
Match: SMESG000061908.1 (SMESG000061908.1)

HSP 1 Score: 1459.51 bits (3777), Expect = 0.000e+0
Identity = 827/840 (98.45%), Postives = 828/840 (98.57%), Query Frame = 1
Query:   28 MEKADVTGFLREQRRKTEETSFRDXXXXXXXXXXXXXX---XXXNTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHETSNYDXXXXXXXXXXXLSQKKLQKKGXXXXXXXXXXXXHGNGTESGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQNNNSRRFEPEVKXXXXXXXXXXXXXXXPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVKVSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHDA 2538
            MEKADVTGFLREQRRKTEETSFR+SER  S       E   EPSNTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLRGVSNMLSENEVRSHVSDVSKHVVDVRLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHETSNYDANAAAAVAHAALSQKKLQKKGSALLPSSSSTDSHGNGTESGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPKDKDKKSKAKEAKKIAKEMEKWEKMMNSKKETVQNNNSRRFEPEVKTAAADTAFAMFTDTTPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYEPELPEIPVPEIPITAPVNPQPEVKVSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHDA
Sbjct:    1 MEKADVTGFLREQRRKTEETSFRESERRKSSSSRPKPEPYEEPSNTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLRGVSNMLSENEVRSHVSDVSKHVVDVRLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHETSNYDANAAAAVAHAALSQKKLQKKGSALLPSSSSTDSHGNGTESGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPKDKDKKSKAKEAKKIAKEMEKWEKMMNSKKETVQNNNSRRFEPEVKTAAADTAFAMFTDTTPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYEPELPEIPVPEIPITAPVNPQPEVKVSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHDA 840          
BLAST of RNA-binding protein 5 vs. Planmine SMEST
Match: SMESG000061908.1 (SMESG000061908.1)

HSP 1 Score: 1457.97 bits (3773), Expect = 0.000e+0
Identity = 836/837 (99.88%), Postives = 837/837 (100.00%), Query Frame = 1
Query:   28 MEKADVTGFLREQRRKTEETSFRDXXXXXXXXXXXXXXXXXNTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLRGVSNMLSENEXXXXXXXXXXXXXXXXLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHETSNYDXXXXXXXXXXXLSQKKLQKKGXXXXXXXXXXXXHGNGTESGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVQNNNSRRFEPEVKXXXXXXXXXXXXXXXPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYXXXXXXXXXXXXXXTAPVNPQPEVKVSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHDA 2538
            MEKADVTGFLREQRRKTEETSFR+SERSSSRPKPEPYEEPSNTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLRGVSNMLSENEVRSHVSDVSKHVVDVRLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHETSNYDANAAAAVAHAALSQKKLQKKGSALLPSSSSTDSHGNGTESGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPKDKDKKSKAKEAKKIAKEMEKWEKMMNSKKETVQNNNSRRFEPEVKTAAADTAFAMFTDTTPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYEPELPEIPVPEIPITAPVNPQPEVKVSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHDA
Sbjct:    1 MEKADVTGFLREQRRKTEETSFRESERSSSRPKPEPYEEPSNTIMIRGLPSHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTLMYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLRGVSNMLSENEVRSHVSDVSKHVVDVRLIRDKKTGMSRGFGFVEFDSIGEAQRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGGHNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTLEDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEYYRNNPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHETSNYDANAAAAVAHAALSQKKLQKKGSALLPSSSSTDSHGNGTESGITFDLIVNGQRISSVPANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPKDKDKKSKAKEAKKIAKEMEKWEKMMNSKKETVQNNNSRRFEPEVKTAAADTAFAMFTDTTPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTRSPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQLREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYEPELPEIPVPEIPITAPVNPQPEVKVSRMMEKMGWTQGQGLGKSNQGRTEIVQAEFHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHDA 837          
BLAST of RNA-binding protein 5 vs. Planmine SMEST
Match: SMESG000041552.1 (SMESG000041552.1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.022e-7
Identity = 23/59 (38.98%), Postives = 35/59 (59.32%), Query Frame = 1
Query: 1441 GSTKFIPPDTTKFLFDQSTQYYYDPVTGLYYDSNSQYFFDRLSQKYVYWDPNKSTYVPV 1617
            G   +I P   +F +++++ +YYDP T LYY++ S YFFD     Y+YW      Y+PV
Sbjct:  319 GMKFYIVPKFERFQYEKTSGFYYDPETALYYEARSGYFFDAERSVYLYWCEESKCYLPV 377          
The following BLAST results are available for this feature:
BLAST of RNA-binding protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBM103.964e-4131.63RNA binding motif protein 10 [Source:HGNC Symbol;A... [more]
RBM104.016e-4131.63RNA binding motif protein 10 [Source:HGNC Symbol;A... [more]
RBM53.908e-3336.70RNA binding motif protein 5 [Source:HGNC Symbol;Ac... [more]
RBM109.349e-2834.23RNA binding motif protein 10 [Source:HGNC Symbol;A... [more]
RBM101.403e-2734.23RNA binding motif protein 10 [Source:HGNC Symbol;A... [more]
back to top
BLAST of RNA-binding protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm-52.320e-2233.33RNA Binding Motif protein homolog [Source:UniProt... [more]
rbm-52.320e-2233.33RNA Binding Motif protein homolog [Source:UniProt... [more]
rbm-54.870e-2233.33RNA Binding Motif protein homolog [Source:UniProt... [more]
rbm-54.870e-2233.33RNA Binding Motif protein homolog [Source:UniProt... [more]
rbm-55.934e-2233.33RNA Binding Motif protein homolog [Source:UniProt... [more]
back to top
BLAST of RNA-binding protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG48964.107e-2731.48gene:FBgn0031319 transcript:FBtr0344790[more]
CG48964.153e-2731.48gene:FBgn0031319 transcript:FBtr0077968[more]
CG48871.469e-2531.51gene:FBgn0031318 transcript:FBtr0077966[more]
CG48871.469e-2531.51gene:FBgn0031318 transcript:FBtr0331288[more]
back to top
BLAST of RNA-binding protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm53.077e-4731.67RNA binding motif protein 5 [Source:ZFIN;Acc:ZDB-G... [more]
rbm101.109e-4124.50RNA binding motif protein 10 [Source:ZFIN;Acc:ZDB-... [more]
rbm101.341e-4124.50RNA binding motif protein 10 [Source:ZFIN;Acc:ZDB-... [more]
rbm102.316e-4124.50RNA binding motif protein 10 [Source:ZFIN;Acc:ZDB-... [more]
rbm102.028e-2830.58RNA binding motif protein 10 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of RNA-binding protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm51.263e-4329.41RNA binding motif protein 5 [Source:NCBI gene;Acc:... [more]
rbm52.362e-3527.05RNA binding motif protein 5 [Source:NCBI gene;Acc:... [more]
rbm54.472e-3436.82RNA binding motif protein 5 [Source:NCBI gene;Acc:... [more]
rbm54.781e-3436.82RNA binding motif protein 5 [Source:NCBI gene;Acc:... [more]
rbm58.262e-3436.77RNA binding motif protein 5 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of RNA-binding protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbm55.853e-3336.24RNA binding motif protein 5 [Source:MGI Symbol;Acc... [more]
Rbm56.371e-3336.24RNA binding motif protein 5 [Source:MGI Symbol;Acc... [more]
Rbm104.960e-2834.23RNA binding motif protein 10 [Source:MGI Symbol;Ac... [more]
Rbm104.960e-2834.23RNA binding motif protein 10 [Source:MGI Symbol;Ac... [more]
Rbm106.938e-2834.23RNA binding motif protein 10 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of RNA-binding protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4IGK4|RBM5_XENTR5.827e-3336.77RNA-binding protein 5 OS=Xenopus tropicalis OX=836... [more]
sp|P52756|RBM5_HUMAN1.877e-3236.70RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=R... [more]
sp|Q1RMU5|RBM5_BOVIN2.085e-3236.70RNA-binding protein 5 OS=Bos taurus OX=9913 GN=RBM... [more]
sp|Q91YE7|RBM5_MOUSE4.094e-3236.24RNA-binding protein 5 OS=Mus musculus OX=10090 GN=... [more]
sp|B2GV05|RBM5_RAT4.241e-3236.24RNA-binding protein 5 OS=Rattus norvegicus OX=1011... [more]
back to top
BLAST of RNA-binding protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KL446.911e-16136.62Putative rna binding protein OS=Schistosoma manson... [more]
A0A4Z2DM912.352e-15836.18RNA-binding protein isoform 2 OS=Schistosoma japon... [more]
A0A4Z2DM972.439e-15736.04RNA-binding protein isoform 1 OS=Schistosoma japon... [more]
H2KSC44.317e-15134.64RNA-binding protein 5/10 OS=Clonorchis sinensis OX... [more]
C7TZR71.033e-12536.24RNA-binding protein 5 (Fragment) OS=Schistosoma ja... [more]
back to top
BLAST of RNA-binding protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rbm56.556e-3236.62RNA-binding protein 5 [Source:NCBI gene;Acc:103023... [more]
rbm62.283e-1250.94RNA-binding protein 6 [Source:NCBI gene;Acc:103026... [more]
ncl3.672e-630.72nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
back to top
BLAST of RNA-binding protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002233.13.467e-2636.11pep scaffold:Pmarinus_7.0:GL477379:17971:46302:-1 ... [more]
ncl5.828e-1126.59nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
aggf11.480e-626.72angiogenic factor with G patch and FHA domains 1 [... [more]
back to top
BLAST of RNA-binding protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RNA-binding protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO481064.065e-2730.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA-binding protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001301.21.058e-2935.00RNA-binding protein 5-B [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000004188.24.598e-2538.46RNA-binding protein 5 [Source:NCBI gene;Acc:101165... [more]
rbm102.501e-2126.59RNA-binding protein 10 [Source:NCBI gene;Acc:10115... [more]
rbm103.501e-2126.59RNA-binding protein 10 [Source:NCBI gene;Acc:10115... [more]
rbm63.275e-1148.08RNA-binding protein 6 [Source:NCBI gene;Acc:101163... [more]
back to top
BLAST of RNA-binding protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000061908.10.000e+098.45SMESG000061908.1[more]
SMESG000061908.10.000e+099.88SMESG000061908.1[more]
SMESG000041552.11.022e-738.98SMESG000041552.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007445 ID=SMED30007445|Name=RNA-binding protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2611bp
TAATATTAGTTACCTATATTATTAAATATGGAGAAAGCAGATGTCACAGG
ATTCTTACGAGAACAACGTAGGAAAACTGAAGAGACTAGTTTTAGAGACA
GTGAACGTTCGTCATCTCGTCCTAAACCAGAGCCTTATGAGGAACCATCC
AACACAATTATGATTAGAGGTCTTCCATCGCATATTACTGAAGATGACAT
TCGAGTTAGTCTTGATGATACTCAAGCTAATTATGTAGCCGTCAGACTAT
TAAAAGATCGTAGGACGGGTTCAAATAAGGGAATAGCATTTGTTGAGTTC
ATAGCAGTAAATGACGCTAAAACACTAATGTATGATACAAAAGGTGAATT
GGATATATCAGGTTATATTGGAAAATTAAGTTACGGTTATAATGTGAAAG
AAGAGGTTGATCGTTATGACGCTGAAAAAACAAATTCTTGGAGGTATGAG
AAACCGACGAATACAGTAATGTTAAGAGGCGTGTCGAACATGTTATCGGA
AAATGAAGTGCGATCTCACGTTTCAGATGTATCGAAACACGTTGTCGACG
TCAGATTGATTAGAGACAAGAAAACCGGTATGTCCCGAGGATTCGGTTTT
GTCGAGTTTGATTCAATTGGTGAAGCGCAACGATGGATGGAATACCAACA
AGGCTACTTCGTTATTGGAGAATCTGAAATGAAATTGGCTTACACATCGA
CAAGACAAGGTGGCGCCCCAATGACAGACTTTTATGCTACCGACGCTGGA
GATTGGTCTTGTGCAAGATGCGGCGGTCATAATTTTAAGAGGCGCGACTT
TTGTTATAAGTGTCATTTATCGAAAGCTCAAAGTAAATCAGTCATGGAAA
CAATCGATGGAAAAGACCAAATCGGAACATCACCTTGCAACACACTGATT
TTGCGCGACCTTGATGCGCTTACTCTCGAGGATGCGATTGTTAAAGTTTT
GAAGGTCCAATTCGGTGTCATTGTGAAACAGTGTGAAATCATGCGTGATG
ACGTGACAAAGGTGTCACGATGTTTCGCGTTTGTCGAGCTGGGCTCTTTA
TCGGAATCGAGGAAAGTTGTGGAATACTATCGCAACAATCCCGATCGAAT
ATTCGAGTTATCGGGGAAAGCTGTGACTATCGATTATGCTAAAAACACTT
TCAACACAATTATGCAATCATACAAAGAAGCACTGGCAAAGCGGTTTGAG
GATACATATGAGGCACCCGTACATGAAACATCTAATTATGATGCTAATGC
GGCAGCAGCGGTGGCACATGCGGCTTTGAGTCAGAAAAAGTTACAGAAAA
AGGGATCAGCGCTGTTGCCTTCAAGCAGCTCAACTGATAGTCACGGTAAC
GGCACAGAATCGGGAATCACTTTTGATTTAATTGTAAACGGCCAGAGAAT
TTCTTCAGTTCCTGCAAATCCTTTCAATATAAAGGCCATCGGTTCCACAA
AATTCATCCCCCCCGACACGACTAAATTTCTATTTGACCAATCAACGCAA
TATTATTATGACCCAGTTACTGGACTTTATTATGATTCCAATTCACAATA
CTTTTTTGATCGATTGTCACAGAAATATGTTTACTGGGACCCGAATAAGT
CCACTTATGTGCCAGTTGATGTTCCCGCCCCTCCGGCAAACACAATTGAT
TTAACCAAAACCAATCCTCCAAAGGACAAAGACAAAAAATCCAAAGCTAA
AGAGGCAAAGAAAATAGCGAAAGAAATGGAAAAATGGGAGAAAATGATGA
ATTCTAAGAAAGAAACTGTGCAAAATAATAATTCGAGGAGATTCGAGCCT
GAGGTGAAGACAGCGGCTGCAGATACAGCATTTGCAATGTTTACAGATAC
CACACCAACATTCTCAGGATTAGTGTTGGATAAGGCCGCCTTCAGGAATG
ACGACATCGTGGCTGCTTACAGCGGTGATAGCGATGATGATGACTGCGTT
GCGAGTCTCACGCCCCCTCGTACTAGATCTCCGAGCACTCTTTTAAAAGA
TGAAGAAGATAAGCTGATAAATTGGGATAAAATGGCTTGCCACCTCTGCA
ATCGGGGATTCAAGGACAAAGCAACACTTGAAAAGCATCGATCAATATCA
GATTTACATAAAAAGAACATGGAGCAACTCAGAGAGAAATTGGGCATTCC
TGATACATTATCATTTAATCCACCAACCAAAGCCACTAAATATCGAGATC
GAGCTAAAGAACGTCGAGAAAAATTCGGTATTCCTTCTCCGCCAACTAAT
AAAAGAAAATATGAACCTGAATTACCAGAAATTCCAGTCCCTGAAATCCC
AATTACCGCGCCAGTAAATCCTCAGCCAGAAGTCAAAGTCTCCAGAATGA
TGGAAAAGATGGGATGGACGCAGGGCCAAGGGCTTGGAAAATCCAATCAA
GGTCGAACAGAAATCGTCCAAGCAGAATTCCACACATCTGGTGCAGGTAT
TGGAGCGGCTCCGAAATTTAATTCCGCTCCCAGTGACAGCTACAGAGAGA
ACCTGAAACGAGCTATGTATGCCAAATATCACGATGCTTAATGAATTTCT
CCGCTTTTTTCTATTTACCTTTCAACTTGTACAAATATATAATTTTATCG
TTAAAAAAAAA
back to top

protein sequence of SMED30007445-orf-1

>SMED30007445-orf-1 ID=SMED30007445-orf-1|Name=SMED30007445-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=838bp
MEKADVTGFLREQRRKTEETSFRDSERSSSRPKPEPYEEPSNTIMIRGLP
SHITEDDIRVSLDDTQANYVAVRLLKDRRTGSNKGIAFVEFIAVNDAKTL
MYDTKGELDISGYIGKLSYGYNVKEEVDRYDAEKTNSWRYEKPTNTVMLR
GVSNMLSENEVRSHVSDVSKHVVDVRLIRDKKTGMSRGFGFVEFDSIGEA
QRWMEYQQGYFVIGESEMKLAYTSTRQGGAPMTDFYATDAGDWSCARCGG
HNFKRRDFCYKCHLSKAQSKSVMETIDGKDQIGTSPCNTLILRDLDALTL
EDAIVKVLKVQFGVIVKQCEIMRDDVTKVSRCFAFVELGSLSESRKVVEY
YRNNPDRIFELSGKAVTIDYAKNTFNTIMQSYKEALAKRFEDTYEAPVHE
TSNYDANAAAAVAHAALSQKKLQKKGSALLPSSSSTDSHGNGTESGITFD
LIVNGQRISSVPANPFNIKAIGSTKFIPPDTTKFLFDQSTQYYYDPVTGL
YYDSNSQYFFDRLSQKYVYWDPNKSTYVPVDVPAPPANTIDLTKTNPPKD
KDKKSKAKEAKKIAKEMEKWEKMMNSKKETVQNNNSRRFEPEVKTAAADT
AFAMFTDTTPTFSGLVLDKAAFRNDDIVAAYSGDSDDDDCVASLTPPRTR
SPSTLLKDEEDKLINWDKMACHLCNRGFKDKATLEKHRSISDLHKKNMEQ
LREKLGIPDTLSFNPPTKATKYRDRAKERREKFGIPSPPTNKRKYEPELP
EIPVPEIPITAPVNPQPEVKVSRMMEKMGWTQGQGLGKSNQGRTEIVQAE
FHTSGAGIGAAPKFNSAPSDSYRENLKRAMYAKYHDA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0000166nucleotide binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0000484secretory system
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR041591OCRE
IPR013087Znf_C2H2_type
IPR036443Znf_RanBP2_sf
IPR035979RBD_domain_sf
IPR007087Znf_C2H2
IPR000504RRM_dom
IPR001876Znf_RanBP2
IPR000467G_patch_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 684..704
NoneNo IPR availableCOILSCoilCoilcoord: 553..580
NoneNo IPR availableGENE3DG3DSA:4.10.1060.10coord: 234..268
e-value: 1.5E-7
score: 32.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..42
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..34
NoneNo IPR availablePANTHERPTHR13948RNA-BINDING PROTEINcoord: 21..125
coord: 125..835
NoneNo IPR availableCDDcd16162OCRE_RBM5_likecoord: 478..530
e-value: 2.13149E-26
score: 100.467
NoneNo IPR availableCDDcd12313RRM1_RRM2_RBM5_likecoord: 286..371
e-value: 1.35034E-20
score: 84.5283
IPR000467G-patch domainSMARTSM00443G-patch_5coord: 765..811
e-value: 2.1E-12
score: 57.2
IPR000467G-patch domainPFAMPF01585G-patchcoord: 771..810
e-value: 1.0E-14
score: 54.1
IPR000467G-patch domainPROSITEPS50174G_PATCHcoord: 767..813
score: 13.895
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 43..120
e-value: 1.1E-5
score: 34.9
coord: 146..221
e-value: 5.0E-10
score: 49.3
coord: 289..369
e-value: 8.0E-4
score: 28.7
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 149..209
e-value: 6.2E-7
score: 29.1
coord: 44..99
e-value: 6.7E-7
score: 29.0
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 145..225
score: 12.577
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 288..373
score: 9.559
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 42..122
score: 11.077
IPR001876Zinc finger, RanBP2-typeSMARTSM00547zf_4coord: 241..265
e-value: 4.6E-4
score: 29.5
IPR001876Zinc finger, RanBP2-typePROSITEPS01358ZF_RANBP2_1coord: 243..262
IPR001876Zinc finger, RanBP2-typePROSITEPS50199ZF_RANBP2_2coord: 239..268
score: 8.671
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 269..389
e-value: 1.1E-12
score: 49.9
coord: 123..233
e-value: 2.8E-17
score: 64.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 3..112
e-value: 6.6E-13
score: 50.9
IPR041591OCRE domainPFAMPF17780OCREcoord: 480..531
e-value: 1.7E-15
score: 56.8
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 669..699
score: 9.452
IPR036443Zinc finger, RanBP2-type superfamilySUPERFAMILYSSF90209Ran binding protein zinc finger-likecoord: 237..268
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 14..102
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 281..375
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 134..226