NADPH:adrenodoxin oxidoreductase, mitochondrial

Overview
NameNADPH:adrenodoxin oxidoreductase, mitochondrial
Smed IDSMED30007434
Length (bp)1478
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NADPH:adrenodoxin oxidoreductase, mitochondrial (SMED30007434) t-SNE clustered cells

Violin plots show distribution of expression levels for NADPH:adrenodoxin oxidoreductase, mitochondrial (SMED30007434) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NADPH:adrenodoxin oxidoreductase, mitochondrial (SMED30007434) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NADPH:adrenodoxin oxidoreductase, mitochondrial (SMED30007434) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Human
Match: FDXR (ferredoxin reductase [Source:HGNC Symbol;Acc:HGNC:3642])

HSP 1 Score: 385.571 bits (989), Expect = 4.052e-129
Identity = 208/461 (45.12%), Postives = 287/461 (62.26%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFN-LTDSNFSKNWFMHFLKYPRAIY---DGVSNPGSVDFVRFGINNIQG----ELVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDM-SNMDLSCP---LDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ LLK+ Q   VD++EK PVPFGLVR+GVAPDHPEVKNVIN+FTQ A +    F+GNV +G+D+ + EL+E YH +VL++GA   + + IPGE+L  V SA   VGWYNGLPE +   PDL+ + AVI+G GNVALD+ARILLTP + L++TDI    L  L +SR+K + LVGRRGPLQVAFTIKELRE+I L   +  I+ P       + I  +PRP+KRL  L++ T  ++ G       ++ S+ W + F + P+ +    DG    G    VR  +  ++G         +G   D+ C L++ SIGY+   +DP +PFD+   +IPN+ G+V++               LYC GW+KRGP GVI  T++D+  T   +LQD+ + +  S P      +  LL+S+G + +SF +WE LD  E   G+  GKPREKL +  EM+
Sbjct:   44 VGSGPAGFYTAQHLLKHPQA-HVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELQEAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGAR-PILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAG----VRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPG------------LYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEML 486          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Human
Match: FDXR (ferredoxin reductase [Source:HGNC Symbol;Acc:HGNC:3642])

HSP 1 Score: 385.185 bits (988), Expect = 1.275e-128
Identity = 208/461 (45.12%), Postives = 287/461 (62.26%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFN-LTDSNFSKNWFMHFLKYPRAIY---DGVSNPGSVDFVRFGINNIQG----ELVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDM-SNMDLSCP---LDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ LLK+ Q   VD++EK PVPFGLVR+GVAPDHPEVKNVIN+FTQ A +    F+GNV +G+D+ + EL+E YH +VL++GA   + + IPGE+L  V SA   VGWYNGLPE +   PDL+ + AVI+G GNVALD+ARILLTP + L++TDI    L  L +SR+K + LVGRRGPLQVAFTIKELRE+I L   +  I+ P       + I  +PRP+KRL  L++ T  ++ G       ++ S+ W + F + P+ +    DG    G    VR  +  ++G         +G   D+ C L++ SIGY+   +DP +PFD+   +IPN+ G+V++               LYC GW+KRGP GVI  T++D+  T   +LQD+ + +  S P      +  LL+S+G + +SF +WE LD  E   G+  GKPREKL +  EM+
Sbjct:   75 VGSGPAGFYTAQHLLKHPQA-HVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELQEAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGAR-PILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAG----VRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPG------------LYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEML 517          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Human
Match: FDXR (ferredoxin reductase [Source:HGNC Symbol;Acc:HGNC:3642])

HSP 1 Score: 379.407 bits (973), Expect = 1.150e-126
Identity = 207/467 (44.33%), Postives = 287/467 (61.46%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVD------ILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFN-LTDSNFSKNWFMHFLKYPRAIY---DGVSNPGSVDFVRFGINNIQG----ELVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDM-SNMDLSCP---LDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ LLK+ Q   VD++EK PVPFGLVR+GVAPDHPEVKNVIN+FTQ A +    F+GNV +G+D+ + EL+E YH +VL++GA   + + IPGE+L  V SA   VGWYNGLPE +   PDL+ + AVI+G GNVALD+ARILLTP +      + ++TDI    L  L +SR+K + LVGRRGPLQVAFTIKELRE+I L   +  I+ P       + I  +PRP+KRL  L++ T  ++ G       ++ S+ W + F + P+ +    DG    G    VR  +  ++G         +G   D+ C L++ SIGY+   +DP +PFD+   +IPN+ G+V++               LYC GW+KRGP GVI  T++D+  T   +LQD+ + +  S P      +  LL+S+G + +SF +WE LD  E   G+  GKPREKL +  EM+
Sbjct:   44 VGSGPAGFYTAQHLLKHPQA-HVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELQEAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLEALLLCQRTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGAR-PILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAG----VRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPG------------LYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEML 492          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Human
Match: FDXR (ferredoxin reductase [Source:HGNC Symbol;Acc:HGNC:3642])

HSP 1 Score: 367.851 bits (943), Expect = 1.401e-122
Identity = 198/461 (42.95%), Postives = 273/461 (59.22%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFN-LTDSNFSKNWFMHFLKYPRAIY---DGVSNPGSVDFVRFGINNIQG----ELVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDM-SNMDLSCP---LDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ LLK +    VD++EK PVPFGLVR+GVAPDHPEVKNVIN+FTQ A +    F+GNV +G+D+ + EL+E YH +VL++GA   + + IPGE+L  V SA   VGWYNGLPE +   PDL+ + AVI+G GNVALD+ARILLTP + L++TDI    L  L +SR+K + LVGRRGPLQVAFTIK                              +PRP+KRL  L++ T  ++ G       ++ S+ W + F + P+ +    DG    G    VR  +  ++G         +G   D+ C L++ SIGY+   +DP +PFD+   +IPN+ G+V++               LYC GW+KRGP GVI  T++D+  T   +LQD+ + +  S P      +  LL+S+G + +SF +WE LD  E   G+  GKPREKL +  EM+
Sbjct:   44 VGSGPAGFYTAQHLLKQHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELQEAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIK------------------------------VPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAG----VRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPG------------LYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEML 458          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Human
Match: FDXR (ferredoxin reductase [Source:HGNC Symbol;Acc:HGNC:3642])

HSP 1 Score: 368.622 bits (945), Expect = 5.002e-122
Identity = 207/503 (41.15%), Postives = 286/503 (56.86%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLK------------------------------------------NNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFN-LTDSNFSKNWFMHFLKYPRAIY---DGVSNPGSVDFVRFGINNIQG----ELVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDM-SNMDLSCP---LDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ LLK                                           +    VD++EK PVPFGLVR+GVAPDHPEVKNVIN+FTQ A +    F+GNV +G+D+ + EL+E YH +VL++GA   + + IPGE+L  V SA   VGWYNGLPE +   PDL+ + AVI+G GNVALD+ARILLTP + L++TDI    L  L +SR+K + LVGRRGPLQVAFTIKELRE+I L   +  I+ P       + I  +PRP+KRL  L++ T  ++ G       ++ S+ W + F + P+ +    DG    G    VR  +  ++G         +G   D+ C L++ SIGY+   +DP +PFD+   +IPN+ G+V++               LYC GW+KRGP GVI  T++D+  T   +LQD+ + +  S P      +  LL+S+G + +SF +WE LD  E   G+  GKPREKL +  EM+
Sbjct:   44 VGSGPAGFYTAQHLLKRVEALCSQPRVLNSPALSGEGEDLGASQPLSLGPTSCHPVPQQHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELQEAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGAR-PILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAG----VRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPG------------LYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEML 529          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Celegans
Match: Y62E10A.6 (NADPH:adrenodoxin oxidoreductase, mitochondrial [Source:UniProtKB/TrEMBL;Acc:Q9U1X0])

HSP 1 Score: 248.44 bits (633), Expect = 9.966e-77
Identity = 163/460 (35.43%), Postives = 240/460 (52.17%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQV--ARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVD-ILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLN-PEVINNLPRPKKRLISLIMETFLKETGEFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGELVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPLDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAATQVN 1444
            VGSGPA  +    LL+ + N  VD+FE  PVPFGLVRYGVAPDH EVKNVIN+F  +     +  + F NVNIG+D+   EL   Y  ++LA+G+ + + + IPG D   V S  + VGWYNG+P   +  PDLT    VI+G+GNVALD AR+L T    +L+ +DIP   L+ L  + +K+I ++GRRGP  V+FTIKELRE   ++    K+ +      N  E +  L R KKRL  ++++         N+  +N  +     F + P  I     + G V  +    N        ++G+     C LLI SIGYQ   +D  +P  ND+K+I   +   +       N   +  S +Y  GW   GP G+I++T   +   +  I  D +    S   + V +LL  +   ++S+  W+ +DR E   G+  GK REK T   + +    + N
Sbjct:   31 VGSGPAGMFACNGLLRKS-NFSVDVFENSPVPFGLVRYGVAPDHQEVKNVINTFDAMFEKNRERLKLFCNVNIGRDITFDELTRGYDAVLLAYGSYKTRTLDIPGSDASNVISGSEFVGWYNGVPNAST--PDLTTSNVVIVGNGNVALDCARVLSTASSGLLRISDIPGDRLNVLEGANVKDIKILGRRGPEHVSFTIKELREQFKIKDWDSKLEISEIDAKNLTESLPKLERKKKRLTEVLVK---------NIGIANGLRQCHFIFHRIPEKII--ADSNGKVQEIIVKNN--------ETGQEETYPCGLLIYSIGYQTLVLD-GVP-QNDKKMIDMKDHCRV-------NMVAACSSQVYATGWCAHGPHGIIVDTQQQSIFVADQIAADFAQFKDSTS-NGVEELLEDRKVPFISWDEWKQIDRQEQDTGKLSGKIREKFTTFEKFLTKLKKCN 458          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Celegans
Match: W07E11.1 (pep chromosome:WBcel235:X:10084627:10104063:1 gene:WBGene00012326.1 transcript:W07E11.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07E11.1)

HSP 1 Score: 49.2914 bits (116), Expect = 7.454e-6
Identity = 43/161 (26.71%), Postives = 70/161 (43.48%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAI------------DMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDI 523
            +GSGP+    A +L+K    + V  +E+     GL+RYG+ P     K V++    +   +  RF  N  IGK +    L +    I++  G+T  + + + G D K V  A+            D V W  GL        D   ++ +I+G G+ A D 
Sbjct: 1830 IGSGPSGLGAAAQLVKVGHTVVV--YERKNRVGGLLRYGI-PTMKLDKFVVDRRVSLLEQEGVRFLTNTEIGKHVPADFLLKENDAIIVCTGSTTARDLNVEGRDAKGVCFAMEYLEKSQRRRAGDDVSW-EGL--------DPANKKVIILGGGDTATDC 1978          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Celegans
Match: W07E11.1 (pep chromosome:WBcel235:X:10084627:10104252:1 gene:WBGene00012326.1 transcript:W07E11.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07E11.1)

HSP 1 Score: 49.2914 bits (116), Expect = 7.515e-6
Identity = 43/161 (26.71%), Postives = 70/161 (43.48%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAI------------DMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDI 523
            +GSGP+    A +L+K    + V  +E+     GL+RYG+ P     K V++    +   +  RF  N  IGK +    L +    I++  G+T  + + + G D K V  A+            D V W  GL        D   ++ +I+G G+ A D 
Sbjct: 1820 IGSGPSGLGAAAQLVKVGHTVVV--YERKNRVGGLLRYGI-PTMKLDKFVVDRRVSLLEQEGVRFLTNTEIGKHVPADFLLKENDAIIVCTGSTTARDLNVEGRDAKGVCFAMEYLEKSQRRRAGDDVSW-EGL--------DPANKKVIILGGGDTATDC 1968          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Fly
Match: dare (gene:FBgn0015582 transcript:FBtr0088176)

HSP 1 Score: 362.844 bits (930), Expect = 5.369e-121
Identity = 187/452 (41.37%), Postives = 282/452 (62.39%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGELVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPLDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAA 1432
            VG+GPA FY AQ +LK   N  VD+ EKLPVPFGLVR+GVAPDHPEVKNVIN+FT+ A +   R+FGN+++G D+ ++ELR+ YH ++L +GA QD+++ +  E L  V SA   V WYNGLP  E+  PDL+G +  I+G GNVA+D+AR+LL+P+D LK TD  ++ L  L+ S+++ +HLVGRRGPLQ AFTIKELRE++ L +V  +    + + ++ + ++ L RP+KRL  L++++ LKE G       + SK +   FL+ P+AI      PG ++   F +  +Q E    +  T  +   L++RSIGY+   +D  I FD  R  + NING+++++ +T           LY  GW+  GP GVI+ T++ A   + TI  D++   L      V     + G + +++  W+ ++  E+  G+ KGKPREK+ +I EM+  A
Sbjct:   35 VGAGPAGFYAAQLILKQLDNCVVDVVEKLPVPFGLVRFGVAPDHPEVKNVINTFTKTAEHPRLRYFGNISLGTDVSLRELRDRYHAVLLTYGADQDRQLELENEQLDNVISARKFVAWYNGLPGAENLAPDLSGRDVTIVGQGNVAVDVARMLLSPLDALKTTDTTEYALEALSCSQVERVHLVGRRGPLQAAFTIKELREMLKLPNVDTRWRTEDFSGIDMQ-LDKLQRPRKRLTELMLKS-LKEQGRI-----SGSKQFLPIFLRAPKAIA-----PGEME---FSVTELQQEAAVPTSSTERLPSHLILRSIGYKSSCVDTGINFDTRRGRVHNINGRILKDDATGEVDPG-----LYVAGWLGTGPTGVIVTTMNGAFAVAKTICDDINTNALDT--SSVKPGYDADGKRVVTWDGWQRINDFESAAGKAKGKPREKIVSIEEMLRVA 464          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Fly
Match: CG9674 (gene:FBgn0036663 transcript:FBtr0333608)

HSP 1 Score: 57.3806 bits (137), Expect = 3.051e-8
Identity = 42/151 (27.81%), Postives = 74/151 (49.01%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNG--LPEKESFCPDLTGEEAVIIGHGNVALDI 523
            VGSGP+    +Q+L  N     V +FE+     GL++YG+ P     K V+     +  ++   F  NV++GKDL+ ++L + Y  ++L  G+T  + + +   DLK ++ A++ +       L  K        G+  +IIG G+   D 
Sbjct: 1773 VGSGPSGLAASQQL--NRAGHFVTVFERNDRVGGLLQYGI-PTMKLSKEVVKRRVDLMADEGIEFRTNVHVGKDLKAEQLLQEYDAVLLTTGSTWPRDLPLANRDLKGIHFAMEFLEAQQKKQLGGKNDII-SAAGKNVIIIGGGDTGCDC 1919          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Fly
Match: CG9674 (gene:FBgn0036663 transcript:FBtr0305916)

HSP 1 Score: 57.3806 bits (137), Expect = 3.051e-8
Identity = 42/151 (27.81%), Postives = 74/151 (49.01%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNG--LPEKESFCPDLTGEEAVIIGHGNVALDI 523
            VGSGP+    +Q+L  N     V +FE+     GL++YG+ P     K V+     +  ++   F  NV++GKDL+ ++L + Y  ++L  G+T  + + +   DLK ++ A++ +       L  K        G+  +IIG G+   D 
Sbjct: 1773 VGSGPSGLAASQQL--NRAGHFVTVFERNDRVGGLLQYGI-PTMKLSKEVVKRRVDLMADEGIEFRTNVHVGKDLKAEQLLQEYDAVLLTTGSTWPRDLPLANRDLKGIHFAMEFLEAQQKKQLGGKNDII-SAAGKNVIIIGGGDTGCDC 1919          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Fly
Match: CG9674 (gene:FBgn0036663 transcript:FBtr0075344)

HSP 1 Score: 56.9954 bits (136), Expect = 3.240e-8
Identity = 42/151 (27.81%), Postives = 74/151 (49.01%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNG--LPEKESFCPDLTGEEAVIIGHGNVALDI 523
            VGSGP+    +Q+L  N     V +FE+     GL++YG+ P     K V+     +  ++   F  NV++GKDL+ ++L + Y  ++L  G+T  + + +   DLK ++ A++ +       L  K        G+  +IIG G+   D 
Sbjct: 1772 VGSGPSGLAASQQL--NRAGHFVTVFERNDRVGGLLQYGI-PTMKLSKEVVKRRVDLMADEGIEFRTNVHVGKDLKAEQLLQEYDAVLLTTGSTWPRDLPLANRDLKGIHFAMEFLEAQQKKQLGGKNDII-SAAGKNVIIIGGGDTGCDC 1918          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Fly
Match: CG9674 (gene:FBgn0036663 transcript:FBtr0075341)

HSP 1 Score: 56.9954 bits (136), Expect = 3.240e-8
Identity = 42/151 (27.81%), Postives = 74/151 (49.01%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNG--LPEKESFCPDLTGEEAVIIGHGNVALDI 523
            VGSGP+    +Q+L  N     V +FE+     GL++YG+ P     K V+     +  ++   F  NV++GKDL+ ++L + Y  ++L  G+T  + + +   DLK ++ A++ +       L  K        G+  +IIG G+   D 
Sbjct: 1772 VGSGPSGLAASQQL--NRAGHFVTVFERNDRVGGLLQYGI-PTMKLSKEVVKRRVDLMADEGIEFRTNVHVGKDLKAEQLLQEYDAVLLTTGSTWPRDLPLANRDLKGIHFAMEFLEAQQKKQLGGKNDII-SAAGKNVIIIGGGDTGCDC 1918          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Zebrafish
Match: fdxr (ferredoxin reductase [Source:ZFIN;Acc:ZDB-GENE-130613-2])

HSP 1 Score: 421.779 bits (1083), Expect = 1.508e-143
Identity = 211/458 (46.07%), Postives = 295/458 (64.41%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGE----LVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPL-----DDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VG GPA FYTAQ+LLK  Q+  VD++E+LPVPFGLVR+GVAPDHPEVKNVIN+FTQ A+++   F GNVN+GKD+ I+ELR+ YH +VL++GA  ++ MGIPGEDL  V+SA D VGWYNG+P     CPDL+ E AV++G GNVALD+ARILL+PVD+LK+TDI  + L  L  S ++ + +VGRRGPLQ+A TIKELRE++NL + +  + LP   +   E +  LPRP+KRL  L+M+  +KE G     D    K+W   F + P  +  GV    +   VR  +N ++GE        +G+  D+ C L+I SIGY+   I+P +PFD  + I+PN  G+V                 LYC GW+KRGP GVI  T++D+ +T+  I+QDM    L   +     + ++ LL ++G + + F  WE ++  E   G+  GKPREKL ++ +M+
Sbjct:   44 VGGGPAGFYTAQQLLKARQDAVVDIYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTAQHERCSFHGNVNVGKDVTIEELRQAYHAVVLSYGAEGNRSMGIPGEDLCNVFSAKDFVGWYNGVPSNTELCPDLSCETAVVLGQGNVALDVARILLSPVDMLKETDITQNALEALTGSNVRRVLIVGRRGPLQIACTIKELREMVNLPNTRADM-LPADFEGIAEALKELPRPRKRLTDLMMKA-VKEGG-----DEKLEKSWGFRFFRSPVEVLAGVDGKKAAG-VRLALNKLEGEGEGARSVPTGQLEDVDCGLIISSIGYKSLPIEPTVPFDPRKAIVPNDMGRV------------QDAEGLYCSGWVKRGPTGVIATTMNDSFDTARVIIQDMETGKLDVSVNKPGAEAITGLLQTRGVRMVLFSEWEKINAEEERRGKALGKPREKLLDVEKML 481          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Zebrafish
Match: fdxr (ferredoxin reductase [Source:ZFIN;Acc:ZDB-GENE-130613-2])

HSP 1 Score: 421.779 bits (1083), Expect = 1.508e-143
Identity = 211/458 (46.07%), Postives = 295/458 (64.41%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGE----LVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPL-----DDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VG GPA FYTAQ+LLK  Q+  VD++E+LPVPFGLVR+GVAPDHPEVKNVIN+FTQ A+++   F GNVN+GKD+ I+ELR+ YH +VL++GA  ++ MGIPGEDL  V+SA D VGWYNG+P     CPDL+ E AV++G GNVALD+ARILL+PVD+LK+TDI  + L  L  S ++ + +VGRRGPLQ+A TIKELRE++NL + +  + LP   +   E +  LPRP+KRL  L+M+  +KE G     D    K+W   F + P  +  GV    +   VR  +N ++GE        +G+  D+ C L+I SIGY+   I+P +PFD  + I+PN  G+V                 LYC GW+KRGP GVI  T++D+ +T+  I+QDM    L   +     + ++ LL ++G + + F  WE ++  E   G+  GKPREKL ++ +M+
Sbjct:   44 VGGGPAGFYTAQQLLKARQDAVVDIYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTAQHERCSFHGNVNVGKDVTIEELRQAYHAVVLSYGAEGNRSMGIPGEDLCNVFSAKDFVGWYNGVPSNTELCPDLSCETAVVLGQGNVALDVARILLSPVDMLKETDITQNALEALTGSNVRRVLIVGRRGPLQIACTIKELREMVNLPNTRADM-LPADFEGIAEALKELPRPRKRLTDLMMKA-VKEGG-----DEKLEKSWGFRFFRSPVEVLAGVDGKKAAG-VRLALNKLEGEGEGARSVPTGQLEDVDCGLIISSIGYKSLPIEPTVPFDPRKAIVPNDMGRV------------QDAEGLYCSGWVKRGPTGVIATTMNDSFDTARVIIQDMETGKLDVSVNKPGAEAITGLLQTRGVRMVLFSEWEKINAEEERRGKALGKPREKLLDVEKML 481          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Xenopus
Match: fdxr (ferredoxin reductase [Source:NCBI gene;Acc:100158651])

HSP 1 Score: 402.519 bits (1033), Expect = 6.239e-136
Identity = 205/459 (44.66%), Postives = 298/459 (64.92%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTD-SNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGE----LVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQD--MSNMDLSCPLDD---VSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ +L++N   +VD++EKLPVPFGLVR+GVAPDHPEVKNVIN+FTQ AR++   F GNV +G+D+ ++EL+  YH +VL++GA   +++GIPGE+L  V+SA D VGWYNGLP+     PDL+ + AVI+G GNVALDIARILL+PVDIL+KTDI    L  L++SR++ + +VGRRGPLQVAFTIKELRE+INL   + K+   +   L  +   +LPRP+KRL  L+++  L++ G+    + +   + W + FL+ P A+        +   +R  +  ++G     +   +G+  ++SC L+  SIGY+  +I   +PF   + +IPN  G+V E +             LYC GW+KRGP GVI  T++D+ +T+  IL+D  +  ++ S P      + +LL  +G + +SF +WE +D  ET  G   GKPREK+ +  EM+
Sbjct:   38 VGSGPAGFYTAQHILRHNPQAQVDIYEKLPVPFGLVRFGVAPDHPEVKNVINTFTQTARSERCTFLGNVTVGRDVTVEELQGAYHAVVLSYGAEDKRELGIPGEELPGVHSARDFVGWYNGLPDNRHLHPDLSCDTAVILGQGNVALDIARILLSPVDILRKTDITQTALDALSQSRIRRVWMVGRRGPLQVAFTIKELREMINLPGTRPKLDPADYVGLE-KASKDLPRPRKRLTELLVKAALEKPGQKVAANWAQAEREWGLRFLRSPLAVLPSEDGKRAAR-IRLSVTRLEGSGETAVAVPTGQVENISCGLIFSSIGYKSVSISSTVPFLPQQGVIPNSMGRV-EGIPG-----------LYCSGWVKRGPTGVITTTMTDSFDTAQAILEDVQLGALNWSEPRPGSVAIRELLHLRGIQPVSFSDWEKIDEAETAKGLAVGKPREKILDTEEML 482          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Xenopus
Match: fdxr (ferredoxin reductase [Source:NCBI gene;Acc:100158651])

HSP 1 Score: 402.519 bits (1033), Expect = 7.918e-136
Identity = 205/459 (44.66%), Postives = 298/459 (64.92%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTD-SNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGE----LVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQD--MSNMDLSCPLDD---VSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ +L++N   +VD++EKLPVPFGLVR+GVAPDHPEVKNVIN+FTQ AR++   F GNV +G+D+ ++EL+  YH +VL++GA   +++GIPGE+L  V+SA D VGWYNGLP+     PDL+ + AVI+G GNVALDIARILL+PVDIL+KTDI    L  L++SR++ + +VGRRGPLQVAFTIKELRE+INL   + K+   +   L  +   +LPRP+KRL  L+++  L++ G+    + +   + W + FL+ P A+        +   +R  +  ++G     +   +G+  ++SC L+  SIGY+  +I   +PF   + +IPN  G+V E +             LYC GW+KRGP GVI  T++D+ +T+  IL+D  +  ++ S P      + +LL  +G + +SF +WE +D  ET  G   GKPREK+ +  EM+
Sbjct:   39 VGSGPAGFYTAQHILRHNPQAQVDIYEKLPVPFGLVRFGVAPDHPEVKNVINTFTQTARSERCTFLGNVTVGRDVTVEELQGAYHAVVLSYGAEDKRELGIPGEELPGVHSARDFVGWYNGLPDNRHLHPDLSCDTAVILGQGNVALDIARILLSPVDILRKTDITQTALDALSQSRIRRVWMVGRRGPLQVAFTIKELREMINLPGTRPKLDPADYVGLE-KASKDLPRPRKRLTELLVKAALEKPGQKVAANWAQAEREWGLRFLRSPLAVLPSEDGKRAAR-IRLSVTRLEGSGETAVAVPTGQVENISCGLIFSSIGYKSVSISSTVPFLPQQGVIPNSMGRV-EGIPG-----------LYCSGWVKRGPTGVITTTMTDSFDTAQAILEDVQLGALNWSEPRPGSVAIRELLHLRGIQPVSFSDWEKIDEAETAKGLAVGKPREKILDTEEML 483          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Xenopus
Match: fdxr (ferredoxin reductase [Source:NCBI gene;Acc:100158651])

HSP 1 Score: 402.134 bits (1032), Expect = 1.683e-135
Identity = 205/459 (44.66%), Postives = 298/459 (64.92%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTD-SNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGE----LVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQD--MSNMDLSCPLDD---VSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ +L++N   +VD++EKLPVPFGLVR+GVAPDHPEVKNVIN+FTQ AR++   F GNV +G+D+ ++EL+  YH +VL++GA   +++GIPGE+L  V+SA D VGWYNGLP+     PDL+ + AVI+G GNVALDIARILL+PVDIL+KTDI    L  L++SR++ + +VGRRGPLQVAFTIKELRE+INL   + K+   +   L  +   +LPRP+KRL  L+++  L++ G+    + +   + W + FL+ P A+        +   +R  +  ++G     +   +G+  ++SC L+  SIGY+  +I   +PF   + +IPN  G+V E +             LYC GW+KRGP GVI  T++D+ +T+  IL+D  +  ++ S P      + +LL  +G + +SF +WE +D  ET  G   GKPREK+ +  EM+
Sbjct:   51 VGSGPAGFYTAQHILRHNPQAQVDIYEKLPVPFGLVRFGVAPDHPEVKNVINTFTQTARSERCTFLGNVTVGRDVTVEELQGAYHAVVLSYGAEDKRELGIPGEELPGVHSARDFVGWYNGLPDNRHLHPDLSCDTAVILGQGNVALDIARILLSPVDILRKTDITQTALDALSQSRIRRVWMVGRRGPLQVAFTIKELREMINLPGTRPKLDPADYVGLE-KASKDLPRPRKRLTELLVKAALEKPGQKVAANWAQAEREWGLRFLRSPLAVLPSEDGKRAAR-IRLSVTRLEGSGETAVAVPTGQVENISCGLIFSSIGYKSVSISSTVPFLPQQGVIPNSMGRV-EGIPG-----------LYCSGWVKRGPTGVITTTMTDSFDTAQAILEDVQLGALNWSEPRPGSVAIRELLHLRGIQPVSFSDWEKIDEAETAKGLAVGKPREKILDTEEML 495          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Xenopus
Match: fdxr (ferredoxin reductase [Source:NCBI gene;Acc:100158651])

HSP 1 Score: 402.134 bits (1032), Expect = 1.737e-135
Identity = 205/459 (44.66%), Postives = 298/459 (64.92%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTD-SNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGE----LVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQD--MSNMDLSCPLDD---VSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ +L++N   +VD++EKLPVPFGLVR+GVAPDHPEVKNVIN+FTQ AR++   F GNV +G+D+ ++EL+  YH +VL++GA   +++GIPGE+L  V+SA D VGWYNGLP+     PDL+ + AVI+G GNVALDIARILL+PVDIL+KTDI    L  L++SR++ + +VGRRGPLQVAFTIKELRE+INL   + K+   +   L  +   +LPRP+KRL  L+++  L++ G+    + +   + W + FL+ P A+        +   +R  +  ++G     +   +G+  ++SC L+  SIGY+  +I   +PF   + +IPN  G+V E +             LYC GW+KRGP GVI  T++D+ +T+  IL+D  +  ++ S P      + +LL  +G + +SF +WE +D  ET  G   GKPREK+ +  EM+
Sbjct:   53 VGSGPAGFYTAQHILRHNPQAQVDIYEKLPVPFGLVRFGVAPDHPEVKNVINTFTQTARSERCTFLGNVTVGRDVTVEELQGAYHAVVLSYGAEDKRELGIPGEELPGVHSARDFVGWYNGLPDNRHLHPDLSCDTAVILGQGNVALDIARILLSPVDILRKTDITQTALDALSQSRIRRVWMVGRRGPLQVAFTIKELREMINLPGTRPKLDPADYVGLE-KASKDLPRPRKRLTELLVKAALEKPGQKVAANWAQAEREWGLRFLRSPLAVLPSEDGKRAAR-IRLSVTRLEGSGETAVAVPTGQVENISCGLIFSSIGYKSVSISSTVPFLPQQGVIPNSMGRV-EGIPG-----------LYCSGWVKRGPTGVITTTMTDSFDTAQAILEDVQLGALNWSEPRPGSVAIRELLHLRGIQPVSFSDWEKIDEAETAKGLAVGKPREKILDTEEML 497          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Xenopus
Match: fdxr (ferredoxin reductase [Source:NCBI gene;Acc:100158651])

HSP 1 Score: 402.905 bits (1034), Expect = 2.529e-135
Identity = 205/459 (44.66%), Postives = 298/459 (64.92%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTD-SNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGE----LVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQD--MSNMDLSCPLDD---VSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ +L++N   +VD++EKLPVPFGLVR+GVAPDHPEVKNVIN+FTQ AR++   F GNV +G+D+ ++EL+  YH +VL++GA   +++GIPGE+L  V+SA D VGWYNGLP+     PDL+ + AVI+G GNVALDIARILL+PVDIL+KTDI    L  L++SR++ + +VGRRGPLQVAFTIKELRE+INL   + K+   +   L  +   +LPRP+KRL  L+++  L++ G+    + +   + W + FL+ P A+        +   +R  +  ++G     +   +G+  ++SC L+  SIGY+  +I   +PF   + +IPN  G+V E +             LYC GW+KRGP GVI  T++D+ +T+  IL+D  +  ++ S P      + +LL  +G + +SF +WE +D  ET  G   GKPREK+ +  EM+
Sbjct:   92 VGSGPAGFYTAQHILRHNPQAQVDIYEKLPVPFGLVRFGVAPDHPEVKNVINTFTQTARSERCTFLGNVTVGRDVTVEELQGAYHAVVLSYGAEDKRELGIPGEELPGVHSARDFVGWYNGLPDNRHLHPDLSCDTAVILGQGNVALDIARILLSPVDILRKTDITQTALDALSQSRIRRVWMVGRRGPLQVAFTIKELREMINLPGTRPKLDPADYVGLE-KASKDLPRPRKRLTELLVKAALEKPGQKVAANWAQAEREWGLRFLRSPLAVLPSEDGKRAAR-IRLSVTRLEGSGETAVAVPTGQVENISCGLIFSSIGYKSVSISSTVPFLPQQGVIPNSMGRV-EGIPG-----------LYCSGWVKRGPTGVITTTMTDSFDTAQAILEDVQLGALNWSEPRPGSVAIRELLHLRGIQPVSFSDWEKIDEAETAKGLAVGKPREKILDTEEML 536          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Mouse
Match: Fdxr (ferredoxin reductase [Source:MGI Symbol;Acc:MGI:104724])

HSP 1 Score: 380.948 bits (977), Expect = 1.835e-127
Identity = 208/460 (45.22%), Postives = 293/460 (63.70%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETG-EFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGELVSDSGKTV------DMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDM-SNMDLSCPLDD---VSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ LLK++ +  VD++EK  VPFGLVR+GVAPDHPEVKNVIN+FTQ AR+    F GNV +G+D+ + ELRE YH +VL++GA   + +GIPGE+L  V SA   VGWYNGLPE +   PDL+ + AVI+G GNVALD+ARILLTP + L+KTDI +  L  L +SR+K + +VGRRGPLQVAFTIKELRE+I L   +  I+ P+      + I ++PRP++RL  L++ T  ++ G E     +  S+ W + F + P+ +     +   V  +R  + +++G  V +S + V      D+ C LL+ S+GY+   IDP +PFD    +IPN  G+V+            +   LYC GW+KRGP GVI  T++D+  TS  +L+D+ + +  S P      +  LL+++G + +SF +WE LD  E   G+  GKPREKL +  EM+
Sbjct:   46 VGSGPAGFYTAQHLLKHHTHAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFQGNVVVGRDVSVPELREAYHAVVLSYGAEDHQPLGIPGEELPGVVSARAFVGWYNGLPENQELAPDLSCDTAVILGQGNVALDVARILLTPPEHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTR-PILDPSDFLGLQDRIKDVPRPRRRLTELLLRTATEKPGVEEAARQALASRAWGLRFFRSPQQVLP-TPDGQRVAGIRLAVTSLEG--VGESTRAVPTGDVEDLPCGLLLSSVGYKSRPIDPSVPFDPKLGVIPNTEGRVV------------NVPGLYCSGWVKRGPTGVITTTMTDSFLTSQALLEDLKAGLLPSGPRPGYVAIQALLSNRGVRPVSFSDWEKLDAEEVSRGQGTGKPREKLVDRREML 489          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. UniProt/SwissProt
Match: sp|P82861|ADRO_SALFO (NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Salvelinus fontinalis OX=8038 GN=fdxr PE=2 SV=1)

HSP 1 Score: 434.106 bits (1115), Expect = 2.625e-147
Identity = 219/465 (47.10%), Postives = 303/465 (65.16%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDSNFS-KNWFMHFLKYPRAIY---DGVSNPGSVDFVRFGINNIQGE----LVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDM--SNMDLSC---PLDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAA 1432
            VG GPA FYTAQ L+K   +++VD++E+LPVPFGLVR+GVAPDHPEVKNVIN+FTQ AR+    F GNV +GKD+ ++EL+E YH +VL++GA  ++ MG+PGEDL  VYSA D VGWYNGLP      PDL+ E AVI+G GNVALD+AR+LL+PVDILKKTDI  H L  LAES ++ + +VGRRGPLQVA TIKELRE++NL   + ++   ++ +   E + +L RP+KRL  L+++  ++  GE  L   N + + W   FL+ P  +    D +   G    +R  +N ++G+        +G+  D+ C L+I SIGY+   IDP +PFD  + IIPN  G+V               + LYC GW+KRGP GVI  T++D+ +T+ T+LQD+    +D+S        VS LL  +G K +SF +WE +D  ET  GE +GKPREK+ ++ EM+  A
Sbjct:   49 VGGGPAGFYTAQHLVKTRTDVQVDIYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTARHARCSFHGNVRVGKDVTVEELQEAYHAVVLSYGAEGNRTMGVPGEDLAGVYSAKDFVGWYNGLPRNRELRPDLSCETAVILGQGNVALDVARMLLSPVDILKKTDITQHALDALAESSVRRVLIVGRRGPLQVACTIKELREMVNLPGTRPEME-ASEFEGIAETLKSLARPRKRLTELLLKAAIETPGEEELEKRNKAERAWGFRFLRRPLEVLPSTDLIRAAG----IRLAVNRLEGDGEGVRAVATGEVEDVECGLVISSIGYKSLPIDPAVPFDGRKAIIPNTMGRV------------QQTAGLYCSGWVKRGPTGVIATTMNDSFDTARTLLQDIGKGTLDVSSVKPGSQGVSALLEKRGVKPVSFSDWEKIDSEETRRGETRGKPREKMLDVGEMLQVA 496          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. UniProt/SwissProt
Match: sp|P22570|ADRO_HUMAN (NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=3)

HSP 1 Score: 387.497 bits (994), Expect = 3.256e-129
Identity = 209/461 (45.34%), Postives = 287/461 (62.26%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFN-LTDSNFSKNWFMHFLKYPRAIY---DGVSNPGSVDFVRFGINNIQG----ELVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDM-SNMDLSCP---LDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ LLK+ Q   VD++EK PVPFGLVR+GVAPDHPEVKNVIN+FTQ A +    F+GNV +G+D+ + ELRE YH +VL++GA   + + IPGE+L  V SA   VGWYNGLPE +   PDL+ + AVI+G GNVALD+ARILLTP + L++TDI    L  L +SR+K + LVGRRGPLQVAFTIKELRE+I L   +  I+ P       + I  +PRP+KRL  L++ T  ++ G       ++ S+ W + F + P+ +    DG    G    VR  +  ++G         +G   D+ C L++ SIGY+   +DP +PFD+   +IPN+ G+V++               LYC GW+KRGP GVI  T++D+  T   +LQD+ + +  S P      +  LL+S+G + +SF +WE LD  E   G+  GKPREKL +  EM+
Sbjct:   44 VGSGPAGFYTAQHLLKHPQA-HVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGAR-PILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAG----VRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPG------------LYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEML 486          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. UniProt/SwissProt
Match: sp|P56522|ADRO_RAT (NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fdxr PE=1 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 3.821e-129
Identity = 209/460 (45.43%), Postives = 289/460 (62.83%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETG-EFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGELVSDSGKTV------DMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDM-SNMDLSCP---LDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ LLK++    VD++EK  VPFGLVR+GVAPDHPEVKNVIN+FTQ AR+    F GNV +G+D+ + ELRE YH +VL++GA   + + IPGE+L  V SA   VGWYNGLPE +   PDL+ + AVI+G GNVALD+ARILLTP + L+KTDI +  L  L +SR+K + +VGRRGPLQVAFTIKELRE+I L   +  I+ P+      + I ++PRP+KRL  L++ T  ++ G E     +  S+ W + F + P+ +     +   V  +R  +  ++G  V +S + V      D+ C LL+ S+GY+   IDP +PFD    IIPN  G+V+            +   LYC GW+KRGP GVI  T++D+  TS  +L+D+ + +  S P      +  LL+ +G + +SF +WE LD  E   G+  GKPREKL +  EM+
Sbjct:   46 VGSGPAGFYTAQHLLKHHTRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFRGNVVVGRDVSVPELREAYHAVVLSYGAEDHQPLEIPGEELPGVVSARAFVGWYNGLPENQKLAPDLSCDTAVILGQGNVALDVARILLTPPEHLEKTDITEVALGVLRQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTQ-PILDPSDFLGLQDRIKDVPRPRKRLTELLLRTATEKPGVEEAARRALASRAWGLRFFRSPQQVLP-TPDGRRVAGIRLAVTRLEG--VGESTRAVPTGDVEDLPCGLLLSSVGYKSRPIDPSVPFDPKLGIIPNTEGRVV------------NAPGLYCSGWVKRGPTGVITTTMTDSFLTSQVLLKDLKAGLLPSGPRPGYTAIQALLSDRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDRREML 489          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. UniProt/SwissProt
Match: sp|P08165|ADRO_BOVIN (NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Bos taurus OX=9913 GN=FDXR PE=1 SV=3)

HSP 1 Score: 386.341 bits (991), Expect = 1.083e-128
Identity = 206/461 (44.69%), Postives = 285/461 (61.82%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETG-EFNLTDSNFSKNWFMHFLKYPRAIY---DGVSNPGSVDFVRFGINNIQG----ELVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDL-SCPLDD---VSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ LLK++    VD++EK  VPFGLVR+GVAPDHPEVKNVIN+FTQ AR+    F+GNV +G+D+ ++EL++ YH +VL++GA   + + IPGE+L  V+SA   VGWYNGLPE     PDL+ + AVI+G GNVALD+ARILLTP D L+KTDI +  L  L +SR+K + +VGRRGPLQVAFTIKELRE+I L   +  +   +   L  + I    RP+KRL+ L++ T  ++ G E     ++ S+ W + F + P+ +    DG    G    +R  +  ++G         +G   D+ C L++ SIGY+   IDP +PFD    ++PN+ G+V++               LYC GW+KRGP GVI  T++D+  T   +LQD+    L S P      +  LL S+G   +SF +WE LD  E   G+  GKPREKL +  EM+
Sbjct:   44 VGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPMLDPADFLGLQ-DRIKEAARPRKRLMELLLRTATEKPGVEEAARRASASRAWGLRFFRSPQQVLPSPDGRRAAG----IRLAVTRLEGIGEATRAVPTGDVEDLPCGLVLSSIGYKSRPIDPSVPFDPKLGVVPNMEGRVVDVPG------------LYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEKLDAEEVSRGQASGKPREKLLDPQEML 487          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q61578|ADRO_MOUSE (NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Mus musculus OX=10090 GN=Fdxr PE=1 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 1.284e-126
Identity = 208/460 (45.22%), Postives = 293/460 (63.70%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETG-EFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGELVSDSGKTV------DMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDM-SNMDLSCPLDD---VSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ LLK++ +  VD++EK  VPFGLVR+GVAPDHPEVKNVIN+FTQ AR+    F GNV +G+D+ + ELRE YH +VL++GA   + +GIPGE+L  V SA   VGWYNGLPE +   PDL+ + AVI+G GNVALD+ARILLTP + L+KTDI +  L  L +SR+K + +VGRRGPLQVAFTIKELRE+I L   +  I+ P+      + I ++PRP++RL  L++ T  ++ G E     +  S+ W + F + P+ +     +   V  +R  + +++G  V +S + V      D+ C LL+ S+GY+   IDP +PFD    +IPN  G+V+            +   LYC GW+KRGP GVI  T++D+  TS  +L+D+ + +  S P      +  LL+++G + +SF +WE LD  E   G+  GKPREKL +  EM+
Sbjct:   46 VGSGPAGFYTAQHLLKHHTHAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFQGNVVVGRDVSVPELREAYHAVVLSYGAEDHQPLGIPGEELPGVVSARAFVGWYNGLPENQELAPDLSCDTAVILGQGNVALDVARILLTPPEHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTR-PILDPSDFLGLQDRIKDVPRPRRRLTELLLRTATEKPGVEEAARQALASRAWGLRFFRSPQQVLP-TPDGQRVAGIRLAVTSLEG--VGESTRAVPTGDVEDLPCGLLLSSVGYKSRPIDPSVPFDPKLGVIPNTEGRVV------------NVPGLYCSGWVKRGPTGVITTTMTDSFLTSQALLEDLKAGLLPSGPRPGYVAIQALLSNRGVRPVSFSDWEKLDAEEVSRGQGTGKPREKLVDRREML 489          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. TrEMBL
Match: A0A3B5KXN9 (NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Xiphophorus couchianus OX=32473 PE=3 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 2.435e-147
Identity = 220/466 (47.21%), Postives = 312/466 (66.95%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNL-TDSNFSKNWFMHFLKYPRAIYDGVSNPGS--VDFVRFGINNIQGELVSDSGKTV------DMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSN--MDLSCP---LDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAA 1432
            +GSGPA FYTAQ L+K  Q+++VD++E+LPVPFGLVR+GVAPDHPEVKNVIN+FTQ A++    F+GNVN+GKD+ + EL+  YH +VL++GA  +++MG+PGEDL  VYSA D VGWYNGLP      PDL+ E AVI+G GNVALD+ARILL+P DILKKTDI    L  LAESR++ + +VGRRGP+QVA TIKELRE++NL   + ++V  +   ++ E + ++PRP+KRL  L+++T L   G+  L    N +K W   F + P  I   +++PG      +R  +N ++G    D+ + V      D+SC L+I SIGY+   IDP +PFD+ R ++PN  G+V               + LYC GW+K GP GVI  T++++ +T+ ++L+DM +  +D+S        VS LL  +G K ++F +WE +D +ET  GE +GKPREKL ++ EM+ AA
Sbjct:    6 IGSGPAGFYTAQHLIKACQDVEVDIYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTAKHSRCSFYGNVNVGKDVTVGELQGAYHAVVLSYGAEGNRRMGVPGEDLPGVYSAKDFVGWYNGLPSCRELKPDLSCETAVILGQGNVALDVARILLSPSDILKKTDIAQPALEALAESRVRKVLIVGRRGPMQVACTIKELREMVNLPGTRPEMVTADFEGVS-EALKDVPRPRKRLTDLLLKTALDAPGDKELERRRNAAKVWGFLFYRSPTEI---LADPGCSRTAGIRLAVNRLEGS--GDAARAVLTGEVEDVSCGLVISSIGYKSLPIDPAVPFDSRRAVVPNSVGRV------------HQAAGLYCSGWLKTGPTGVIATTMNNSFDTARSLLEDMDSGALDVSAAKPGSQAVSSLLEERGVKPVTFSDWEKIDSLETRRGEARGKPREKLLSVEEMLKAA 453          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. TrEMBL
Match: A0A3B5A873 (NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Stegastes partitus OX=144197 PE=3 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 6.401e-147
Identity = 213/459 (46.41%), Postives = 308/459 (67.10%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDS-NFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGELVSD----SGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDM--SNMDLSCP---LDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMM 1423
            VGSGPA FYTAQ +LK  QN++VD++E+LPVPFGLVR+GVAPDHPEVKNVIN+FTQ A++    F+GNVN+GKD+ I EL++ YH +VL++GA  ++ MG+PGEDL  VYSA D VGWYNGLP      PDL+ E AVI+G GNVALD+ARILL+PVDILKKTDI    L  LAES+++ + +VGRRGP+Q+A TIKELRE++NL + + ++V  +   +  E + +LPRP+KRL  L+++T L++ GE         S+ W   F + P  +   ++N   V  +R  +N ++GE        +G+  D++C L++ SIGY+   IDP +PFD+ + I+PN+ G+V               + LYC GW+K GP GVI  T++++ +T+ ++++DM   ++D+S        +S LL  +G K ++F +WE +D +E   GE  GKPREK+  + EM+
Sbjct:   34 VGSGPAGFYTAQHILKARQNVEVDVYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTAKHSRCSFYGNVNVGKDVSIDELQQAYHAVVLSYGAEGNRSMGVPGEDLAGVYSAKDFVGWYNGLPNCRELSPDLSCETAVILGQGNVALDVARILLSPVDILKKTDITQPALEALAESQVRRVLIVGRRGPMQIACTIKELREMVNLPTTRPEMVAADFEGVT-EALKDLPRPRKRLTELMLKTALEKPGEKEQERRIKASRIWGFRFFRSPVEV---LANHNRVAGIRLAVNKLEGEGEGAQAVLTGEVEDVTCGLVVSSIGYKSLPIDPSVPFDSRKAIVPNVMGRV------------QQTAGLYCSGWLKTGPTGVIATTMNNSFDTARSVMEDMDSGSLDVSAAKPGSKSISALLEKRGIKPVTFSDWEKIDNVEMSRGEACGKPREKVLTVEEML 476          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. TrEMBL
Match: A0A3B5AIC2 (NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Stegastes partitus OX=144197 PE=3 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 1.059e-146
Identity = 214/462 (46.32%), Postives = 309/462 (66.88%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDS-NFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGELVSD----SGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDM--SNMDLSCP---LDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAA 1432
            VGSGPA FYTAQ +LK  QN++VD++E+LPVPFGLVR+GVAPDHPEVKNVIN+FTQ A++    F+GNVN+GKD+ I EL++ YH +VL++GA  ++ MG+PGEDL  VYSA D VGWYNGLP      PDL+ E AVI+G GNVALD+ARILL+PVDILKKTDI    L  LAES+++ + +VGRRGP+Q+A TIKELRE++NL + + ++V  +   +  E + +LPRP+KRL  L+++T L++ GE         S+ W   F + P  +   ++N   V  +R  +N ++GE        +G+  D++C L++ SIGY+   IDP +PFD+ + I+PN+ G+V               + LYC GW+K GP GVI  T++++ +T+ ++++DM   ++D+S        +S LL  +G K ++F +WE +D +E   GE  GKPREK+  + EM+  A
Sbjct:   41 VGSGPAGFYTAQHILKARQNVEVDVYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTAKHSRCSFYGNVNVGKDVSIDELQQAYHAVVLSYGAEGNRSMGVPGEDLAGVYSAKDFVGWYNGLPNCRELSPDLSCETAVILGQGNVALDVARILLSPVDILKKTDITQPALEALAESQVRRVLIVGRRGPMQIACTIKELREMVNLPTTRPEMVAADFEGVT-EALKDLPRPRKRLTELMLKTALEKPGEKEQERRIKASRIWGFRFFRSPVEV---LANHNRVAGIRLAVNKLEGEGEGAQAVLTGEVEDVTCGLVVSSIGYKSLPIDPSVPFDSRKAIVPNVMGRV------------QQTAGLYCSGWLKTGPTGVIATTMNNSFDTARSVMEDMDSGSLDVSAAKPGSKSISALLEKRGIKPVTFSDWEKIDNVEMSRGEACGKPREKVLTVEEMLQVA 486          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. TrEMBL
Match: M4AE54 (NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Xiphophorus maculatus OX=8083 PE=3 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 3.670e-146
Identity = 221/467 (47.32%), Postives = 313/467 (67.02%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNL-TDSNFSKNWFMHFLKYPRAIYDGVSNPGS--VDFVRFGINNIQGELVSDSGKTV------DMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSL-LYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSN--MDLSCP---LDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAA 1432
            VGSGPA FYTAQ L+K  Q+++VD++E+LPVPFGLVR+GVAPDHPEVKNVIN+FTQ A+N    F+GNVN+GKD+ + EL+  YH +VL++GA  ++++G+PGEDL  VYSA D VGWYNGLP      PDL+ E AVI+G GNVALD+ARILL+P DILKKTDI    L  LAESR++ + +VGRRGP+QVA TIKELRE++NL   + ++V  +   ++ E + ++PRP+KRL  L+++  L   G+  L    N +K W   F + P  I   +++PG      +R  +N ++G    D+ + V      D+SC L+I SIGY+   IDP +PFD+ R ++PN  G+V             H++  LYC GW+K GP GVI  T++++ +T+ ++L+DM +  +D+S        VS LL  +G K ++F +WE +D +ET  GE +GKPREKL ++ EM+ AA
Sbjct:   48 VGSGPAGFYTAQHLIKARQDVEVDIYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTAKNSRCSFYGNVNVGKDVTVCELQGAYHAVVLSYGAEGNRRIGVPGEDLPGVYSAKDFVGWYNGLPSCRELKPDLSCETAVILGQGNVALDVARILLSPSDILKKTDITQPALEALAESRVRKVLIVGRRGPMQVACTIKELREMVNLPGTRPEMVTADFEGVS-EALKDVPRPRKRLTELLLKMALDAPGDKELERRRNAAKVWGFLFYRSPTEI---LADPGCSRTAGIRLAVNRLEGS--GDAARAVLTGEVEDVSCGLVISSIGYKSLPIDPAVPFDSRRAVVPNSVGRV-------------HQAAGLYCSGWLKTGPTGVIATTMNNSFDTARSLLEDMDSGALDVSAAKPGSQAVSSLLEERGVKPVTFSDWEKIDSLETRRGEARGKPREKLLSVEEMLKAA 495          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. TrEMBL
Match: A0A3Q2E0K1 (NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Cyprinodon variegatus OX=28743 PE=3 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 7.769e-146
Identity = 222/464 (47.84%), Postives = 308/464 (66.38%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLN--PEVINNLPRPKKRLISLIMETFLKETGEFNL-TDSNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGE----LVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSN--MDLSCPLDD---VSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAA 1432
            VGSGPA FYTAQ L+K  Q+++VD++E+LPVPFGLVR+GVAPDHPEVKNVIN+FTQ A++    F+GNVN+GKD+ I EL++ YH +VL++GA  +++MGIPGEDL  VYSA D VGWYNGLP      PDL+ E AVI+G GNVALD+ARILL+P+DILKKTDI    L  LAESR++ + +VGRRGP+QVA TIKELRE++NL   + +++    AD    PE + ++ RP+KRL  L+++T L+  G+  L    N +K W   F + P  I     N   +  +R  +N ++G         +G+  D+SC L+I SIGY+   IDP +PFD  R I+PN  G+V               + LYC GW+K GP GVI  T++++ +T+ ++L+DM +  +D+S        VS LL  +G K ++F +WE +D +ET  G+ +GKPREKL  + EM+ AA
Sbjct:   48 VGSGPAGFYTAQHLIKARQDVEVDIYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTAKHPRCSFYGNVNVGKDVTISELQQAYHAVVLSYGAEGNRRMGIPGEDLPGVYSAKDFVGWYNGLPSCRELNPDLSCETAVILGQGNVALDVARILLSPLDILKKTDITQPALEALAESRVQKVLIVGRRGPMQVACTIKELREMVNLPGTRPEML---AADFEGIPEALKDVARPRKRLTELLLKTALEAPGDKELERRKNATKVWGFRFYRSPTEILS-EPNLNRMSGIRLAVNRLEGSGDGAQAVLTGEVEDVSCGLVISSIGYRSLPIDPTVPFDPHRAIVPNSLGRV------------PQAAGLYCSGWLKTGPTGVIATTMNNSFDTARSLLEDMESGTLDVSPARTGSQVVSRLLEERGVKPVTFSDWEKIDSLETKRGDARGKPREKLLTVEEMLTAA 495          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001655.1 (pep scaffold:Pmarinus_7.0:GL476581:340985:349076:1 gene:ENSPMAG00000001491.1 transcript:ENSPMAT00000001655.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 296.975 bits (759), Expect = 1.669e-98
Identity = 143/283 (50.53%), Postives = 201/283 (71.02%), Query Frame = 2
Query:  119 LKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLN--PEVINNLPRPKKRLISLIMETFLKETGEFNLTDSNFSKNWFMHFLKYPRAIY--DGVSNPGSVDFVRFGINNIQ 955
            +++ Q ++VDMFE+LPVPFGLVR+GVAPDHPEVKNVIN+FTQ AR++ FRF GNV +G+D+ ++ELR  YH IVL++GA  D+ +GIPGEDL+ VYSA D VGWYNGLP  +   PDL+ +  V++G GNVALD+ARILL+P+  L+KTDI    L  +  SR++ + L GRRGPLQVAFTIKELRE+I+L   +  I   N AD +   + +++LPRP+KRL  L+++   ++       ++   + W + FL+ P +I   DG ++P  V  VRF +N ++
Sbjct:    1 VQHQQAVRVDMFERLPVPFGLVRFGVAPDHPEVKNVINTFTQTARSERFRFLGNVTVGRDVSVEELRHAYHAIVLSYGAEDDRALGIPGEDLRGVYSARDFVGWYNGLPHNKDLNPDLSCDTVVVLGQGNVALDVARILLSPISWLQKTDITQPALEAITRSRVRKVVLAGRRGPLQVAFTIKELREMIHLPDTRAVI---NPADFDGFKDALSSLPRPRKRLSELLLKAATEQRSRDPAVEAG-GREWELLFLRSPTSIVASDGGASP-HVAAVRFTVNQLE 278          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Yeast
Match: ARH1 (Oxidoreductase of the mitochondrial inner membrane; involved in cytoplasmic and mitochondrial iron homeostasis and required for activity of Fe-S cluster-containing enzymes; one of the few mitochondrial proteins essential for viability [Source:SGD;Acc:S000002784])

HSP 1 Score: 211.075 bits (536), Expect = 6.605e-63
Identity = 165/487 (33.88%), Postives = 245/487 (50.31%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQ-NIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVA--------RNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGE-DLKQVYSAIDMVGWYNGLPE--KESFCPDLTGEEAV---IIGHGNVALDIARILLTPV--DILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVI-------NNLPRPKKRLISLIMETFLKETGEFNLTD--------SNFSKNWFMHFLKYPRAIYD---GVSNPGSVDFVRFGINNIQGELVSDSGKTVDMSCQLLIRSIGYQGFNIDP----DIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPLDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEM 1420
            VGSGP+ FYTA  LLK +   + V ++EKLPVPFGL RYGVAPDHPEVKN   +FT  A        +   F F G + IGK++ +KEL +    ++L++G T D+K+ IPGE   K V+S+ + V WYNG P+  K+    D    +     IIG+GNVALDI R+L++    +I + TDI    L+ L  + +K++ L+ RR  +   FT KELREL  LE    +        ++P+         +   R   R + +  E +LK   E +  +        S + K W + +LK P  I     G  N  S+   R   +N    L  D    +     LLI S+GY G  +       I FD D   I N  G+V+    T + +   H   LY  GWI++G  GVI +T+ DA E    ++QD+  +  +  L++  DL      K+ ++ +WE +++ E   G+K+ K R K     E+
Sbjct:   21 VGSGPSGFYTAYHLLKKSPIPLNVTIWEKLPVPFGLSRYGVAPDHPEVKNCEETFTTCAEEFSSPTNQKHKFSFVGGITIGKEILLKELLDNQDAVILSYGCTGDRKLNIPGELGTKGVFSSREFVNWYNGHPDFAKDKRFTDFDWSKVSKVGIIGNGNVALDITRVLISNQIDEIWENTDISSLALNLLRRAPVKDVKLIARRDFVHSKFTNKELRELWELEKYGIR------GRIDPKFFQKEMFDPSKYDRAFNRRVEMCSE-YLKPFNERSKKNYKKAPPPSSGYDKFWELDYLKTPLKINRDDFGAINSLSLCNNRLNEDNSLQPL-KDVNNIMTYKVDLLITSLGYAGVPMPEFSKLSIGFDKDH--IANKQGRVL----TSSGEIFPH---LYASGWIRKGSQGVIASTMQDAFEVGDRVIQDLV-VSGALSLENSIDL---SNIKHTTWKDWERINKKELLRGKKEHKTRSKFLTFEEL 486          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Yeast
Match: GLT1 (NAD(+)-dependent glutamate synthase (GOGAT); synthesizes glutamate from glutamine and alpha-ketoglutarate; with Gln1p, forms the secondary pathway for glutamate biosynthesis from ammonia; expression regulated by nitrogen source; assembles into filaments as cells approach stationary phase and under cytosolic acidification and starvation conditions [Source:SGD;Acc:S000002330])

HSP 1 Score: 50.447 bits (119), Expect = 6.412e-7
Identity = 32/116 (27.59%), Postives = 57/116 (49.14%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMV 424
            +GSGPA    A  L  N     V ++E+     GL+ YG+ P+    K ++     +   +   F  N  IGK + + EL+  ++ +V A G+T  + + I G +LK +  A+ ++
Sbjct: 1788 IGSGPAGLACADML--NRAGHTVTVYERSDRCGGLLMYGI-PNMKLDKAIVQRRIDLLSAEGIDFVTNTEIGKTISMDELKNKHNAVVYAIGSTIPRDLPIKGRELKNIDFAMQLL 1900          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Nematostella
Match: EDO44879 (NADPH:adrenodoxin oxidoreductase, mitochondrial [Source:UniProtKB/TrEMBL;Acc:A7RUM6])

HSP 1 Score: 396.741 bits (1018), Expect = 1.010e-134
Identity = 201/462 (43.51%), Postives = 294/462 (63.64%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFL-KETGEFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINN-IQGELVS----DSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPLD----DVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAA 1432
            VG+GPA FYTA ++LK +++  VD++E+LPVP GL R+G+APDHPE KN IN FT  A++   RF GNV++G+D+ + EL++ Y  +V+++GA  DK  GIPGE L  VY+A   VGWYNGLPE  +  PDL+ + AV++GHGNVALD+ARILL P+  L+KTDI +H L  L +S++K ++LVGRRGPLQVAFT+KELRE+  L  V+  +  P       +++  + RP+KRL  L+++T L K T +     +  ++ W + FL+ P  +       G V  +R  +N  I+G   S     +  T D+SC +++RSIGY+   ID  IPFD+ R +IP   G+VI         S++    LYC GW+  GPVGVI  T++DA+ T   +++D+++   +         V  LL+S+G + +SF  WE +D++E   GE KGKPREK+ ++ EMM  A
Sbjct:    6 VGAGPAGFYTAHQILKLHKSAHVDVYERLPVPHGLARFGIAPDHPETKNCINQFTSTAKSPRCRFVGNVHVGQDITLSELQQSYDAVVMSYGAEDDKIFGIPGEGLSGVYAARAFVGWYNGLPENRNLAPDLSSDTAVVLGHGNVALDVARILLAPIKFLEKTDICEHALDALRKSQVKKVYLVGRRGPLQVAFTVKELREMTKLAGVRA-VFSPGDVAPIKDLLPTIARPRKRLTELMVKTALDKSTPQEQERQAAATREWEVKFLRSPVEVLPTPDGTG-VAGIRLQVNKLIEGANSSVRAVGTDVTEDISCGIVLRSIGYKSQPIDESIPFDHKRGVIPTNKGRVI---------SDAIVPGLYCSGWVGHGPVGVIATTMNDAYATGQAVVEDINSGKTAESSTKGFLSVQTLLSSRGVRTVSFTQWERIDQLEIKRGESKGKPREKIVSVEEMMSIA 456          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Nematostella
Match: EDO29182 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4D1])

HSP 1 Score: 227.639 bits (579), Expect = 1.075e-70
Identity = 128/343 (37.32%), Postives = 197/343 (57.43%), Query Frame = 2
Query:  458 FCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFL-KETGEFNLTDSNFSKNWFMHFLKYPRAIY---DGVSNPGSVDFVRFGINNI----QGELVS-DSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCP---------LDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAA 1432
              PDL+ +  V++GHGNVALD+ARILL P+  L+KTDI +H L  L +S++K ++LVGRRGPLQVAFT+KELRE+  L  V+  +  P       +++  + RP+KRL  L+++T L K T +     +  ++ W + FL+ P  +    DG+   G    +R  +N +    +G + +  +  T D+SC +++RSIGY+   ID  IPFD+ R +IP   G+VI         S +    LYC GW+  GPVGVI  T++DA+ T   +++D+++               + D   +    G + +SF  WE +D++E   GE KGKPREK+ ++ EMM  A
Sbjct:    2 LAPDLSSDTVVVLGHGNVALDVARILLAPIKFLEKTDICEHALDALRKSQVKKVYLVGRRGPLQVAFTVKELREMTKLAGVRA-VFSPGDVAPIKDLLPTIARPRKRLTELMVKTALDKSTPQEQERQAAATREWEVKFLRSPVEVLPTPDGMGVAG----IRLQVNKLVEGAKGSVRAVGTDVTEDISCGIVLRSIGYKSQPIDESIPFDHKRGVIPTNKGRVI---------SGAIVPGLYCSGWVGHGPVGVIATTMNDAYATGQAVVEDINSGKTEAQTMFSHRAIVMFDSHSIF--PGVRTVSFTQWERIDQLEIKRGESKGKPREKIVSVEEMMSIA 328          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Nematostella
Match: EDO38711 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC78])

HSP 1 Score: 59.3066 bits (142), Expect = 2.793e-9
Identity = 47/182 (25.82%), Postives = 84/182 (46.15%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCP--DLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKN 616
            +GSGPA    A +L  N    KV ++EK     GL+ YG+ P     K ++     +   +   F     +G+D+   +L      +++A G+T  + + IPG  L+ V+ A++ +         +   P  D TG+  ++IG G+  +D    + T V    K+ +   +L++  ESR  N
Sbjct: 1440 IGSGPAGLSAAVQL--NKAGHKVTVYEKNDRCGGLLMYGI-PSMKLDKKIVQRRLNLMEQEGITFVTKSEVGRDVTANQLMADNDAVLMAVGSTWPRDLPIPGRSLEGVHFAMNFLETSQKRQMGDYSLPSLDATGKHVIVIGGGDTGVD---CIATSVRQDAKSIVTFELLAESPESRSPN 1615          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Nematostella
Match: EDO26058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD00])

HSP 1 Score: 50.0618 bits (118), Expect = 9.641e-7
Identity = 28/94 (29.79%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  143 VDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMV 424
            V +FE+     GL+RYG+ PD    K +I+   +V   +   F  N  +GK++ ++ ++  Y  +++  GAT+ + + I G  LK VY A++ +
Sbjct:    4 VTVFERDSKVGGLLRYGI-PDFKLEKQIIDRRVEVLIEEGIIFKTNAYVGKNISVETIKADYDAVLMCGGATERRGIPIKGNHLKGVYQAMEFL 96          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Medaka
Match: fdxr (ferredoxin reductase [Source:NCBI gene;Acc:101160395])

HSP 1 Score: 412.149 bits (1058), Expect = 1.063e-139
Identity = 207/462 (44.81%), Postives = 293/462 (63.42%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDSN-FSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGE----LVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPLDD-----VSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAA 1432
            VG GPA FYTAQ L+K  Q+++VD++E+LPVPFGLVR+GVAPDHPEVKNVIN+FTQ A++    F+GNVN+GKD+ + EL   YH +VL++GA  ++ +G+PGE L  VYSA D VGWYNGLP      PDL+ + AV++G GNVALD+ARILL+P+DILKKTDI    L  LA SR++++ +VGRRGP+QVA TIKELRE++ L   + ++  P+  +   + + +LPRP+KRL  L+++T L+  GE      N  S+ W   F + P  +         V  VR  +N ++G         SG   D+ C L+I SIGY+   ID  +PFD+ R I+PN  G+V + L             LYC GW+K GP GVI  T++++ +T+ ++++DM +  L    +      +  LL  KG + + F +WE +D +E   GE  GKPREKL ++ EM+  A
Sbjct:   46 VGGGPAGFYTAQHLIKARQDVQVDVYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTAKHSRCSFYGNVNVGKDVSVAELLRSYHAVVLSYGAEGNRSVGVPGEHLSGVYSAKDFVGWYNGLPSCRELDPDLSCDTAVVLGQGNVALDVARILLSPLDILKKTDITQPALDALAASRVRSVWIVGRRGPMQVACTIKELREMVTLPGTRPEMT-PSDFEGVKDALKDLPRPRKRLTELMVKTALERPGEKEQERWNSASRVWGFRFFRSPVEVLPDAEGK-KVAAVRLAVNRLEGSGEGAQAVRSGDVEDVPCGLVISSIGYKSLPIDAAVPFDSRRAIVPNSMGRVQQVLG------------LYCSGWLKTGPTGVIATTMNNSFDTARSLMEDMDSGKLDVSAEKPGSLRIRALLEEKGVEPVVFSDWEKIDSLEVRRGEACGKPREKLLSVEEMLAVA 493          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Planmine SMEST
Match: SMESG000050975.1 (SMESG000050975.1)

HSP 1 Score: 929.087 bits (2400), Expect = 0.000e+0
Identity = 452/457 (98.91%), Postives = 455/457 (99.56%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGELVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPLDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAATQVNK 1447
            VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPG VDFVRFGINNIQGELVSDSG+TVDMSCQL+IRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNN +NSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPLDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAATQVNK
Sbjct:    7 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGFVDFVRFGINNIQGELVSDSGETVDMSCQLVIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNNNNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPLDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTNIHEMMLAATQVNK 463          
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Planmine SMEST
Match: SMESG000050975.1 (SMESG000050975.1)

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 406/411 (98.78%), Postives = 409/411 (99.51%), Query Frame = 2
Query:   77 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQGELVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPLDDVSDLLTSK 1309
            VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPG VDFVRFGINNIQGELVSDSG+TVDMSCQL+IRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNN +NSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPLDDVSDLLTSK
Sbjct:    7 VGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDHPEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGATQDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGNVALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAFTIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFLKETGEFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGFVDFVRFGINNIQGELVSDSGETVDMSCQLVIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIEELSTDNNNNNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSNMDLSCPLDDVSDLLTSK 417          
The following BLAST results are available for this feature:
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FDXR4.052e-12945.12ferredoxin reductase [Source:HGNC Symbol;Acc:HGNC:... [more]
FDXR1.275e-12845.12ferredoxin reductase [Source:HGNC Symbol;Acc:HGNC:... [more]
FDXR1.150e-12644.33ferredoxin reductase [Source:HGNC Symbol;Acc:HGNC:... [more]
FDXR1.401e-12242.95ferredoxin reductase [Source:HGNC Symbol;Acc:HGNC:... [more]
FDXR5.002e-12241.15ferredoxin reductase [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y62E10A.69.966e-7735.43NADPH:adrenodoxin oxidoreductase, mitochondrial [... [more]
W07E11.17.454e-626.71pep chromosome:WBcel235:X:10084627:10104063:1 gene... [more]
W07E11.17.515e-626.71pep chromosome:WBcel235:X:10084627:10104252:1 gene... [more]
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dare5.369e-12141.37gene:FBgn0015582 transcript:FBtr0088176[more]
CG96743.051e-827.81gene:FBgn0036663 transcript:FBtr0333608[more]
CG96743.051e-827.81gene:FBgn0036663 transcript:FBtr0305916[more]
CG96743.240e-827.81gene:FBgn0036663 transcript:FBtr0075344[more]
CG96743.240e-827.81gene:FBgn0036663 transcript:FBtr0075341[more]
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fdxr1.508e-14346.07ferredoxin reductase [Source:ZFIN;Acc:ZDB-GENE-130... [more]
fdxr1.508e-14346.07ferredoxin reductase [Source:ZFIN;Acc:ZDB-GENE-130... [more]
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fdxr6.239e-13644.66ferredoxin reductase [Source:NCBI gene;Acc:1001586... [more]
fdxr7.918e-13644.66ferredoxin reductase [Source:NCBI gene;Acc:1001586... [more]
fdxr1.683e-13544.66ferredoxin reductase [Source:NCBI gene;Acc:1001586... [more]
fdxr1.737e-13544.66ferredoxin reductase [Source:NCBI gene;Acc:1001586... [more]
fdxr2.529e-13544.66ferredoxin reductase [Source:NCBI gene;Acc:1001586... [more]
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Fdxr1.835e-12745.22ferredoxin reductase [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P82861|ADRO_SALFO2.625e-14747.10NADPH:adrenodoxin oxidoreductase, mitochondrial OS... [more]
sp|P22570|ADRO_HUMAN3.256e-12945.34NADPH:adrenodoxin oxidoreductase, mitochondrial OS... [more]
sp|P56522|ADRO_RAT3.821e-12945.43NADPH:adrenodoxin oxidoreductase, mitochondrial OS... [more]
sp|P08165|ADRO_BOVIN1.083e-12844.69NADPH:adrenodoxin oxidoreductase, mitochondrial OS... [more]
sp|Q61578|ADRO_MOUSE1.284e-12645.22NADPH:adrenodoxin oxidoreductase, mitochondrial OS... [more]
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B5KXN92.435e-14747.21NADPH:adrenodoxin oxidoreductase, mitochondrial OS... [more]
A0A3B5A8736.401e-14746.41NADPH:adrenodoxin oxidoreductase, mitochondrial OS... [more]
A0A3B5AIC21.059e-14646.32NADPH:adrenodoxin oxidoreductase, mitochondrial OS... [more]
M4AE543.670e-14647.32NADPH:adrenodoxin oxidoreductase, mitochondrial OS... [more]
A0A3Q2E0K17.769e-14647.84NADPH:adrenodoxin oxidoreductase, mitochondrial OS... [more]
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001655.11.669e-9850.53pep scaffold:Pmarinus_7.0:GL476581:340985:349076:1... [more]
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ARH16.605e-6333.88Oxidoreductase of the mitochondrial inner membrane... [more]
GLT16.412e-727.59NAD(+)-dependent glutamate synthase (GOGAT); synth... [more]
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO448791.010e-13443.51NADPH:adrenodoxin oxidoreductase, mitochondrial [... [more]
EDO291821.075e-7037.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387112.793e-925.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260589.641e-729.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fdxr1.063e-13944.81ferredoxin reductase [Source:NCBI gene;Acc:1011603... [more]
back to top
BLAST of NADPH:adrenodoxin oxidoreductase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000050975.10.000e+098.91SMESG000050975.1[more]
SMESG000050975.10.000e+098.78SMESG000050975.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007434 ID=SMED30007434|Name=NADPH:adrenodoxin oxidoreductase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1478bp
TAAAATAATAGCATTTGATATTATTAGTTTATTTTTTAATAATTTGTGAA
TTATTTTAATGATAAGACTTGGAATTGTAGGCAGCGGTCCTGCTGCATTT
TATACTGCACAAAAGCTTTTAAAAAATAATCAAAATATAAAAGTTGATAT
GTTTGAAAAGTTACCTGTACCCTTTGGTCTTGTCCGATATGGCGTTGCCC
CAGATCACCCTGAAGTGAAAAATGTTATCAATTCATTTACTCAAGTAGCT
CGTAATAAGAATTTTCGATTTTTCGGCAATGTAAATATCGGTAAAGATCT
TCAAATAAAGGAATTACGAGAATTATATCATGGTATTGTTTTGGCTTTTG
GTGCAACCCAAGATAAGAAAATGGGTATTCCTGGAGAAGATTTAAAACAA
GTTTATTCAGCCATTGATATGGTAGGATGGTACAACGGATTGCCTGAAAA
AGAATCATTTTGCCCCGATCTGACCGGAGAAGAAGCGGTCATTATTGGCC
ACGGAAATGTAGCTCTCGATATCGCTCGAATTCTGCTAACTCCGGTGGAT
ATTTTGAAAAAAACCGATATCCCTGATCATGTGCTTTCGCAATTGGCTGA
AAGCCGGCTGAAAAATATCCATCTTGTCGGACGTAGAGGTCCTTTGCAAG
TCGCATTTACCATCAAGGAATTACGAGAGTTGATCAATTTGGAAAGTGTC
AAGTGTAAAATTGTGTTACCCAATCAAGCCGATCTGAATCCGGAGGTAAT
TAACAATTTGCCTCGACCAAAGAAAAGATTAATAAGTCTAATTATGGAAA
CTTTTCTAAAGGAAACTGGAGAATTTAATTTAACGGATTCTAATTTCAGT
AAAAATTGGTTCATGCATTTCCTGAAATATCCTAGAGCTATTTATGATGG
AGTTTCTAATCCTGGATCTGTCGACTTTGTGAGATTTGGAATAAATAATA
TCCAGGGTGAACTGGTTTCTGATTCTGGGAAAACTGTCGATATGTCTTGT
CAACTACTGATCCGGAGTATTGGCTATCAGGGTTTCAATATCGACCCTGA
TATTCCCTTTGATAACGATCGGAAAATCATTCCCAATATAAATGGAAAGG
TCATTGAAGAATTATCCACCGATAATAATAAAAGTAATTCCCATAAATCT
CTGTTGTATTGCGTCGGGTGGATCAAGCGCGGTCCGGTCGGTGTGATCCT
CAATACTCTGTCTGATGCTCATGAGACCAGCTCTACTATTTTGCAGGACA
TGAGCAACATGGATCTCAGCTGCCCATTGGACGATGTGAGCGATTTATTA
ACATCGAAGGGTACCAAATATTTGTCCTTTGTCAATTGGGAAGCTCTAGA
TAGAATTGAGACCGGTCTCGGCGAGAAAAAAGGGAAACCCAGAGAAAAGT
TAACGAATATTCACGAAATGATGTTGGCAGCTACACAAGTAAATAAATAG
AGCTCTTTTATTGGATAAAATATTTTTG
back to top

protein sequence of SMED30007434-orf-1

>SMED30007434-orf-1 ID=SMED30007434-orf-1|Name=SMED30007434-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=464bp
MIRLGIVGSGPAAFYTAQKLLKNNQNIKVDMFEKLPVPFGLVRYGVAPDH
PEVKNVINSFTQVARNKNFRFFGNVNIGKDLQIKELRELYHGIVLAFGAT
QDKKMGIPGEDLKQVYSAIDMVGWYNGLPEKESFCPDLTGEEAVIIGHGN
VALDIARILLTPVDILKKTDIPDHVLSQLAESRLKNIHLVGRRGPLQVAF
TIKELRELINLESVKCKIVLPNQADLNPEVINNLPRPKKRLISLIMETFL
KETGEFNLTDSNFSKNWFMHFLKYPRAIYDGVSNPGSVDFVRFGINNIQG
ELVSDSGKTVDMSCQLLIRSIGYQGFNIDPDIPFDNDRKIIPNINGKVIE
ELSTDNNKSNSHKSLLYCVGWIKRGPVGVILNTLSDAHETSSTILQDMSN
MDLSCPLDDVSDLLTSKGTKYLSFVNWEALDRIETGLGEKKGKPREKLTN
IHEMMLAATQVNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036188FAD/NAD-bd_sf
IPR016040NAD(P)-bd_dom
IPR021163Ferredox_Rdtase_adrenod
IPR023753FAD/NAD-binding_dom
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0015039NADPH-adrenodoxin reductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006629lipid metabolic process
GO:0008202steroid metabolic process
GO:0008203cholesterol metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00419ADXRDTASEcoord: 3..25
score: 44.41
coord: 28..41
score: 43.88
coord: 71..81
score: 47.4
coord: 143..157
score: 52.86
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 6..455
e-value: 3.1E-158
score: 529.3
NoneNo IPR availablePANTHERPTHR11938FAD NADPH DEHYDROGENASE/OXIDOREDUCTASEcoord: 3..455
NoneNo IPR availablePANTHERPTHR11938:SF91NADPH:ADRENODOXIN OXIDOREDUCTASE, MITOCHONDRIALcoord: 3..455
NoneNo IPR availableSUPERFAMILYSSF51971Nucleotide-binding domaincoord: 3..323
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 40..323
e-value: 3.1E-158
score: 529.3
IPR021163Ferredoxin-NADP+ reductase, adrenodoxin-typePIRSFPIRSF000362FNRcoord: 1..461
e-value: 2.1E-158
score: 525.6
IPR023753FAD/NAD(P)-binding domainPFAMPF07992Pyr_redox_2coord: 6..159
e-value: 2.7E-8
score: 33.4