Synaptotagmin-1

Overview
NameSynaptotagmin-1
Smed IDSMED30007426
Length (bp)1584
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin-1 (SMED30007426) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin-1 (SMED30007426) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin-1 (SMED30007426) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin-1 (SMED30007426) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007426

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30007426h1SMcG0017657 SmedASXL_013312SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30007426h1SMcG0017657 Contig38266newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007426h1SMcG0017657 Contig38266uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30007426h1SMcG0017657 dd_Smed_v4_19328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007426h1SMcG0017657 dd_Smed_v4_19328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30007426h1SMcG0017657 dd_Smed_v4_19328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30007426h1SMcG0017657 dd_Smed_v6_19328_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30007426h1SMcG0017657 OX_Smed_1.0.12599ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin-1 vs. Ensembl Human
Match: SYT9 (synaptotagmin 9 [Source:HGNC Symbol;Acc:HGNC:19265])

HSP 1 Score: 112.079 bits (279), Expect = 8.764e-26
Identity = 112/454 (24.67%), Postives = 208/454 (45.81%), Query Frame = 1
Query:  190 IIVIAAGISIALIGV---IAGVLIWIFHRKRKLRKETERMLNEKSNLVFPQNGVGQTQQTFEEIRQCMMESPSPTDPQYLG--------PRSSFAGY--NLPKKVHTYGSISDSLSICRTESYKSRKTSTDSGI--------ASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSL--VWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            ++V A G+  AL GV   ++  L W+  R+R L   ++    E  N +        T+   +E  +  ++ P+P     +         P S+  G   N    V     +++  S  R  S + +   ++               GIG + P+LY++R          ++  CG L+F L Y      L+VKI +  N+ +           T + ++ I + P  D+K + QT + +   +PVF E F FP+ Y +L    L FS+YD +   +S+    G+  +   L+  D   E  +W D+  +  +  +  G+L+ SL YLP+A RLT+ I+KA+++   +I   +  Y V+V+     + +KK KT   K+++L  V+NE + F    E ++ I+  + ++  D  G+   IG   +G  +  R G +H+ +++   ++    WH++
Sbjct:   57 LVVTACGL--ALFGVSLFVSWKLCWVPWRERGLPSGSKDNNQEPLNYM-------DTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQTGIQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDF------SGTSDPYVKIYLLP--DRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLEARKLHFSVYDFDR--FSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNDNVDL-GELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPY-VKVSLMCDGRRLKKRKTS-TKRNTLNPVYNEAIVFDVPPENIDQIHLSIAVMDYDRVGHNEIIGVCQVGNEA-ERLGRDHWSEMLSYPRKPIAHWHSL 487          
BLAST of Synaptotagmin-1 vs. Ensembl Human
Match: SYT11 (synaptotagmin 11 [Source:HGNC Symbol;Acc:HGNC:19239])

HSP 1 Score: 103.605 bits (257), Expect = 4.034e-23
Identity = 86/290 (29.66%), Postives = 145/290 (50.00%), Query Frame = 1
Query:  625 SSPSASV-CGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKF-PIAY---EELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSM-EVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICES-KETFTMWHNI 1470
            SSP   V  G+L F + Y F    L+V I++ + +         +     + +I + + P    +++   L+K    PVF ETF F  I Y   ++L  H L  S    + +D      G   +PL  VDPS  +V++  D+I   ++K  +RG+L VSL+Y P A+R+T+V++KA+ +   +I   + +  V+VN +   K I K KT  +K   + ++NE   +    + L DI  +  +I  D       +G   LG HS + SG EH+ + +CES ++    WH++
Sbjct:  150 SSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGS-----DPYIKMTILPDKRHRVKTRVLRKT-LDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDV----IGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWRE-VCESPRKPVAKWHSL 428          
BLAST of Synaptotagmin-1 vs. Ensembl Human
Match: SYT3 (synaptotagmin 3 [Source:HGNC Symbol;Acc:HGNC:11511])

HSP 1 Score: 101.679 bits (252), Expect = 4.450e-22
Identity = 79/314 (25.16%), Postives = 151/314 (48.09%), Query Frame = 1
Query:  568 IGNVIPDLYQRRGTIIRRES---------SPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            IG + P+LYQ  GT               + + + CG + F L YL+ +  L+V+I Q  ++ +  ++  +      + ++ I + P   +K  QT + +   +PVF ETF+F +   EL    L FS+YD +   +S+    G+  +   L   +   +  +W D++    EK +  G+L  SL YLP+A RLT+ I+KA ++   ++   +  Y V+ +   + + +KK KT  +K   +  +NE + F    E + ++   + ++  D  G+   IG   +G  +    G EH+ +++   ++    WH +
Sbjct:  267 IGQIKPELYQ--GTGPGGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFS------DPYVKIYLLPDRKKKF-QTKVHRKTLNPVFNETFQFSVPLAELAQRKLHFSVYDFDR--FSRHDLIGQVVLDNLLELAEQPPDRPLWRDIVEGGSEKADL-GELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPY-VKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPDAADPHGREHWAEMLANPRKPVEHWHQL 567          
BLAST of Synaptotagmin-1 vs. Ensembl Human
Match: SYT3 (synaptotagmin 3 [Source:HGNC Symbol;Acc:HGNC:11511])

HSP 1 Score: 101.679 bits (252), Expect = 4.450e-22
Identity = 79/314 (25.16%), Postives = 151/314 (48.09%), Query Frame = 1
Query:  568 IGNVIPDLYQRRGTIIRRES---------SPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            IG + P+LYQ  GT               + + + CG + F L YL+ +  L+V+I Q  ++ +  ++  +      + ++ I + P   +K  QT + +   +PVF ETF+F +   EL    L FS+YD +   +S+    G+  +   L   +   +  +W D++    EK +  G+L  SL YLP+A RLT+ I+KA ++   ++   +  Y V+ +   + + +KK KT  +K   +  +NE + F    E + ++   + ++  D  G+   IG   +G  +    G EH+ +++   ++    WH +
Sbjct:  267 IGQIKPELYQ--GTGPGGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFS------DPYVKIYLLPDRKKKF-QTKVHRKTLNPVFNETFQFSVPLAELAQRKLHFSVYDFDR--FSRHDLIGQVVLDNLLELAEQPPDRPLWRDIVEGGSEKADL-GELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPY-VKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPDAADPHGREHWAEMLANPRKPVEHWHQL 567          
BLAST of Synaptotagmin-1 vs. Ensembl Human
Match: SYT3 (synaptotagmin 3 [Source:HGNC Symbol;Acc:HGNC:11511])

HSP 1 Score: 101.679 bits (252), Expect = 4.450e-22
Identity = 79/314 (25.16%), Postives = 151/314 (48.09%), Query Frame = 1
Query:  568 IGNVIPDLYQRRGTIIRRES---------SPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            IG + P+LYQ  GT               + + + CG + F L YL+ +  L+V+I Q  ++ +  ++  +      + ++ I + P   +K  QT + +   +PVF ETF+F +   EL    L FS+YD +   +S+    G+  +   L   +   +  +W D++    EK +  G+L  SL YLP+A RLT+ I+KA ++   ++   +  Y V+ +   + + +KK KT  +K   +  +NE + F    E + ++   + ++  D  G+   IG   +G  +    G EH+ +++   ++    WH +
Sbjct:  267 IGQIKPELYQ--GTGPGGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFS------DPYVKIYLLPDRKKKF-QTKVHRKTLNPVFNETFQFSVPLAELAQRKLHFSVYDFDR--FSRHDLIGQVVLDNLLELAEQPPDRPLWRDIVEGGSEKADL-GELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPY-VKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPDAADPHGREHWAEMLANPRKPVEHWHQL 567          
BLAST of Synaptotagmin-1 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 80.8777 bits (198), Expect = 3.852e-16
Identity = 66/277 (23.83%), Postives = 133/277 (48.01%), Query Frame = 1
Query:  649 GNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQ-KFGRATIPLNTVDPSMEVEIWLDMIII--ELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            G + +KL Y F+   L V + Q  ++             T + ++ + + P   +K+     +K   +PVF ETF F +A+ E+    L F++YD +   +SK  + G+  IPL  +D    +E W D+     + E  ++ G +  SL Y+P+A +LT+VI++AK++   ++   +  Y+  V     +++ KK  +  +   +  +NE  +F+   E++  +   + ++  D  G+   IG   LG +    + + H+ D++   +     WH +
Sbjct:  161 GRIQYKLDYDFQQGQLTVTVIQAEDLPGMDM------SGTSDPYVKLYLLPEKKKKVETKVHRKT-LNPVFNETFIFKVAFNEITAKTLVFAIYDFDR--FSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTG-AELRHWMDMLASPRRPIAQWHTL 427          
BLAST of Synaptotagmin-1 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 80.1073 bits (196), Expect = 8.404e-16
Identity = 71/280 (25.36%), Postives = 136/280 (48.57%), Query Frame = 1
Query:  649 GNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQ-KFGRATIPLNTVDPSMEVEIWLDMIII--ELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQF--DKEKIIKKHKTGCQKQDSLVWNEVMAF-KFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            G + +KL Y F+   L V + Q  ++     S       T + ++ + + P   +K+     +K   +PVF ETF F +A+ E+    L F++YD +   +SK  + G+  IPL  +D    +E W D+     + E  ++ G +  SL Y+P+A +LT+VI++AK++   ++   +  Y V++  F  D++++ KK     +K  +  +NE   F K    K+  +   + ++  D  G+   IG   LG +    + + H+ D++   +     WH +
Sbjct:  161 GRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMS------GTSDPYVKLYLLPEKKKKVETKVHRKT-LNPVFNETFIFKVAFNEITAKTLVFAIYDFDR--FSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPY-VKLEMFGEDRKRLKKKKTNIKRKTLNPYFNESFVFDKLPLHKMKKVSLMITVMDYDKLGSNDAIGRCLLGCNGTG-AELRHWMDMLASPRRPIAQWHTL 429          
BLAST of Synaptotagmin-1 vs. Ensembl Celegans
Match: snt-2 (Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:K8FE10])

HSP 1 Score: 77.0258 bits (188), Expect = 4.672e-15
Identity = 71/286 (24.83%), Postives = 137/286 (47.90%), Query Frame = 1
Query:  649 GNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYD---LNEEDYSKQKFGRATIPLNTVDPSMEVEIWLDMIIIELE-KRETR-GQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQ-KQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGT-HSN----SRSGMEHFYDIICESKETFTMWHNIQ 1473
            GN+HF++ Y F+ S L V I       S+            + ++ + + P   QK  +T + +N  +P + ETF+F I + EL++  L   +YD   L+++D    K G+ ++PL ++D  +  +I   +   E + ++E R G +  S  Y P+   +TL IM+A+++   ++   +  Y V++      K++ K KT  + K  +  +NE   FK     +  ++  V +   D       IG+ +LG+ H N    + +  E + +++  S+     WH +Q
Sbjct:   85 GNIHFRVEYDFEQSKLSVTI------VSASDLPAMDRNGMSDPYVKVYVLPERKQKF-ETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDD----KMGQLSVPLESIDFGITTDIERPLQKPEKDDEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPY-VKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSKHLNLPQITHACSEQWAEMMT-SRRPVVQWHTLQ 357          
BLAST of Synaptotagmin-1 vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 72.0182 bits (175), Expect = 8.725e-14
Identity = 63/274 (22.99%), Postives = 128/274 (46.72%), Query Frame = 1
Query:  649 GNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            G L +KL Y F  + L V I Q   + +           T + ++ + + P   +K+ QT +++   +PVF E+F F I + E+    L  +++D +      Q  G+ +IPL  VD +  +E      +IE       G++ ++L Y+P+  +L++V+M+ K++   ++   +  Y+        +++ KK  T   K  +  +NE  +F    EK+  ++  V +   D  G+   IG   +GT +     ++ + D++   + +   WH +
Sbjct:   17 GRLQYKLDYDFDKNSLTVVIIQAEELPAMDL------GGTSDPYVKLFLLPDKKKKL-QTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQ-IGQISIPLGKVDLAATLE---RTDLIESPPENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGTCATG-VALKQWNDMLATPRRSVAQWHTL 278          
BLAST of Synaptotagmin-1 vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 72.0182 bits (175), Expect = 8.725e-14
Identity = 63/274 (22.99%), Postives = 128/274 (46.72%), Query Frame = 1
Query:  649 GNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            G L +KL Y F  + L V I Q   + +           T + ++ + + P   +K+ QT +++   +PVF E+F F I + E+    L  +++D +      Q  G+ +IPL  VD +  +E      +IE       G++ ++L Y+P+  +L++V+M+ K++   ++   +  Y+        +++ KK  T   K  +  +NE  +F    EK+  ++  V +   D  G+   IG   +GT +     ++ + D++   + +   WH +
Sbjct:   17 GRLQYKLDYDFDKNSLTVVIIQAEELPAMDL------GGTSDPYVKLFLLPDKKKKL-QTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQ-IGQISIPLGKVDLAATLE---RTDLIESPPENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGTCATG-VALKQWNDMLATPRRSVAQWHTL 278          
BLAST of Synaptotagmin-1 vs. Ensembl Fly
Match: Sytbeta (gene:FBgn0261090 transcript:FBtr0299848)

HSP 1 Score: 120.939 bits (302), Expect = 7.475e-29
Identity = 84/316 (26.58%), Postives = 154/316 (48.73%), Query Frame = 1
Query:  529 KTSTDSGIASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQ 1473
            +   D  +  +  +G + PDLY+     +   +  S+   G LH ++ Y +   DL V + + +N+S              + ++ + + P VD + RQT + + + +P F + FKFP++ ++L    L   + D +   YS     G   I ++ +D S  VEIW D++  + + +E R +LL SLNYLP AERLT+VIMKA+++   +  ++    +  +    + K  K   T      + +WNE   F      L++   ++ ++    +  E  IG   LG    S +G +H++D+I  +++   MWH I+
Sbjct:  246 QPGVDPAMGPASPLGALQPDLYRMPDGPVYLTAPESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFR------DPYVRLMLQPEVDSRKRQTHIHRGESNPYFDQHFKFPVSRDQLQGKELILQVLDYDR--YSHNDIIGEVRISVDGLDLSKSVEIWGDLLRTK-KPKEDRPELLCSLNYLPQAERLTVVIMKARNL---DTLQEPYVKIYLIQNGKRIKKKKTSITKSDDPTNPIWNEAFTFNLQSNYLHNAAIEIYVVGAGSEATE--IGCCGLGP-QESGTGCQHWHDMINNARKPTAMWHYIR 546          
BLAST of Synaptotagmin-1 vs. Ensembl Fly
Match: Sytbeta (gene:FBgn0261090 transcript:FBtr0299849)

HSP 1 Score: 120.553 bits (301), Expect = 1.308e-28
Identity = 84/316 (26.58%), Postives = 154/316 (48.73%), Query Frame = 1
Query:  529 KTSTDSGIASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQ 1473
            +   D  +  +  +G + PDLY+     +   +  S+   G LH ++ Y +   DL V + + +N+S              + ++ + + P VD + RQT + + + +P F + FKFP++ ++L    L   + D +   YS     G   I ++ +D S  VEIW D++  + + +E R +LL SLNYLP AERLT+VIMKA+++   +  ++    +  +    + K  K   T      + +WNE   F      L++   ++ ++    +  E  IG   LG    S +G +H++D+I  +++   MWH I+
Sbjct:  302 QPGVDPAMGPASPLGALQPDLYRMPDGPVYLTAPESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFR------DPYVRLMLQPEVDSRKRQTHIHRGESNPYFDQHFKFPVSRDQLQGKELILQVLDYDR--YSHNDIIGEVRISVDGLDLSKSVEIWGDLLRTK-KPKEDRPELLCSLNYLPQAERLTVVIMKARNL---DTLQEPYVKIYLIQNGKRIKKKKTSITKSDDPTNPIWNEAFTFNLQSNYLHNAAIEIYVVGAGSEATE--IGCCGLGP-QESGTGCQHWHDMINNARKPTAMWHYIR 602          
BLAST of Synaptotagmin-1 vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0343993)

HSP 1 Score: 92.8189 bits (229), Expect = 8.221e-20
Identity = 71/286 (24.83%), Postives = 137/286 (47.90%), Query Frame = 1
Query:  622 ESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKF-PIAYEELYTHLLTFSLYDLNEEDYSKQ-KFGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQ 1473
            E   S    G L+FKL Y F ++ L V + Q   + +           T + ++ + + P   +K  +T + +   SPVF ETF F  + Y +     L F+++D +   +SK  + G   +PL T+D +  +E W D++ +E E  +  G +  SL Y+P+A +LT+VI++AK++   ++   +  Y+      + +++ KK  +  +   +  +NE  +F+   E++  I   V ++  D  G    IG   LG      + + H+ D++   +     WH ++
Sbjct:  185 EDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMG------GTSDPYVKVYLLPDKKKKF-ETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDR--FSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTG-TELRHWSDMLASPRRPIAQWHTLK 460          
BLAST of Synaptotagmin-1 vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077726)

HSP 1 Score: 90.5077 bits (223), Expect = 4.471e-19
Identity = 72/287 (25.09%), Postives = 138/287 (48.08%), Query Frame = 1
Query:  622 ESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKF-PIAYEELYTHLLTFSLYDLNEEDYSKQ-KFGRATIPLNTVDPSMEVEIWLDMIIIELE-KRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQ 1473
            E   S    G L+FKL Y F ++ L V + Q   + +           T + ++ + + P   +K  +T + +   SPVF ETF F  + Y +     L F+++D +   +SK  + G   +PL T+D +  +E W D++ +E E  +E  G +  SL Y+P+A +LT+VI++AK++   ++   +  Y+      + +++ KK  +  +   +  +NE  +F+   E++  I   V ++  D  G    IG   LG      + + H+ D++   +     WH ++
Sbjct:  185 EDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMG------GTSDPYVKVYLLPDKKKKF-ETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDR--FSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTG-TELRHWSDMLASPRRPIAQWHTLK 461          
BLAST of Synaptotagmin-1 vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077728)

HSP 1 Score: 90.5077 bits (223), Expect = 5.594e-19
Identity = 72/287 (25.09%), Postives = 138/287 (48.08%), Query Frame = 1
Query:  622 ESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKF-PIAYEELYTHLLTFSLYDLNEEDYSKQ-KFGRATIPLNTVDPSMEVEIWLDMIIIELE-KRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQ 1473
            E   S    G L+FKL Y F ++ L V + Q   + +           T + ++ + + P   +K  +T + +   SPVF ETF F  + Y +     L F+++D +   +SK  + G   +PL T+D +  +E W D++ +E E  +E  G +  SL Y+P+A +LT+VI++AK++   ++   +  Y+      + +++ KK  +  +   +  +NE  +F+   E++  I   V ++  D  G    IG   LG      + + H+ D++   +     WH ++
Sbjct:  183 EDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMG------GTSDPYVKVYLLPDKKKKF-ETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDR--FSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTG-TELRHWSDMLASPRRPIAQWHTLK 459          
BLAST of Synaptotagmin-1 vs. Ensembl Zebrafish
Match: syt9b (synaptotagmin IXb [Source:ZFIN;Acc:ZDB-GENE-040822-6])

HSP 1 Score: 110.923 bits (276), Expect = 1.595e-25
Identity = 84/307 (27.36%), Postives = 156/307 (50.81%), Query Frame = 1
Query:  565 GIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-FGRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            G+G + P+LY++R   +  +    A  CG LHF + Y      L+VKI +  ++ +   +       T + ++ I + P  D+K + QT + +   +P+F E F FP+AY EL T  L FS+YD +   +S+    G+  +   L+  D   E  +  D++ +  +  +  G L+ SL YLP+A RLT+ I+KA+++   +I   +  Y V+V+     + +KK KT  ++   + V+NE + F    E ++ I   + ++  D  G+   IG   +G  + S  G +H+ +++   ++    WH +
Sbjct:  201 GLGRIKPELYKQRS--VDTDDGRRADSCGRLHFIIKYDCDLEQLIVKIHRAQDLPAKDFT------GTSDPYVKIYLLP--DRKTKHQTKVHRKTLNPIFDEVFLFPVAYGELPTRKLHFSVYDFDR--FSRHDVIGQVVVDNFLDLPDFPQETRLCRDILYVSADNVDL-GDLMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPY-VKVSIMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVGHNEVIGICHVGNRAPS-LGRDHWNEMLTYPRKPIARWHQL 492          
BLAST of Synaptotagmin-1 vs. Ensembl Zebrafish
Match: syt9a (synaptotagmin IXa [Source:ZFIN;Acc:ZDB-GENE-031002-18])

HSP 1 Score: 109.383 bits (272), Expect = 6.933e-25
Identity = 87/311 (27.97%), Postives = 156/311 (50.16%), Query Frame = 1
Query:  556 SSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSL--VWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            + + +G + P+LY++R        S     CG LHF L Y      L+VKI +  ++ +           T + ++ I + P  D+K + QT + +   +PVF E F FP+AY +L T  L FS+YD +   +S+    G+  +   L+ VD   E ++  D+  +  +  +  G L+ SL YLP+A RLT+ ++KA+++   +I   +  Y V+V+     + +KK KT   K+++L  V+NE + F    E ++ I   V ++  D  G+   IG   +G  +    G EH+ +++   ++    WH +
Sbjct:  227 TGMSLGQLKPELYKQRSLDGEDSRSSRVGSCGRLHFILKYDCDLEQLIVKIHRAQDLPAKDF------SGTSDPYVKIYLLP--DRKTKHQTKVHRKTLNPVFDEVFLFPVAYADLPTRKLHFSVYDFDR--FSRHDIIGQVVVDNFLDLVDFPRETKLCRDIQYVSSDNVDL-GDLMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPY-VKVSLMCDGRRLKKRKTS-TKRNTLNPVYNEAIVFDVPPENIDQISLLVAVMDYDRVGHNEVIGVCRVGNDAEGL-GREHWNEMLTYPRKPIAHWHPL 523          
BLAST of Synaptotagmin-1 vs. Ensembl Zebrafish
Match: CR381655.1 (synaptotagmin III [Source:NCBI gene;Acc:100000615])

HSP 1 Score: 103.99 bits (258), Expect = 2.876e-23
Identity = 85/322 (26.40%), Postives = 159/322 (49.38%), Query Frame = 1
Query:  568 IGNVIPDLYQ-RRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPS---MEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQRDL*ENI*NPYLLVF 1518
            IG + P+LY+ R+G    +      + CG + F L Y F T  L+VKI +  ++ +  A+  +      + ++ I + P   +K  QT + +   +PVF ETF+F +   EL+   L FS+YD +   +S+       +  N +D S    E  IW D++    EK +  G+L  SL YLP+A RLT+ I+KA ++   ++   +  Y V+ +   + + +KK KT  +K   +  +NE + F    E +  +   + ++  D  G+   IG   +G+ ++   G EH+  ++   ++    WH +  D    + +P+ +++
Sbjct:  183 IGQIKPELYRLRQGD---QGDGKQGNNCGKISFLLRYAFNTEQLVVKILKALDLPAKDANGFS------DPYVKIYLLPDRKKKF-QTKVHRKTLNPVFNETFQFGVPLAELHARKLHFSVYDFDR--FSRHDLIGQVVVDNLLDFSEGTGEKPIWRDIVEGTAEKADL-GELNFSLCYLPTAGRLTVTIIKATNLKAMDLTGFSDPY-VKASLVCEGRRLKKRKTSIKKNTLNPTYNEALVFDIPNENIESVSLIIAVMDYDCIGHNEVIGMCRMGSDADG-PGREHWTAMLANPRKPIEHWHQLVEDADTEVEDPHAVLY 489          
BLAST of Synaptotagmin-1 vs. Ensembl Zebrafish
Match: syt3 (synaptotagmin III [Source:ZFIN;Acc:ZDB-GENE-090601-1])

HSP 1 Score: 100.138 bits (248), Expect = 5.356e-22
Identity = 83/306 (27.12%), Postives = 151/306 (49.35%), Query Frame = 1
Query:  568 IGNVIPDLYQ-RRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPS---MEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            IG + P+LY+ R+G    +      + CG + F L Y F T  L+VKI +  ++ +  A+  +      + ++ I + P   +K  QT + +   +PVF ETF+F +   EL+   L FS+YD +   +S+       +  N +D S    E  IW D++    EK +  G+L  SL YLP+A RLT+ I+KA ++   ++   +  Y V+ +   + + +KK KT  +K   +  +NE + F    E +  +   + ++  D  G+   IG   +G+ ++   G EH+  ++   ++    WH +
Sbjct:  207 IGQIKPELYRLRQGD---QGDGKQGNNCGKISFLLRYAFNTEQLVVKILKALDLPAKDANGFS------DPYVKIYLLPDRKKKF-QTKVHRKTLNPVFNETFQFGVPLAELHARKLHFSVYDFDR--FSRHDLIGQVVVDNLLDFSEGTGEKPIWRDIVEGTAEKADL-GELNFSLCYLPTAGRLTVTIIKATNLKAMDLTGFSDPY-VKASLVCEGRRLKKRKTSIKKNTLNPTYNEALVFDIPNENIESVSLIIAVMDYDCIGHNEVIGMCRMGSDADG-PGREHWTAMLANPRKPIEHWHQL 497          
BLAST of Synaptotagmin-1 vs. Ensembl Zebrafish
Match: CR381655.1 (synaptotagmin III [Source:NCBI gene;Acc:100000615])

HSP 1 Score: 99.7525 bits (247), Expect = 5.586e-22
Identity = 83/306 (27.12%), Postives = 151/306 (49.35%), Query Frame = 1
Query:  568 IGNVIPDLYQ-RRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPS---MEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            IG + P+LY+ R+G    +      + CG + F L Y F T  L+VKI +  ++ +  A+  +      + ++ I + P   +K  QT + +   +PVF ETF+F +   EL+   L FS+YD +   +S+       +  N +D S    E  IW D++    EK +  G+L  SL YLP+A RLT+ I+KA ++   ++   +  Y V+ +   + + +KK KT  +K   +  +NE + F    E +  +   + ++  D  G+   IG   +G+ ++   G EH+  ++   ++    WH +
Sbjct:  188 IGQIKPELYRLRQGD---QGDGKQGNNCGKISFLLRYAFNTEQLVVKILKALDLPAKDANGFS------DPYVKIYLLPDRKKKF-QTKVHRKTLNPVFNETFQFGVPLAELHARKLHFSVYDFDR--FSRHDLIGQVVVDNLLDFSEGTGEKPIWRDIVEGTAEKADL-GELNFSLCYLPTAGRLTVTIIKATNLKAMDLTGFSDPY-VKASLVCEGRRLKKRKTSIKKNTLNPTYNEALVFDIPNENIESVSLIIAVMDYDCIGHNEVIGMCRMGSDADG-PGREHWTAMLANPRKPIEHWHQL 478          
BLAST of Synaptotagmin-1 vs. Ensembl Xenopus
Match: SYT9 (synaptotagmin 9 [Source:NCBI gene;Acc:100497543])

HSP 1 Score: 106.301 bits (264), Expect = 8.010e-24
Identity = 85/305 (27.87%), Postives = 153/305 (50.16%), Query Frame = 1
Query:  565 GIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-FGRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWH 1464
            GIG + P+LY+++          ++  CG L+F + Y      L+VKI +  N+ +           T + ++ I + P  D+K + QT + +   +PVF E F FP+ Y +L T  L FS+YD +   +S+    G+  +   L+  D   E  IW D+  +  +  +  G L+ SL YLP+A RLT+ I+KA+++   +I   +  Y V+V+   + + +KK KT  ++   + V+NE + F    E ++ I   + ++  D  G+   IG   +G  + S  G EH+ +++   ++    WH
Sbjct:  192 GIGRIKPELYKQKSVETDDGRRNNSKSCGKLNFIIKYDCDLEKLIVKIHKAVNLPAKDF------SGTSDPYVKIYLLP--DRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLPTRKLHFSVYDFDR--FSRHDVIGQVIVDNFLDLADFPRESNIWRDIEHVTNDNVDL-GDLMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPY-VKVSIMCEGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVGHNEVIGICQVGNDAESL-GREHWSEMLSYPRKPIAHWH 483          
BLAST of Synaptotagmin-1 vs. Ensembl Xenopus
Match: wnt6 (Wnt family member 6 [Source:Xenbase;Acc:XB-GENE-486077])

HSP 1 Score: 99.3673 bits (246), Expect = 1.768e-21
Identity = 78/314 (24.84%), Postives = 154/314 (49.04%), Query Frame = 1
Query:  541 DSGIASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            D     +  IG + P+LY++R      +    A+ CG + F L Y + +  L+VKI +   + +  A+  +      + ++ + + P   +K  QT + +   +P+F ETF F + + EL    L FS+YD +   +S+    G+  +   L   + + E  IW D++    EK +  G++  SL YLP+A RLT  I+KA ++   ++   +  Y V+ +   + + +KK KT  +K   +  +NE + F    E ++ +   + ++  D  G+   IG   +G+ ++ + G EH+ +++   ++    WH +
Sbjct:  214 DEKPEQATSIGQIKPELYKQRSADAEMKKQ-EATSCGRISFILRYAYNSEQLVVKILKALELPAKDANGFS------DPYVKMYLLPDRKKKF-QTKVHRKTLNPIFNETFHFNVPFNELQNRKLHFSIYDFDR--FSRHDLIGQVVLDNLLEFSNATDETPIWRDILEASSEKADL-GEINFSLCYLPTAGRLTATIIKATNLKAMDLTGFSDPY-VKASLICEGRRLKKRKTSIKKNTLNPTYNEALVFDIPNENMDHVSLTIAVMDYDCIGHNEVIGMCRVGSDADMQ-GREHWNEMLANPRKPIEHWHQL 514          
BLAST of Synaptotagmin-1 vs. Ensembl Xenopus
Match: luzp2 (leucine zipper protein 2 [Source:Xenbase;Acc:XB-GENE-940667])

HSP 1 Score: 90.5077 bits (223), Expect = 7.502e-19
Identity = 60/222 (27.03%), Postives = 115/222 (51.80%), Query Frame = 1
Query:  811 QKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQ 1473
            +K  +T + +   +P+F ETF F I Y+EL    L  S+YD +   +SK    G   +P+NTVD    +E W D+   E E+ E  G + +SL Y+P+A +LT+ I++AK++   ++   +  Y+      + +++ KK  T  +K  +  +NE  +F+   E++  +   + ++  D  G    IG   +G ++ S + + H+ D++   +     WH ++
Sbjct:  194 KKKHETKVHRKTLNPIFNETFTFKIPYQELGGKTLCMSIYDFDR--FSKHDIIGEVKVPMNTVDLGQPIEEWRDLQSAEKEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVITVLDYDKLGKNEAIGKIFVGCNA-SGTELRHWSDMLANPRRPIAQWHPLK 412          
BLAST of Synaptotagmin-1 vs. Ensembl Xenopus
Match: e2f4 (E2F transcription factor 4 [Source:Xenbase;Acc:XB-GENE-482721])

HSP 1 Score: 89.7373 bits (221), Expect = 1.151e-18
Identity = 72/285 (25.26%), Postives = 135/285 (47.37%), Query Frame = 1
Query:  619 RESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-FGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            +E        G L + L Y F+ + LMV I Q   + +           T + ++ + + P   +K  +T + +   +PVF E F F + Y EL    L  ++YD +   +SK    G   +P+NTVD     E W D++  E E++E  G +  SL Y+P+A +LT+VI++AK++   ++   +  Y+      + +++ KK  T  +   +  +NE  +F+   E++  +   V ++  D  G    IG   +G +S   + + H+ D++   +     WH +
Sbjct:  137 KEQPKEVEKLGKLQYSLDYDFQNNQLMVGIIQAAELPALDMG------GTSDPYVKLFLMPDKKKKF-ETKVHRKTLNPVFNEQFTFKVPYAELGGKTLVLTVYDFDR--FSKHDVIGDVKVPMNTVDFGHVTEEWRDLVSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTG-AELRHWSDMLANPRRPIAQWHTL 411          
BLAST of Synaptotagmin-1 vs. Ensembl Xenopus
Match: cfap100 (cilia and flagella associated protein 100 [Source:Xenbase;Acc:XB-GENE-991284])

HSP 1 Score: 87.4261 bits (215), Expect = 6.325e-18
Identity = 64/236 (27.12%), Postives = 125/236 (52.97%), Query Frame = 1
Query:  778 FITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSME-VEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQRD 1479
            F+ I + P  +Q +  + ++ N +S +F ETF  P+    L  + L FS++ ++ +D  K   G A + L+ +D ++     W+ +  +  +  +T G++L+SL+YLP+AERLT+V++K ++++     +      V+V      + I K KT  ++ D + V+NE M F      L ++  ++ + +    G   NIG   +G  S S  GM H+  ++   ++  +MWH I+++
Sbjct:  184 FVHISLLPD-EQIVGISRIQGNAYSVMFDETFSIPLDPLALEENSLKFSIFGIDGDD-RKVSTGVAELKLSDLDLALRPFNTWIYLQDVN-KATDTVGEILLSLSYLPTAERLTVVVVKVRNLLWTE-GKTTADPFVKVYLLQDGRKISKKKTAVKRDDRNPVFNEAMIFSVPAIVLQELSLRITVAECCEDGRAENIGHVIIGP-STSGMGMTHWNQMLATLRKPVSMWHQIRQN 414          
BLAST of Synaptotagmin-1 vs. Ensembl Mouse
Match: Syt9 (synaptotagmin IX [Source:MGI Symbol;Acc:MGI:1926373])

HSP 1 Score: 109.383 bits (272), Expect = 5.371e-25
Identity = 85/308 (27.60%), Postives = 156/308 (50.65%), Query Frame = 1
Query:  565 GIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSL--VWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            GIG + P+LY++R          ++  CG L+F L Y      L+VKI +  N+ +           T + ++ I + P  D+K + QT + +   +PVF E F FP+ Y +L    L FS+YD +   +S+    G+  +    +  D   E  +W D+  +  +  +  G+L+ SL YLP+A RLT+ I+KA+++   +I   +  Y V+V+     + +KK KT   K+++L  V+NE + F    E ++ I+  + ++  D  G+   IG   +G  +  R G +H+ +++   ++    WH++
Sbjct:  194 GIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDF------SGTSDPYVKIYLLP--DRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDR--FSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDL-GELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPY-VKVSLMCDGRRLKKRKTS-TKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEA-ERLGRDHWSEMLSYPRKPIAHWHSL 487          
BLAST of Synaptotagmin-1 vs. Ensembl Mouse
Match: Syt11 (synaptotagmin XI [Source:MGI Symbol;Acc:MGI:1859547])

HSP 1 Score: 104.375 bits (259), Expect = 6.898e-24
Identity = 89/291 (30.58%), Postives = 146/291 (50.17%), Query Frame = 1
Query:  625 SSPSASV-CGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKF-PIAY---EELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSM-EVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLS-YLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICES-KETFTMWHNI 1470
            SSP   V  G+L F + Y F    L+V I++ + +         +     + +I + + P    +++   L+K    PVF ETF F  I Y   ++L  H L  S    + +D      G   +PL  VDPS  +V++  D+I   ++K  +RG+L VSL+Y P A+R+T+V++KA+   +P ++   LS   V+VN +   K I K KT  +K   + V+NE   +    + L DI  +  +I  D       +G   LG HS + SG EH+ + +CES ++    WH++
Sbjct:   83 SSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGS-----DPYIKMTILPDKRHRVKTRVLRKT-LDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDV----IGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARH--LPKMDITGLSDPYVKVNVYYGRKRIAKKKTHVKKCTLNPVFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEHWRE-VCESPRKPIAKWHSL 360          
BLAST of Synaptotagmin-1 vs. Ensembl Mouse
Match: Syt11 (synaptotagmin XI [Source:MGI Symbol;Acc:MGI:1859547])

HSP 1 Score: 103.99 bits (258), Expect = 1.723e-23
Identity = 87/290 (30.00%), Postives = 145/290 (50.00%), Query Frame = 1
Query:  625 SSPSASV-CGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKF-PIAY---EELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSM-EVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICES-KETFTMWHNI 1470
            SSP   V  G+L F + Y F    L+V I++ + +         +     + +I + + P    +++   L+K    PVF ETF F  I Y   ++L  H L  S    + +D      G   +PL  VDPS  +V++  D+I   ++K  +RG+L VSL+Y P A+R+T+V++KA+ +   +I   + +  V+VN +   K I K KT  +K   + V+NE   +    + L DI  +  +I  D       +G   LG HS + SG EH+ + +CES ++    WH++
Sbjct:  149 SSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGS-----DPYIKMTILPDKRHRVKTRVLRKT-LDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDV----IGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPVFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEHWRE-VCESPRKPIAKWHSL 427          
BLAST of Synaptotagmin-1 vs. Ensembl Mouse
Match: Syt11 (synaptotagmin XI [Source:MGI Symbol;Acc:MGI:1859547])

HSP 1 Score: 103.99 bits (258), Expect = 1.723e-23
Identity = 87/290 (30.00%), Postives = 145/290 (50.00%), Query Frame = 1
Query:  625 SSPSASV-CGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKF-PIAY---EELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSM-EVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICES-KETFTMWHNI 1470
            SSP   V  G+L F + Y F    L+V I++ + +         +     + +I + + P    +++   L+K    PVF ETF F  I Y   ++L  H L  S    + +D      G   +PL  VDPS  +V++  D+I   ++K  +RG+L VSL+Y P A+R+T+V++KA+ +   +I   + +  V+VN +   K I K KT  +K   + V+NE   +    + L DI  +  +I  D       +G   LG HS + SG EH+ + +CES ++    WH++
Sbjct:  149 SSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGS-----DPYIKMTILPDKRHRVKTRVLRKT-LDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDV----IGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPVFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEHWRE-VCESPRKPIAKWHSL 427          
BLAST of Synaptotagmin-1 vs. Ensembl Mouse
Match: Syt3 (synaptotagmin III [Source:MGI Symbol;Acc:MGI:99665])

HSP 1 Score: 99.7525 bits (247), Expect = 9.900e-22
Identity = 79/307 (25.73%), Postives = 150/307 (48.86%), Query Frame = 1
Query:  568 IGNVIPDLYQRRGTIIRRESSPSASV--CGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            IG + P+LYQ  G   RR      +   CG + F L YL+ +  L+V+I Q  ++ +  ++  +      + ++ I + P   +K  QT + +   +P+F ETF+F +   EL    L FS+YD +   +S+    G+  +   L   +   +  +W D++    EK +  G+L  SL YLP+A RLT+ I+KA ++   ++   +  Y V+ +   + + +KK KT  +K   +  +NE + F    E + ++   + ++  D  G+   IG   +G  +    G EH+ +++   ++    WH +
Sbjct:  269 IGQIKPELYQGTGPGGRRGGGSGEAGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFS------DPYVKIYLLPDRKKKF-QTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDR--FSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADL-GELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPY-VKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQL 564          
BLAST of Synaptotagmin-1 vs. UniProt/SwissProt
Match: sp|Q86SS6|SYT9_HUMAN (Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 4.209e-25
Identity = 112/454 (24.67%), Postives = 208/454 (45.81%), Query Frame = 1
Query:  190 IIVIAAGISIALIGV---IAGVLIWIFHRKRKLRKETERMLNEKSNLVFPQNGVGQTQQTFEEIRQCMMESPSPTDPQYLG--------PRSSFAGY--NLPKKVHTYGSISDSLSICRTESYKSRKTSTDSGI--------ASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSL--VWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            ++V A G+  AL GV   ++  L W+  R+R L   ++    E  N +        T+   +E  +  ++ P+P     +         P S+  G   N    V     +++  S  R  S + +   ++               GIG + P+LY++R          ++  CG L+F L Y      L+VKI +  N+ +           T + ++ I + P  D+K + QT + +   +PVF E F FP+ Y +L    L FS+YD +   +S+    G+  +   L+  D   E  +W D+  +  +  +  G+L+ SL YLP+A RLT+ I+KA+++   +I   +  Y V+V+     + +KK KT   K+++L  V+NE + F    E ++ I+  + ++  D  G+   IG   +G  +  R G +H+ +++   ++    WH++
Sbjct:   57 LVVTACGL--ALFGVSLFVSWKLCWVPWRERGLPSGSKDNNQEPLNYM-------DTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQTGIQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDF------SGTSDPYVKIYLLP--DRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLEARKLHFSVYDFDR--FSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNDNVDL-GELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPY-VKVSLMCDGRRLKKRKTS-TKRNTLNPVYNEAIVFDVPPENIDQIHLSIAVMDYDRVGHNEIIGVCQVGNEA-ERLGRDHWSEMLSYPRKPIAHWHSL 487          
BLAST of Synaptotagmin-1 vs. UniProt/SwissProt
Match: sp|Q9R0N9|SYT9_MOUSE (Synaptotagmin-9 OS=Mus musculus OX=10090 GN=Syt9 PE=1 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 3.757e-24
Identity = 85/308 (27.60%), Postives = 156/308 (50.65%), Query Frame = 1
Query:  565 GIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSL--VWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            GIG + P+LY++R          ++  CG L+F L Y      L+VKI +  N+ +           T + ++ I + P  D+K + QT + +   +PVF E F FP+ Y +L    L FS+YD +   +S+    G+  +    +  D   E  +W D+  +  +  +  G+L+ SL YLP+A RLT+ I+KA+++   +I   +  Y V+V+     + +KK KT   K+++L  V+NE + F    E ++ I+  + ++  D  G+   IG   +G  +  R G +H+ +++   ++    WH++
Sbjct:  194 GIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDF------SGTSDPYVKIYLLP--DRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDR--FSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDL-GELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPY-VKVSLMCDGRRLKKRKTS-TKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEA-ERLGRDHWSEMLSYPRKPIAHWHSL 487          
BLAST of Synaptotagmin-1 vs. UniProt/SwissProt
Match: sp|Q925C0|SYT9_RAT (Synaptotagmin-9 OS=Rattus norvegicus OX=10116 GN=Syt9 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 4.237e-24
Identity = 85/308 (27.60%), Postives = 156/308 (50.65%), Query Frame = 1
Query:  565 GIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSL--VWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            GIG + P+LY++R          ++  CG L+F L Y      L+VKI +  N+ +           T + ++ I + P  D+K + QT + +   +PVF E F FP+ Y +L    L FS+YD +   +S+    G+  +    +  D   E  +W D+  +  +  +  G+L+ SL YLP+A RLT+ I+KA+++   +I   +  Y V+V+     + +KK KT   K+++L  V+NE + F    E ++ I+  + ++  D  G+   IG   +G  +  R G +H+ +++   ++    WH++
Sbjct:  194 GIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDF------SGTSDPYVKIYLLP--DRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDR--FSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDL-GELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPY-VKVSLMCDGRRLKKRKTS-TKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEA-ERLGRDHWSEMLSYPRKPIAHWHSL 487          
BLAST of Synaptotagmin-1 vs. UniProt/SwissProt
Match: sp|P24507|SY63_DIPOM (Synaptotagmin-C OS=Diplobatis ommata OX=1870830 GN=P65-C PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 5.053e-23
Identity = 86/318 (27.04%), Postives = 158/318 (49.69%), Query Frame = 1
Query:  532 TSTDSGIASSIGIGNVIPDLYQRRGTIIRRESSPSASV-CGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            T  D  +     IG + P+LY++R   I  E+     V CG ++F L Y + T  L+VKI +  ++ +  A+  +      + ++ I + P   +K  QT + +   +P+F ETF+F + + EL    L FS+YD +   +S+    G+  +   L   D S +  IW D++    EK +  G++  SL YLP+A RLT+ I+KA ++   ++   +  Y V+ +    E+ +KK KT  +K   + V+NE + F    E +  +   + ++  D  G+   IG   +G  ++   G EH+ +++   ++    WH +
Sbjct:  200 TQADEKVEQVTSIGQIKPELYKQRS--IDTEAKKHQKVNCGRINFMLRYTYTTEQLVVKILKALDLPAKDANGFS------DPYVKIYLLPDRKKKF-QTKVHRKTLNPIFNETFQFNVPFNELQNRKLHFSVYDFDR--FSRHDLIGQVVLDNLLEFSDFSEDTTIWRDILEATSEKADL-GEINFSLCYLPTAGRLTITIIKATNLKAMDLTGFSDPY-VKASLICDERRLKKRKTSIKKNTLNPVYNEALVFDIPNENMEHVNVIIAVMDYDCIGHNEVIGMCRVGNATDG-PGREHWNEMLANPRKPIEQWHQL 503          
BLAST of Synaptotagmin-1 vs. UniProt/SwissProt
Match: sp|Q9R0N3|SYT11_MOUSE (Synaptotagmin-11 OS=Mus musculus OX=10090 GN=Syt11 PE=1 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 1.205e-22
Identity = 87/290 (30.00%), Postives = 145/290 (50.00%), Query Frame = 1
Query:  625 SSPSASV-CGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKF-PIAY---EELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSM-EVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICES-KETFTMWHNI 1470
            SSP   V  G+L F + Y F    L+V I++ + +         +     + +I + + P    +++   L+K    PVF ETF F  I Y   ++L  H L  S    + +D      G   +PL  VDPS  +V++  D+I   ++K  +RG+L VSL+Y P A+R+T+V++KA+ +   +I   + +  V+VN +   K I K KT  +K   + V+NE   +    + L DI  +  +I  D       +G   LG HS + SG EH+ + +CES ++    WH++
Sbjct:  149 SSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGS-----DPYIKMTILPDKRHRVKTRVLRKT-LDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDV----IGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPVFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEHWRE-VCESPRKPIAKWHSL 427          
BLAST of Synaptotagmin-1 vs. TrEMBL
Match: A0A1S3HDC6 (synaptotagmin-6-like OS=Lingula unguis OX=7574 GN=LOC106153639 PE=4 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.254e-46
Identity = 109/339 (32.15%), Postives = 194/339 (57.23%), Query Frame = 1
Query:  478 SISDSLSICRTESYKSRKTSTDSGIASS---IGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-FGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNIN-EDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQR 1476
            S+SDS SI   +S +S  + T   I+S+    G+G++ PDLYQR+ T++R+ S   +   G LH +L Y FKTSDL+V + +  ++ +       +     + ++ + + P  D K+RQ+S+K+   +PV+ E FKFP+ ++EL    L   +YD ++  +S+    G  ++ L+++D S  VE+W D+     E     G+LL+SL+YLP+AERLT+V++KA +  +P IN        VR +   + K IK+ KT  QK   + VWNE + F+   E L+ +  ++ ++  D+ G+   IG+ +LG  + + S   H+ +++   +++   WH++Q+
Sbjct:   96 SVSDSGSIKSVQSGRSESSVTSGDISSTSVDAGLGSIQPDLYQRKDTVLRQTSKDQSGKLGRLHLRLKYDFKTSDLIVHLIEAQDLPAMDVFGGFS-----DPYVKMFLRPEPDSKLRQSSIKRRTLNPVYNEYFKFPVTFDELREKTLFVHVYDYDK--FSRNDIIGEVSVHLDSIDVSTSVEVWCDIERYS-EVTSNLGELLLSLSYLPTAERLTVVVLKATN--LPKINFGGTTDPFVRASLIHEGKRIKRKKTSVQKNTINPVWNEALVFQVPAELLDKVILELSVLDYDLVGHSETIGNITLG-RNQTGSEESHWREMMENLRKSIAKWHSLQK 423          
BLAST of Synaptotagmin-1 vs. TrEMBL
Match: K1R220 (Synaptotagmin-C OS=Crassostrea gigas OX=29159 GN=CGI_10023929 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.450e-38
Identity = 114/429 (26.57%), Postives = 211/429 (49.18%), Query Frame = 1
Query:  208 GISIALIGVIAGVLIWIF---HRKRKLRKETERMLNEKSNLVFPQNGVGQTQQ-TFEEIRQCMMESPSPTDPQYLGPRSSFAGYNLPKKVHTYGSISDSLSICRTESYKSRKTSTDSGIASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-FGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQ-DSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQR 1476
            G++++L GVI G + +I    +RKRK R                 + VG  +  +   I     E+    + + + P S  +         + GSI        T S  +R  ++   +      G + PDLY R+  ++++ S   +   G LH ++ Y F+TSD++V +  +      +    +      + +I I M P VD++IRQ+S+K+   +P + E FKFP+  +E+    L F ++D ++  +S+ K  G  ++ L  VD +  VE+W D  I +  +    G+LL+SL+YLP+AERLT+V++KAK++++         Y VR++     K +K+ KT  ++   S VWNE + F  + + L     +V ++  D+ G+   +G   +G +     G +H+ D++   +++  MW ++ R
Sbjct:    8 GVTLSLAGVIGGFVCFILCKVYRKRKHRHNIPSYTG--------YDAVGDYKPPSLMSISTASQEAFLTKEHRSVQPSSLPSTSRGSISTMSRGSIKSDPFTEETSSISARSDTSADSLIFDPNFGAIRPDLYPRKDAVLQQSSVEQSQ--GKLHIRIKYDFRTSDVLVHL--IEAQELVVDRSRDPEGGFGDPYIRISMIPEVDERIRQSSVKRRTHNPFYNEYFKFPVTLDEVKERTLIFQVFDYDK--FSRHKTMGEVSVDLGQVDVTNSVEMWCD--IQKQSQHNDMGELLLSLSYLPTAERLTVVVLKAKELVMTAAGGSCDPY-VRISLVVDGKKVKRKKTSVKRSTTSPVWNEALTFNISSDLLPKCNLEVTVLDHDLIGHGEFVGRCIIGPNRPDAEG-KHWNDMLNNHRKSMAMWQHLYR 418          
BLAST of Synaptotagmin-1 vs. TrEMBL
Match: A0A2C9K054 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106074836 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 4.731e-37
Identity = 97/328 (29.57%), Postives = 173/328 (52.74%), Query Frame = 1
Query:  508 TESYKSRKTSTDSGIASSI---GIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQ-KFGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQR 1476
            T+   S    +D+ + S I     G + PDLY R+  ++++ S       G LH +L Y F+T D +V + +  ++  +       +    + +I I + P VD+++RQ+S+K+   +P F E FKFP+ +++L    L F L+D ++  +S+    G   I +  VD S  VE+W D+        E+ G++L+SL+YLP+AERLT+VIMKAK++ + +    +    VRV+     K +K+ KT  ++   + VWNE +AF    E L  +  +V ++  D+ G+   +G   LG          H+ D++   +++  MWH +++
Sbjct:   15 TDDTSSISAKSDASVDSLIFDPNFGAIRPDLYPRKDIVLQQSSLDGGQ--GRLHTRLKYDFRTCDFVVHLIEAQDLPPADPVTGTFS----DPYIRISLLPCVDERVRQSSVKRRTLNPYFNEYFKFPLDFDDLKEKTLVFHLFDYDK--FSRHTSLGEVEISMANVDVSNSVEMWCDVQKQHKVAGES-GEILISLSYLPTAERLTVVIMKAKELKL-STAAPSADPFVRVSLMVDGKKVKRKKTSVRRGSVNPVWNEALAFNVPAEVLPKVSLEVSVLDHDLIGHGEMLGRCLLGGTDKPGEEQGHWKDMLTNQRKSVAMWHILRK 332          
BLAST of Synaptotagmin-1 vs. TrEMBL
Match: A0A0L8H110 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22024656mg PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 7.684e-37
Identity = 113/330 (34.24%), Postives = 185/330 (56.06%), Query Frame = 1
Query:  508 TESYKSRK-TSTDSGIASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-FGRATIPLNTVDPSMEVEIWLDMIIIELEKRE--TRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQ-DSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGME--HFYDIICESKETFTMWHNIQR 1476
            T S  +R  TS DS +  +   G++ PDLY R+ TI+++ S       G LH +L Y F+TSDL+V + +V+++    ++   +     + +I + + P VD++ RQ+S+++   +P F E FKFPI YE+L    L F ++  N + +S+    G   + LNTV+ S  VEIW D   I+  +R   T G+LL+SL+YLP+AERLT+VI+KAKD+ I    E++  + VR++     K IK+ K+  Q+   S VWNE + F    E L  +  +  +   D+ G+   IG  +LG     R G E  H+ +++   + +  MWH++ +
Sbjct:   97 TSSISARSDTSVDSSVFDA-SFGSIRPDLYPRKETILQQCSQQKCY--GRLHLRLKYDFRTSDLVVHLIEVHDLMCPDSTSGFS-----DPYIKLFLYPEVDERRRQSSVQRRTLNPFFNEFFKFPIPYEDLQDKSLIFQVF--NYDKFSRHSILGEVNVDLNTVETSSSVEIWSD---IQRYQRHACTMGELLISLSYLPTAERLTVVIIKAKDLRILGPAEESDPF-VRISLIVDGKKIKRKKSSVQRSTSSPVWNEALTFNVPAEILPKVALECCVWDHDIIGHGELIGKCTLGPE---RQGNERKHWMELLSCHRTSTAMWHSLHK 409          
BLAST of Synaptotagmin-1 vs. TrEMBL
Match: A0A2C9K056 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106074836 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 9.119e-37
Identity = 97/328 (29.57%), Postives = 173/328 (52.74%), Query Frame = 1
Query:  508 TESYKSRKTSTDSGIASSI---GIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQ-KFGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQR 1476
            T+   S    +D+ + S I     G + PDLY R+  ++++ S       G LH +L Y F+T D +V + +  ++  +       +    + +I I + P VD+++RQ+S+K+   +P F E FKFP+ +++L    L F L+D ++  +S+    G   I +  VD S  VE+W D+        E+ G++L+SL+YLP+AERLT+VIMKAK++ + +    +    VRV+     K +K+ KT  ++   + VWNE +AF    E L  +  +V ++  D+ G+   +G   LG          H+ D++   +++  MWH +++
Sbjct:   35 TDDTSSISAKSDASVDSLIFDPNFGAIRPDLYPRKDIVLQQSSLDGGQ--GRLHTRLKYDFRTCDFVVHLIEAQDLPPADPVTGTFS----DPYIRISLLPCVDERVRQSSVKRRTLNPYFNEYFKFPLDFDDLKEKTLVFHLFDYDK--FSRHTSLGEVEISMANVDVSNSVEMWCDVQKQHKVAGES-GEILISLSYLPTAERLTVVIMKAKELKL-STAAPSADPFVRVSLMVDGKKVKRKKTSVRRGSVNPVWNEALAFNVPAEVLPKVSLEVSVLDHDLIGHGEMLGRCLLGGTDKPGEEQGHWKDMLTNQRKSVAMWHILRK 352          
BLAST of Synaptotagmin-1 vs. Ensembl Cavefish
Match: syt9b (synaptotagmin 9 [Source:NCBI gene;Acc:103033725])

HSP 1 Score: 109.768 bits (273), Expect = 3.481e-25
Identity = 85/309 (27.51%), Postives = 153/309 (49.51%), Query Frame = 1
Query:  556 SSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            S  G+G + P+LY++R   +  +    A  CG LHF L Y      L+VKI +  ++ +           T + ++ I + P    K  QT + +   +PVF E F FP+AY EL    L FS+YD +   +S+    G+  +   L+  D   E ++  D++ +  +  +  G L+ SL YLP+A RLT+ I+KA+++   +I   +  Y V+V+     + +KK KT  ++   + V+NE + F    E ++ I   + ++  D  G+   IG   +G  + S  G +H+ +++   ++    WH +
Sbjct:  199 SGPGLGRIKPELYKQRS--VDTDDGRRADSCGRLHFILKYDCDLEQLIVKIHKAEDLPAKDF------SGTSDPYVKIYLLPERKTK-HQTKVHRKTLNPVFDEVFLFPVAYAELNMRKLHFSVYDFDR--FSRHDLIGQVVVDNFLDLPDFPRETKLCKDILYVTADNVDL-GDLMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPY-VKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVGHNEIIGVCRVGNTAESL-GRDHWNEMLTYPRKPIAHWHPL 493          
BLAST of Synaptotagmin-1 vs. Ensembl Cavefish
Match: syt3 (synaptotagmin III [Source:ZFIN;Acc:ZDB-GENE-090601-1])

HSP 1 Score: 100.523 bits (249), Expect = 3.500e-22
Identity = 83/306 (27.12%), Postives = 150/306 (49.02%), Query Frame = 1
Query:  568 IGNVIPDLYQ-RRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPS---MEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            IG + P+LY+ R+G    +        CG + F L Y F T  L+VKI +  ++ +  A+  +      + ++ I + P   +K  QT + +   +PVF ETF+F +   EL++  L FS+YD +   +S+       +  N +D S    E  IW D++    EK +  G+L  SL YLP+A RLT+ I+KA ++   ++   +  Y V+ +   + + +KK KT  +K   +  +NE + F    E +  +   + ++  D  G+   IG   +G+ +    G EH+  ++   ++    WH +
Sbjct:  185 IGQIKPELYRLRQG---EQGDGKQGDTCGKISFLLRYAFNTEQLVVKILKALDLPAKDANGFS------DPYVKIYLLPDRKKKY-QTKVHRKTLNPVFNETFQFGVPLAELHSRKLHFSVYDFDR--FSRHDLIGQVVVDNLLDFSEGTGEKPIWRDIVEGTAEKADL-GELNFSLCYLPTAGRLTVTIIKATNLKAMDLTGFSDPY-VKASLVCEGRRLKKRKTSIKKNTLNPTYNEALVFDIPNENIESVSLIIAVMDYDCIGHNEVIGMCCVGSDAEG-PGREHWTAMLANPRKPIEHWHQL 475          
BLAST of Synaptotagmin-1 vs. Ensembl Cavefish
Match: syt3 (synaptotagmin III [Source:ZFIN;Acc:ZDB-GENE-090601-1])

HSP 1 Score: 100.138 bits (248), Expect = 4.970e-22
Identity = 83/306 (27.12%), Postives = 150/306 (49.02%), Query Frame = 1
Query:  568 IGNVIPDLYQ-RRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPS---MEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            IG + P+LY+ R+G    +        CG + F L Y F T  L+VKI +  ++ +  A+  +      + ++ I + P   +K  QT + +   +PVF ETF+F +   EL++  L FS+YD +   +S+       +  N +D S    E  IW D++    EK +  G+L  SL YLP+A RLT+ I+KA ++   ++   +  Y V+ +   + + +KK KT  +K   +  +NE + F    E +  +   + ++  D  G+   IG   +G+ +    G EH+  ++   ++    WH +
Sbjct:  214 IGQIKPELYRLRQG---EQGDGKQGDTCGKISFLLRYAFNTEQLVVKILKALDLPAKDANGFS------DPYVKIYLLPDRKKKY-QTKVHRKTLNPVFNETFQFGVPLAELHSRKLHFSVYDFDR--FSRHDLIGQVVVDNLLDFSEGTGEKPIWRDIVEGTAEKADL-GELNFSLCYLPTAGRLTVTIIKATNLKAMDLTGFSDPY-VKASLVCEGRRLKKRKTSIKKNTLNPTYNEALVFDIPNENIESVSLIIAVMDYDCIGHNEVIGMCCVGSDAEG-PGREHWTAMLANPRKPIEHWHQL 504          
BLAST of Synaptotagmin-1 vs. Ensembl Cavefish
Match: syt6b (synaptotagmin-6 [Source:NCBI gene;Acc:103047010])

HSP 1 Score: 97.0561 bits (240), Expect = 5.113e-21
Identity = 88/363 (24.24%), Postives = 172/363 (47.38%), Query Frame = 1
Query:  403 TDPQYLGPRSSFAGYNLPKKVHTYGSI---SDSLSICRTESYKSRKTSTDSGIASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLN---TVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            T+P      SSF  + LP+++H   S+   SD L +             D    ++  +G + P+LY ++ T    ESS + + CG ++F L Y ++   L+V I +  ++ +           + + ++ I + P  D+K + QT + +   +P F E F+FP+ YE+L    L  S++D +   +S+       I  N   + D S E  IW D+     E  +  G+++ SL YLP+A RLT+ ++K +++   +I   +  Y+      D +++ KK  T  +   +  +NE + F    E +  +   + ++  D+ G+   IG   +G+H+    G +H+ +++   ++    WH +
Sbjct:  173 TEPASSNRHSSFKKH-LPRQMHHVTSVDRGSDFLDV------------DDHPTCTAAALGRIQPELY-KQSTQEAEESSKNETACGKINFSLKYDYEGEQLLVTILKALDLPAKDLC------GSSDPYVKIYLLP--DRKCKFQTRVHRKTLNPTFDEMFQFPVPYEQLPARKLHLSVFDFDR--FSRHDMIGEVILDNLFESSDLSRETSIWRDIQYATSESVDL-GEIMFSLCYLPTAGRLTMTVIKCRNLKAMDITGYSDPYVKVSLICDGKRLKKKKTTIKKNTLNPTYNEAIIFDIPPENMEQVSLHISVMDYDLVGHNEVIGVNRVGSHAEGL-GRDHWNEMLAYPRKPIAHWHPL 509          
BLAST of Synaptotagmin-1 vs. Ensembl Cavefish
Match: syt5a (synaptotagmin-2-like [Source:NCBI gene;Acc:103027827])

HSP 1 Score: 95.9005 bits (237), Expect = 5.874e-21
Identity = 68/276 (24.64%), Postives = 134/276 (48.55%), Query Frame = 1
Query:  649 GNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-FGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQ 1473
            G L + L Y F  + L+V I Q  ++ +           T + ++ + M P   +K  +T +++ +  PVF ETF F I + +L    L   ++D +   + K    G   I +N++D    +  W D++  E E++E  G + +SL Y+P++ +LT+ IM+AK++   ++   +  ++  V Q + +++ KK  T  Q   +  +NE  +F+    ++  I   + +   D  G+   IG   +G +  S  G+ H+ D++   +     WH +Q
Sbjct:  125 GKLEYSLDYNFTDNQLIVGILQAQDLPAMDIG------GTSDPYVKVYMLPDKKKKF-ETKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDR--FGKHDVIGEIKIAMNSIDLGQPIHEWKDLVGGEKEEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFVKVVLQHNGKRLKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKIQVLITVYDYDKLGSNDAIGKCWIG-YGASGVGLRHWSDMLANPRRPVAQWHTLQ 390          
BLAST of Synaptotagmin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000226.1 (pep scaffold:Pmarinus_7.0:GL478944:1404:4221:1 gene:ENSPMAG00000000205.1 transcript:ENSPMAT00000000226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 3.235e-13
Identity = 40/137 (29.20%), Postives = 73/137 (53.28%), Query Frame = 1
Query: 1063 RGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            RG++LVSL Y P+A RLT+V++KA+ +   +I   ++   V+VN +  ++   K KT  +K   + V+NE   F+  +E L+D+  ++ ++  D    +  IG  +LG       G EH+ ++    +     WH +
Sbjct:    5 RGEILVSLCYHPAASRLTVVVLKARHLPKTDIVGLSVDPYVKVNIYSGKRRFAKKKTHVKKCTLNPVFNESFVFELPEEGLSDLAVELTVVDFDRTTKDEVIGRLALG------PGTEHWREVCENPRRQIAKWHPL 135          
BLAST of Synaptotagmin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003267.1 (pep scaffold:Pmarinus_7.0:GL476427:260045:262512:1 gene:ENSPMAG00000002986.1 transcript:ENSPMAT00000003267.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 5.266e-12
Identity = 70/288 (24.31%), Postives = 139/288 (48.26%), Query Frame = 1
Query:  649 GNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFI-TIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIPLNTVDPSMEVEIWLDMIIIELEKRETRG----------QLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVN-QFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            G+++F LLY  + + L V+I Q+ ++ +              SFI T+ + P V     Q+ +  N  +P+F E+F F +   EL+   +   L+D++   +SK+   G+   PL         ++ LDM   +   ++T+G          +L +SL YLP+AE+LT+ +++A++  I  I   +    V++    + EK IK  K   +++D S+ +NE +AF ++ E+L       ++IQ      ++ +G    G  S+ +  +   + +I   +    +W+ +
Sbjct:    2 GSINFCLLYEEELNILTVQIIQMRDLPAKEFGKPA-------SFICTVSLLPDVSS--LQSQVHHNTPNPIFMESFLFSVPLLELHRRTVLIKLFDVDR--FSKKNIVGKIEQPLR--------DLLLDMKAPQHFLKKTKGKQKSQPDEHGELSISLGYLPNAEKLTITVLQARN--INAIQNGSQGLFVKLTVSVENEKYIKTKKIMQKQRDGSIEFNESVAFSYSSEQLAKTNLLFQVIQTSSGKKKVEVGRILFGKDSSEK--ILARWKVIMSGQPARAVWYKL 266          
BLAST of Synaptotagmin-1 vs. Ensembl Sea Lamprey
Match: syt12 (synaptotagmin XII [Source:ZFIN;Acc:ZDB-GENE-081022-147])

HSP 1 Score: 61.6178 bits (148), Expect = 9.357e-11
Identity = 59/238 (24.79%), Postives = 111/238 (46.64%), Query Frame = 1
Query:  778 FITIEMNPAVDQKIRQTSLKKNDFSPV-FGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF--GRATIPLNTVD-PSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQR 1476
            F+ + + P    ++  TS   +  + V F E    P+    +    L F+   L   D + ++F  G A + L  +D P      WL  +    +  E  G++L+SL+YLP+AERLT+V++KAK +  P   E    + V+V      + + K KT  ++ + + V+N+ + F      L DI  +V +          +IG   +G  S+  + + H+  ++   +   +MWH +++
Sbjct:   77 FVQLGLRPG--NRVACTSKVHHSAASVPFDEHLVMPLDAAAVDDTTLAFTALGL---DSNGRQFSMGTAELRLGDLDLPVRPFSTWL-YLQDSSQVAECCGEVLLSLSYLPTAERLTVVVVKAKGLEWPQGRESGAPF-VKVYLLQGGRKVSKKKTVTKRDERNPVYNDAIIFSVPASTLQDISLRVTVADHREGMRAEDIGHAVIGPQSSGVA-LAHWQQMLATLRRPVSMWHPLRK 306          
BLAST of Synaptotagmin-1 vs. Ensembl Sea Lamprey
Match: SYT6 (synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638])

HSP 1 Score: 61.2326 bits (147), Expect = 1.550e-10
Identity = 45/163 (27.61%), Postives = 77/163 (47.24%), Query Frame = 1
Query:  568 IGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATI--------PLNTVDPSMEVEIWLDM 1032
            +G + P+LY+ R ++        A  CG ++F++ Y ++   L+VKI +  ++ +           T + ++ I + P   +K  QT + +   +PVF ETF+F + Y EL +  L FS+YD +       +F R  I         L   D S E  IW D+
Sbjct:  159 LGRIKPELYKARPSVPAVGDM-KAPPCGRINFQVRYDYEGEQLVVKINKAVDLPAKDF------SGTSDPYVKIYLLPERKRKY-QTKVHRKTLNPVFDETFQFGVPYSELASRRLHFSVYDFD-------RFSRHDIIGTVLVDNLLEATDHSRETSIWRDI 306          
BLAST of Synaptotagmin-1 vs. Ensembl Sea Lamprey
Match: syt4 (synaptotagmin IV [Source:ZFIN;Acc:ZDB-GENE-030131-7297])

HSP 1 Score: 61.2326 bits (147), Expect = 2.004e-10
Identity = 51/223 (22.87%), Postives = 99/223 (44.39%), Query Frame = 1
Query:  823 QTSLKKNDFSPVFGETFKF-PIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSMEVEIWLDMIIIE-LEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDS-LVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIIC---ESKETFTMWHNIQ 1473
            QT + +    PVF ETF F  ++  ++    +TF++         ++  G  T+PL  +    EV  +   I+   ++K    G+LLVSL++  +  RLT+VI+KA+ +   +      +  V+V+ F   + + K KT  ++  S  ++NE                ++ ++     G+E  +G   LG  + S    +H+ ++      +      WH +Q
Sbjct:  175 QTRVLRGTRDPVFDETFAFYGLSAVQMEGSEITFAVLSFGRLSR-EEVIGEVTVPLAGIAAGPEVVAFCRHIVPRGMQKPAGVGELLVSLSFTQADSRLTVVILKARGLHKRDTGSSLGAACVKVSAFAGSERVLKRKTRVRRASSGALFNESFEVALGG---GATSLELLVVVHAGAGDE-ELGRVVLGAGAASPRARQHWQEVRAGGDAAGRPLARWHALQ 392          
BLAST of Synaptotagmin-1 vs. Ensembl Nematostella
Match: EDO33081 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST78])

HSP 1 Score: 86.2705 bits (212), Expect = 5.002e-19
Identity = 63/234 (26.92%), Postives = 112/234 (47.86%), Query Frame = 1
Query:  778 FITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVK-GNEINIGDFSLGTHSNSRS-GMEHFYDIICESKETFTMWHNI 1470
            ++ + + P   +K++ T   +N  +P F E F F +  EEL    L F++ D +   +S+Q+                      +  ++LEK    GQLL SL YLP+A RLT+ I+K KD+ +       +   V+V+     K +KK KT   K+  + V+N+   F      L ++ F + +I    + GN+I++G   +G +  S S G+ H+ D++   +     WH++
Sbjct:   41 YVKMCLLPDRKRKLQSTRRHRNS-NPAFNEDFVFSVPAEELRMRTLKFTVCDFDR--FSRQQV---------------------IGHVQLEK----GQLLFSLQYLPTACRLTVAILKGKDLRVEGEETTEIDTYVKVSMIMGGKAVKKRKTPVVKKTCNPVFNQAFVFSMPPSYLENVSFVISVIATPKRGGNKIHVGRAVVGPYMYSTSPGLSHWTDMLGSPRSAVAQWHSL 246          
BLAST of Synaptotagmin-1 vs. Ensembl Nematostella
Match: EDO31747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX18])

HSP 1 Score: 83.9593 bits (206), Expect = 1.257e-17
Identity = 77/286 (26.92%), Postives = 153/286 (53.50%), Query Frame = 1
Query:  649 GNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-FGRATIPLNTVDPSMEVEIWLDMIIIELEK-RETRGQLLVSLNYLPSAERLTLVIMKAKDVIIP----NINEDNLSYLVRVN-QFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQK--DVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQ 1473
            G L F L+Y  + ++L++++     I+       +   + ++S++ ++++P      + +TS+ +    P + ETF+F I  E+L   +L+  + +++   YS+    G+  + L  V  + ++ + ++M I+E  K R   G LLVSL+Y+P+AERL++VIMKA+++  P    +    ++S  V+V   FD +K +KK KT  +KQ+ + V+NE M F      L+ +   + +  K  D + ++I IG   +G+ S S   + H+  ++   +     WH ++
Sbjct:   83 GTLKFTLIYQTEFNNLIIQV-----INGHEIVGRDFWDNAVDSYVQLKLDPDPGNVYKGKTSISRKTTEPYYNETFQFSIEMEKLADAILSLLVMEVDR--YSRHHVIGQIDLELGDVVLANQM-VAMEMEILEAYKSRLGLGDLLVSLSYMPTAERLSVVIMKARNLNPPFSEWSSQPRDISPFVKVVLLFDGQK-VKKKKTSTRKQEKNPVYNESMLFDIPPHFLHRVILLISVADKPSDSRRSDI-IGRVVIGSPS-SGEALSHWNQMLVSPRRPIAAWHKLR 357          
BLAST of Synaptotagmin-1 vs. Ensembl Nematostella
Match: EDO50013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF18])

HSP 1 Score: 78.1814 bits (191), Expect = 4.619e-16
Identity = 74/282 (26.24%), Postives = 134/282 (47.52%), Query Frame = 1
Query:  646 CGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-----FGRATIPLNTVDPSM---EVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWH 1464
            CG L F ++Y      L V++ + NN+S   A           +++ + + P   +K  QT++K  + +PVF ETF+F +A+ EL    L F + D   + YS+ +     F    + +N  + ++   E +I  D+     E +  +G++L+SL YLP++ RLT V++KA+  +            V+V+     + IKK KT         V+NE   F    E+L+D+   V+++  D K  +  I    +G  S +  G+ H+  ++   ++    WH
Sbjct:   15 CGKLEFSIMYDTTCECLRVRVLKANNLSVPEA----------TTYVEVFLLPDKIEKY-QTNVKYKNSNPVFNETFEFDVAFSELPERTLQFCINDY--DGYSRHQALGEVFHSFDVNVNMQEDTVVIYEKDIRRDIFTFR-ENQVRKGEVLLSLCYLPTSGRLTFVVLKARLSMRLLFRYSLSDPFVKVSLMVSGRQIKKTKTSVMHGTLRPVYNEAFVFDIPVERLSDVSLLVRMLHSDGKRCQ-TIAKTVVGPDSQTSIGLHHWNCMMTSPRKPIAQWH 281          
BLAST of Synaptotagmin-1 vs. Ensembl Nematostella
Match: EDO31748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX19])

HSP 1 Score: 76.2554 bits (186), Expect = 1.811e-15
Identity = 57/219 (26.03%), Postives = 111/219 (50.68%), Query Frame = 1
Query:  820 RQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-FGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            R+  ++   F P + E   F ++   + +  +   LY+L+   +S Q   G   +PL           W D+      + +  G++L+SLNY P+ +RLT+V++KA+++ I N++      LV+V     ++ + + +T  QK+  + V+NE  AFK ++E +  I F++ ++ K   G +  +G  +LG +    SG  H+  ++   ++   MWH I
Sbjct:   52 RKIEIQPMTFEPQWNEEVLFALSGRPVTSLNVQVRLYELD--SFSNQHVIGCIKLPLAEQSFEESRADWYDLEDEHKIECDYVGEVLLSLNYFPTTQRLTIVVLKARNLKIDNVS-GLWGPLVKVFFHVNKRRVGRKRTAMQKKTFNPVYNEAFAFKVSQEAMPKITFRILVVSKTSHGQDEVLGHVTLGQNVIG-SGFSHWSHMLATLRKPVAMWHPI 266          
BLAST of Synaptotagmin-1 vs. Ensembl Nematostella
Match: EDO31975 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF3])

HSP 1 Score: 75.0998 bits (183), Expect = 4.324e-15
Identity = 54/222 (24.32%), Postives = 112/222 (50.45%), Query Frame = 1
Query:  823 QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-FGRATIPLNTVD--PSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDII--CESKETFTMWHNIQ 1473
            QT ++ N+  P+F ETF+F + Y E     LT  +     + +S+ K  G  ++P   V+  P+    +W D+  +       RG+L VSL Y   A R++++++KA  +   ++ +    Y   +   D +K+I+  +T C++  S VWN+      +K ++ND    ++++  D+  ++  IG+  + + +N     EH+ +++    S++   M H ++
Sbjct:   51 QTEIRVNEAQPIFNETFEF-VGYSERDLMDLTLRMGLFAYDKFSRGKMLGFTSVPFRDVEWHPTQATILWRDLDTMR-SFSYPRGELSVSLRYEAQANRISIIVLKATALPKVSLVKSTAPYCKVILSID-DKVIESRRTKCKRSLSPVWNQGFILDIDKSRVNDYVITLRVMNHDLLMSDDIIGEVVISSRANG-FAREHWDEMMRNKHSRKEVAMTHALE 268          
BLAST of Synaptotagmin-1 vs. Ensembl Medaka
Match: syt9a (synaptotagmin-9 [Source:NCBI gene;Acc:101174010])

HSP 1 Score: 116.316 bits (290), Expect = 1.571e-27
Identity = 128/498 (25.70%), Postives = 221/498 (44.38%), Query Frame = 1
Query:   94 NFGCLH*KLYFVGYISPVDN*SELAMKIGSAEIIVIAAGISIALIGV---IAGVLIWIFHRKRKLRKETERMLNEKSNLVFPQNGVGQTQQTFEEIRQCMMESPSPTDPQYLGPRSSFAGYNLPKKVHTYGSIS-DSLSICR-----TESYKSRKTST-------------------------DSGIASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-FGRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            N  CL    YF     P  + S++++ + S  ++V A G+  AL GV   ++  L WI  R+R L   T+           PQ  +  T             SP P+ P    P +  A   + K  HT   I+ D+ S  R     T     R+T+                          DS     +G+G++ P+LYQ   ++   E S     CG LHF L +      L+VKI +  ++ +           T + ++ I + P  D+K + QT + +   +PVF E F FP+AY EL T  L FS+YD +   +S+    G+  +   L   D   E ++ L++  +  +  +  G L+ SL YLP+A RLT+ ++KA+++   +I   +  Y V+V+   + + +KK KT  ++   + ++NE + F    E +  I   + ++  D  G+   IG   +G  ++S  G EH+ +++   ++    WH +
Sbjct:   28 NENCLDFIYYFRDLARPRYSDSDISVSLLS--LVVTACGL--ALFGVSLFVSWKLCWIPWRERGLSPTTKE----------PQGHINPTM------------SPLPSQPTPREPPTPVASAAM-KISHTSPDIALDAQSKSRESGIHTNPRMQRQTTDPAQGSIRRHMNLSNPDFNVAQFQRQDSLTGMGLGLGSLKPELYQP-CSMDEDEGSHRGRSCGRLHFVLKFDCNLEQLIVKIHKAEDLPAKDF------SGTSDPYVKIYLLP--DRKTKHQTKVHRKTLNPVFDEVFLFPVAYSELPTRKLHFSVYDFDR--FSRHDIIGQVVVDNFLELADFPRETQLCLNIQYVSSDNVDL-GDLMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPY-VKVSLMCEGRRLKKRKTSTKRNTLNPIYNEAIVFDVPPENIEQISLLIAVMDYDRVGHNEVIGVCRVGNDADSL-GREHWNEMLTYPRKPVAHWHPL 484          
BLAST of Synaptotagmin-1 vs. Ensembl Medaka
Match: syt9a (synaptotagmin-9 [Source:NCBI gene;Acc:101174010])

HSP 1 Score: 112.079 bits (279), Expect = 8.494e-26
Identity = 92/338 (27.22%), Postives = 170/338 (50.30%), Query Frame = 1
Query:  475 GSISDSLSICRTESYKSRKTSTDSGIASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQK-FGRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSL--VWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            GSI   +++   +   ++    DS     +G+G++ P+LYQ   ++   E S     CG LHF L +      L+VKI +  ++ +           T + ++ I + P  D+K + QT + +   +PVF E F FP+AY EL T  L FS+YD +   +S+    G+  +   L   D   E ++ L++  +  +  +  G L+ SL YLP+A RLT+ ++KA+++   +I   +  Y V+V+   + + +KK KT   K+++L  ++NE + F    E +  I   + ++  D  G+   IG   +G  ++S  G EH+ +++   ++    WH +
Sbjct:  217 GSIRRHMNLSNPDFNVAQFQRQDSLTGMGLGLGSLKPELYQP-CSMDEDEGSHRGRSCGRLHFVLKFDCNLEQLIVKIHKAEDLPAKDF------SGTSDPYVKIYLLP--DRKTKHQTKVHRKTLNPVFDEVFLFPVAYSELPTRKLHFSVYDFDR--FSRHDIIGQVVVDNFLELADFPRETQLCLNIQYVSSDNVDL-GDLMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPY-VKVSLMCEGRRLKKRKTS-TKRNTLNPIYNEAIVFDVPPENIEQISLLIAVMDYDRVGHNEVIGVCRVGNDADSL-GREHWNEMLTYPRKPVAHWHPL 539          
BLAST of Synaptotagmin-1 vs. Ensembl Medaka
Match: syt9b (synaptotagmin-9 [Source:NCBI gene;Acc:101171486])

HSP 1 Score: 109.383 bits (272), Expect = 4.816e-25
Identity = 83/307 (27.04%), Postives = 157/307 (51.14%), Query Frame = 1
Query:  565 GIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            G+G + P+LY++R   +  E       CG LHF L +      L+VKI +  ++ +           T + ++ I + P  D+K + QT + +   +PVF E F FP+AY EL +  L FS+YD +   +S+    G+  +   L+  D   E ++  D+  +  +  +  G+L+ SL YLP+A RLT+ ++KA+++   +I   +  Y V+V+   + + +KK KT  ++   + V+NE + F    E ++ I   + ++  D  G+   IG   +G+ + S  G +H+ +++   ++    WH +
Sbjct:  209 GLGRIKPELYKQRS--VDAEDGRRTDSCGRLHFILKFDLDLEQLIVKIHRAQDLPAKDF------SGTSDPYVKIYLLP--DRKTKHQTKVHRKTLNPVFDEVFLFPVAYAELSSRKLHFSVYDFDR--FSRHDLIGQVVVDNFLDLPDFPRETKLCRDIQYVTSDNVDL-GELMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPY-VKVSLMCEGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVGHNEVIGVCRVGSEAESL-GRDHWNEMLSYPRKPIAHWHPL 500          
BLAST of Synaptotagmin-1 vs. Ensembl Medaka
Match: syt9b (synaptotagmin-9 [Source:NCBI gene;Acc:101171486])

HSP 1 Score: 108.997 bits (271), Expect = 5.915e-25
Identity = 83/307 (27.04%), Postives = 157/307 (51.14%), Query Frame = 1
Query:  565 GIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIR-QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKF-GRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQD-SLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            G+G + P+LY++R   +  E       CG LHF L +      L+VKI +  ++ +           T + ++ I + P  D+K + QT + +   +PVF E F FP+AY EL +  L FS+YD +   +S+    G+  +   L+  D   E ++  D+  +  +  +  G+L+ SL YLP+A RLT+ ++KA+++   +I   +  Y V+V+   + + +KK KT  ++   + V+NE + F    E ++ I   + ++  D  G+   IG   +G+ + S  G +H+ +++   ++    WH +
Sbjct:  209 GLGRIKPELYKQRS--VDAEDGRRTDSCGRLHFILKFDLDLEQLIVKIHRAQDLPAKDF------SGTSDPYVKIYLLP--DRKTKHQTKVHRKTLNPVFDEVFLFPVAYAELSSRKLHFSVYDFDR--FSRHDLIGQVVVDNFLDLPDFPRETKLCRDIQYVTSDNVDL-GELMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPY-VKVSLMCEGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVGHNEVIGVCRVGSEAES-LGRDHWNEMLSYPRKPIAHWHPL 500          
BLAST of Synaptotagmin-1 vs. Ensembl Medaka
Match: syt10 (synaptotagmin-10 [Source:NCBI gene;Acc:101162492])

HSP 1 Score: 103.99 bits (258), Expect = 1.309e-23
Identity = 79/308 (25.65%), Postives = 148/308 (48.05%), Query Frame = 1
Query:  553 ASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIP--LNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNI 1470
            +S++ IG + P+LY+++      ES      CG L F L Y ++   L+VKI +  ++ +   +       T + ++ I + P   +K  QT + + + +P F ETF FP+AY+EL    L FS+YD +    S    G   +       D S E  +W D+    +E  +  G+++ SL YLP+A R+TL ++K +++   +I   +  Y+      D  ++ K+  T  +   + V+NE + F    E +  +   + ++  D  G+   IG    G  +    G +H+ +++   ++  T WH +
Sbjct:   96 SSTVSIGRIKPELYKQKSVDSEDESRGPVETCGKLSFSLRYDYEEQALVVKILKALDLPAKDFT------GTSDPYVKIYLLPERKKKF-QTRVHRKNLNPTFDETFCFPVAYDELCNRKLHFSVYDFDRFT-SHDMIGEVVVDNLFELSDLSREAVVWKDIHAATMESVDL-GEIMYSLCYLPTAGRMTLTVIKCRNLKAMDITGSSDPYVKVYLVCDGRRLKKRKTTTKKSTLNPVFNEAIIFDIPPENVEQVSLSIMVMDYDRVGHNEVIGVCRAGPDAVGL-GRDHWNEMLAYPRKPITHWHAL 393          
BLAST of Synaptotagmin-1 vs. Planmine SMEST
Match: SMESG000048136.1 (SMESG000048136.1)

HSP 1 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 437/438 (99.77%), Postives = 437/438 (99.77%), Query Frame = 1
Query:  169 MKIGSAEIIVIAAGISIALIGVIAGVLIWIFHRKRKLRKETERMLNEKSNLVFPQNGVGQTQQTFEEIRQCMMESPSPTDPQYLGPRSSFAGYNLPKKVHTYGSISDSLSICRTESYKSRKTSTDSGIASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQRDL 1482
            MKIGSAEIIVIAAGISIALIGVIAGVLIWIFHRKRKLRKETERMLNEKSNLVFPQNGVGQTQQTFEEIRQ MMESPSPTDPQYLGPRSSFAGYNLPKKVHTYGSISDSLSICRTESYKSRKTSTDSGIASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVNNISSSIASLLNANKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQRDL
Sbjct:    1 MKIGSAEIIVIAAGISIALIGVIAGVLIWIFHRKRKLRKETERMLNEKSNLVFPQNGVGQTQQTFEEIRQSMMESPSPTDPQYLGPRSSFAGYNLPKKVHTYGSISDSLSICRTESYKSRKTSTDSGIASSIGIGNVIPDLYQRRGTIIRRESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVNNISSSIASLLNANKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQRDL 438          
BLAST of Synaptotagmin-1 vs. Planmine SMEST
Match: SMESG000008756.1 (SMESG000008756.1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.543e-17
Identity = 59/221 (26.70%), Postives = 114/221 (51.58%), Query Frame = 1
Query:  823 QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQF-DKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGME--HFYDIICESKETFTMWHNIQR 1476
            +T + + D SP F E F F +   EL   ++ F L  +++ D    +  +A + ++ VD      +WL+M  +  E+ + RG++++SL YLP+A R+TLVI+KAKD+    + + +   ++ V+   +  ++ K+  +  +K    ++NE + F  N    +DI+ ++   +    G    IG   LG+ S   +G+E  H+  +I   +    MWH + +
Sbjct:  161 KTKIHEKDTSPSFKERFLFKVNVPELQRKIVRFRLIGISKPDV-HMEISKALVQISDVDLKKAKRLWLNMKEMSAEE-DARGEIMLSLTYLPTASRITLVIIKAKDLRWKILRQKSGDVMISVSLICNGRRVCKRQTSVKRKTKDPIFNESLIFSVNDPN-DDIFLRLTASEILPNGRLYTIGHCVLGSTS---TGIELTHWQQMISNPRRPSAMWHWLHK 375          
BLAST of Synaptotagmin-1 vs. Planmine SMEST
Match: SMESG000008756.1 (SMESG000008756.1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.007e-17
Identity = 59/221 (26.70%), Postives = 114/221 (51.58%), Query Frame = 1
Query:  823 QTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQKFGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQF-DKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGME--HFYDIICESKETFTMWHNIQR 1476
            +T + + D SP F E F F +   EL   ++ F L  +++ D    +  +A + ++ VD      +WL+M  +  E+ + RG++++SL YLP+A R+TLVI+KAKD+    + + +   ++ V+   +  ++ K+  +  +K    ++NE + F  N    +DI+ ++   +    G    IG   LG+ S   +G+E  H+  +I   +    MWH + +
Sbjct:  169 KTKIHEKDTSPSFKERFLFKVNVPELQRKIVRFRLIGISKPDV-HMEISKALVQISDVDLKKAKRLWLNMKEMSAEE-DARGEIMLSLTYLPTASRITLVIIKAKDLRWKILRQKSGDVMISVSLICNGRRVCKRQTSVKRKTKDPIFNESLIFSVNDPN-DDIFLRLTASEILPNGRLYTIGHCVLGSTS---TGIELTHWQQMISNPRRPSAMWHWLHK 383          
BLAST of Synaptotagmin-1 vs. Planmine SMEST
Match: SMESG000025329.1 (SMESG000025329.1)

HSP 1 Score: 80.4925 bits (197), Expect = 5.295e-16
Identity = 67/278 (24.10%), Postives = 136/278 (48.92%), Query Frame = 1
Query:  649 GNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQ-KFGRATIPLNTVDPSMEVEIWLDMIIIE--LEKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQ 1473
            G L + L Y F+  +L V + Q  ++ +   S       T + ++ + + P   +K  +T + +   +PVF ETF F + + E+ +  L F++YD +   +SK  + G+  +PL  +D    +E W ++   E   EK    G +  SL Y+P++ +LT+VI++AK++   ++   +  Y+      + +++ KK  T  +   +  +NE  +F+   E++  +   V ++  D  G    IG   LG ++   + + H+ D++   +     WH +Q
Sbjct:  122 GKLQYSLDYDFQKGELTVGVIQATDLPAMDMS------GTSDPYVKLYLLPDKKKKF-ETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDR--FSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATG-AELRHWSDMLANPRRPIAQWHTLQ 389          
BLAST of Synaptotagmin-1 vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.531e-15
Identity = 73/304 (24.01%), Postives = 143/304 (47.04%), Query Frame = 1
Query:  577 VIPDLYQRRGTIIRRESSPS--ASVCGNLHFKLLYLFKTSDLMVKIEQVXXXXXXXXXXXXXXKSTLNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLTFSLYDLNEEDYSKQ-KFGRATIPLNTVDPSMEVEIWLDMIIIEL--EKRETRGQLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKIIKKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIGDFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQ 1473
            V PDL +    +   E +    A   G L + L Y F   +L V + Q  ++ +           T + ++ + + P   +K  +T + +   +PVF ETF F I Y E+ +  L F+++D +   +SK  + G+  IPL +VD    +E W ++   +   EK    G +  SL Y+P++ +L +VI++AK++   ++   +  Y+      + +++ KK  T  +   +  +NE  +F+   E++  +   V ++  D  G    IG   LG ++   + + H+ D++   +     WH +Q
Sbjct:  105 VQPDLEELDANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDM------SGTSDPYVKVFLLPDKKKKF-ETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDR--FSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATG-AELRHWSDMLANPRRPIAQWHTLQ 398          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT98.764e-2624.67synaptotagmin 9 [Source:HGNC Symbol;Acc:HGNC:19265... [more]
SYT114.034e-2329.66synaptotagmin 11 [Source:HGNC Symbol;Acc:HGNC:1923... [more]
SYT34.450e-2225.16synaptotagmin 3 [Source:HGNC Symbol;Acc:HGNC:11511... [more]
SYT34.450e-2225.16synaptotagmin 3 [Source:HGNC Symbol;Acc:HGNC:11511... [more]
SYT34.450e-2225.16synaptotagmin 3 [Source:HGNC Symbol;Acc:HGNC:11511... [more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-13.852e-1623.83Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-18.404e-1625.36Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-24.672e-1524.83Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-38.725e-1422.99SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-38.725e-1422.99SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sytbeta7.475e-2926.58gene:FBgn0261090 transcript:FBtr0299848[more]
Sytbeta1.308e-2826.58gene:FBgn0261090 transcript:FBtr0299849[more]
Syt18.221e-2024.83gene:FBgn0004242 transcript:FBtr0343993[more]
Syt14.471e-1925.09gene:FBgn0004242 transcript:FBtr0077726[more]
Syt15.594e-1925.09gene:FBgn0004242 transcript:FBtr0077728[more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt9b1.595e-2527.36synaptotagmin IXb [Source:ZFIN;Acc:ZDB-GENE-040822... [more]
syt9a6.933e-2527.97synaptotagmin IXa [Source:ZFIN;Acc:ZDB-GENE-031002... [more]
CR381655.12.876e-2326.40synaptotagmin III [Source:NCBI gene;Acc:100000615][more]
syt35.356e-2227.12synaptotagmin III [Source:ZFIN;Acc:ZDB-GENE-090601... [more]
CR381655.15.586e-2227.12synaptotagmin III [Source:NCBI gene;Acc:100000615][more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT98.010e-2427.87synaptotagmin 9 [Source:NCBI gene;Acc:100497543][more]
wnt61.768e-2124.84Wnt family member 6 [Source:Xenbase;Acc:XB-GENE-48... [more]
luzp27.502e-1927.03leucine zipper protein 2 [Source:Xenbase;Acc:XB-GE... [more]
e2f41.151e-1825.26E2F transcription factor 4 [Source:Xenbase;Acc:XB-... [more]
cfap1006.325e-1827.12cilia and flagella associated protein 100 [Source:... [more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt95.371e-2527.60synaptotagmin IX [Source:MGI Symbol;Acc:MGI:192637... [more]
Syt116.898e-2430.58synaptotagmin XI [Source:MGI Symbol;Acc:MGI:185954... [more]
Syt111.723e-2330.00synaptotagmin XI [Source:MGI Symbol;Acc:MGI:185954... [more]
Syt111.723e-2330.00synaptotagmin XI [Source:MGI Symbol;Acc:MGI:185954... [more]
Syt39.900e-2225.73synaptotagmin III [Source:MGI Symbol;Acc:MGI:99665... [more]
back to top
BLAST of Synaptotagmin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86SS6|SYT9_HUMAN4.209e-2524.67Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE... [more]
sp|Q9R0N9|SYT9_MOUSE3.757e-2427.60Synaptotagmin-9 OS=Mus musculus OX=10090 GN=Syt9 P... [more]
sp|Q925C0|SYT9_RAT4.237e-2427.60Synaptotagmin-9 OS=Rattus norvegicus OX=10116 GN=S... [more]
sp|P24507|SY63_DIPOM5.053e-2327.04Synaptotagmin-C OS=Diplobatis ommata OX=1870830 GN... [more]
sp|Q9R0N3|SYT11_MOUSE1.205e-2230.00Synaptotagmin-11 OS=Mus musculus OX=10090 GN=Syt11... [more]
back to top
BLAST of Synaptotagmin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HDC61.254e-4632.15synaptotagmin-6-like OS=Lingula unguis OX=7574 GN=... [more]
K1R2201.450e-3826.57Synaptotagmin-C OS=Crassostrea gigas OX=29159 GN=C... [more]
A0A2C9K0544.731e-3729.57Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A0L8H1107.684e-3734.24Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A2C9K0569.119e-3729.57Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt9b3.481e-2527.51synaptotagmin 9 [Source:NCBI gene;Acc:103033725][more]
syt33.500e-2227.12synaptotagmin III [Source:ZFIN;Acc:ZDB-GENE-090601... [more]
syt34.970e-2227.12synaptotagmin III [Source:ZFIN;Acc:ZDB-GENE-090601... [more]
syt6b5.113e-2124.24synaptotagmin-6 [Source:NCBI gene;Acc:103047010][more]
syt5a5.874e-2124.64synaptotagmin-2-like [Source:NCBI gene;Acc:1030278... [more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000226.13.235e-1329.20pep scaffold:Pmarinus_7.0:GL478944:1404:4221:1 gen... [more]
ENSPMAT00000003267.15.266e-1224.31pep scaffold:Pmarinus_7.0:GL476427:260045:262512:1... [more]
syt129.357e-1124.79synaptotagmin XII [Source:ZFIN;Acc:ZDB-GENE-081022... [more]
SYT61.550e-1027.61synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638... [more]
syt42.004e-1022.87synaptotagmin IV [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO330815.002e-1926.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317471.257e-1726.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500134.619e-1626.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317481.811e-1526.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319754.324e-1524.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt9a1.571e-2725.70synaptotagmin-9 [Source:NCBI gene;Acc:101174010][more]
syt9a8.494e-2627.22synaptotagmin-9 [Source:NCBI gene;Acc:101174010][more]
syt9b4.816e-2527.04synaptotagmin-9 [Source:NCBI gene;Acc:101171486][more]
syt9b5.915e-2527.04synaptotagmin-9 [Source:NCBI gene;Acc:101171486][more]
syt101.309e-2325.65synaptotagmin-10 [Source:NCBI gene;Acc:101162492][more]
back to top
BLAST of Synaptotagmin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048136.10.000e+099.77SMESG000048136.1[more]
SMESG000008756.11.543e-1726.70SMESG000008756.1[more]
SMESG000008756.12.007e-1726.70SMESG000008756.1[more]
SMESG000025329.15.295e-1624.10SMESG000025329.1[more]
SMESG000055143.11.531e-1524.01SMESG000055143.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007426 ID=SMED30007426|Name=Synaptotagmin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1584bp
CTTACAATGACATTTGCAGATACTATTCTCCTAGTTTCCTACTTATCTAA
AACTATTCTCCGACAGAAGCAAATGAGATTTATTCTTACATTGAATTTCG
GATGCCTCCATTAGAAATTGTATTTTGTTGGGTATATTTCGCCAGTTGAC
AACTGATCTGAATTGGCAATGAAAATCGGATCGGCAGAGATCATTGTAAT
TGCTGCTGGAATCTCAATCGCATTAATTGGAGTTATTGCCGGAGTTTTAA
TTTGGATTTTTCATCGGAAACGAAAACTCCGAAAAGAAACAGAGAGAATG
TTGAATGAAAAATCGAATTTAGTTTTTCCACAAAATGGAGTCGGGCAAAC
TCAACAAACATTTGAAGAAATACGCCAATGCATGATGGAGTCTCCATCTC
CAACCGATCCTCAATATCTTGGACCAAGAAGTAGTTTTGCAGGATATAAT
TTACCAAAAAAGGTTCACACTTATGGCTCAATATCTGATTCTCTTTCAAT
TTGTCGAACTGAAAGTTACAAGTCTCGGAAAACGAGTACTGACAGCGGTA
TAGCAAGTTCTATTGGAATCGGAAATGTCATTCCAGATCTGTATCAAAGG
CGAGGCACGATAATCAGACGGGAGTCAAGTCCATCTGCTTCAGTTTGTGG
GAACCTGCATTTTAAATTACTTTATTTATTTAAAACTTCTGATCTGATGG
TCAAAATTGAACAAGTGAATAACATCTCTTCGTCAATCGCCTCACTATTA
AATGCAAATAAGTCGACTCTTAATTCTTTCATTACAATTGAGATGAATCC
AGCTGTTGACCAGAAAATTCGACAAACCTCTCTGAAAAAGAATGACTTTT
CTCCGGTATTTGGAGAAACCTTTAAATTTCCAATAGCCTATGAAGAACTG
TATACGCATTTATTAACATTTTCCCTTTATGATTTAAACGAAGAAGATTA
TTCCAAGCAAAAATTCGGCAGGGCAACTATTCCATTAAACACAGTTGATC
CGAGCATGGAAGTCGAAATTTGGCTTGATATGATTATCATAGAACTTGAG
AAACGTGAAACACGAGGCCAGCTACTTGTCAGTCTCAATTATTTACCTTC
AGCTGAGCGATTAACGCTCGTCATAATGAAAGCTAAAGATGTTATCATTC
CAAACATAAACGAAGATAACCTAAGTTATCTTGTTAGAGTCAATCAATTT
GACAAAGAGAAGATCATTAAGAAACATAAAACTGGATGTCAGAAGCAGGA
CAGCTTGGTCTGGAACGAAGTGATGGCGTTCAAATTCAACAAAGAAAAAT
TAAATGATATCTATTTCCAAGTCAAACTAATACAGAAAGATGTAAAAGGA
AATGAAATAAATATCGGTGATTTCTCTTTGGGAACTCATTCAAACAGTCG
CAGTGGAATGGAACATTTCTACGATATAATCTGTGAGTCTAAGGAAACAT
TCACAATGTGGCACAACATTCAGAGGGATCTCTAAGAGAATATTTAGAAT
CCATATTTGTTGGTGTTTTGTTCAACAGACTCATTGATTTCATCTGTGCA
ACACTTATTTTTCTATGAATGTCTATGATTGTCC
back to top

protein sequence of SMED30007426-orf-1

>SMED30007426-orf-1 ID=SMED30007426-orf-1|Name=SMED30007426-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=439bp
MKIGSAEIIVIAAGISIALIGVIAGVLIWIFHRKRKLRKETERMLNEKSN
LVFPQNGVGQTQQTFEEIRQCMMESPSPTDPQYLGPRSSFAGYNLPKKVH
TYGSISDSLSICRTESYKSRKTSTDSGIASSIGIGNVIPDLYQRRGTIIR
RESSPSASVCGNLHFKLLYLFKTSDLMVKIEQVNNISSSIASLLNANKST
LNSFITIEMNPAVDQKIRQTSLKKNDFSPVFGETFKFPIAYEELYTHLLT
FSLYDLNEEDYSKQKFGRATIPLNTVDPSMEVEIWLDMIIIELEKRETRG
QLLVSLNYLPSAERLTLVIMKAKDVIIPNINEDNLSYLVRVNQFDKEKII
KKHKTGCQKQDSLVWNEVMAFKFNKEKLNDIYFQVKLIQKDVKGNEINIG
DFSLGTHSNSRSGMEHFYDIICESKETFTMWHNIQRDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 175..285
e-value: 6.6E-9
score: 45.6
coord: 314..411
e-value: 3.1
score: 12.7
IPR000008C2 domainPFAMPF00168C2coord: 176..287
e-value: 3.6E-10
score: 40.1
coord: 314..419
e-value: 5.9E-4
score: 20.1
IPR000008C2 domainPROSITEPS50004C2coord: 174..270
score: 9.938
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 151..290
e-value: 2.7E-19
score: 71.3
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 291..436
e-value: 5.2E-20
score: 73.5
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 92..434
NoneNo IPR availablePANTHERPTHR10024:SF353SYNAPTOTAGMIN BETA, ISOFORM Dcoord: 92..434
NoneNo IPR availableCDDcd00276C2B_Synaptotagmincoord: 300..432
e-value: 9.54467E-28
score: 104.973
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 299..434
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 153..288
NoneNo IPR availableTMHMMTMhelixcoord: 9..31