Ubiquitin-conjugating enzyme E2 L3

Overview
NameUbiquitin-conjugating enzyme E2 L3
Smed IDSMED30007414
Length (bp)939
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-conjugating enzyme E2 L3 (SMED30007414) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-conjugating enzyme E2 L3 (SMED30007414) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin-conjugating enzyme E2 L3 (SMED30007414) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin-conjugating enzyme E2 L3 (SMED30007414) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007414

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30007414SMESG000059431.1 dd_Smed_v4_667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007414SMESG000059431.1 dd_Smed_v4_667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007414SMESG000059431.1 dd_Smed_v4_667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007414SMESG000059431.1 dd_Smed_v4_667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Human
Match: UBE2L3 (ubiquitin conjugating enzyme E2 L3 [Source:HGNC Symbol;Acc:HGNC:12488])

HSP 1 Score: 200.675 bits (509), Expect = 4.011e-64
Identity = 102/158 (64.56%), Postives = 133/158 (84.18%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL       E++KC    FR IQVD+ N+L WQGLIVP+NPPY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKKY EKRP
Sbjct:    1 MAASRRLMKELE------EIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Human
Match: UBE2L5 (ubiquitin conjugating enzyme E2 L5 [Source:HGNC Symbol;Acc:HGNC:13477])

HSP 1 Score: 200.675 bits (509), Expect = 4.520e-64
Identity = 101/158 (63.92%), Postives = 132/158 (83.54%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL       E++KC    FR IQVD+ N+L WQGLIVP+NPPYNKGAF+++I+FP EYPFKPP+IT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++ +++ F KNAEE+TKKY EKRP
Sbjct:    1 MAASRRLMKELE------EIRKCGMENFRNIQVDEANLLTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKPPRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSNDRKKFCKNAEEFTKKYGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Human
Match: UBE2L5 (ubiquitin conjugating enzyme E2 L5 [Source:HGNC Symbol;Acc:HGNC:13477])

HSP 1 Score: 200.675 bits (509), Expect = 4.520e-64
Identity = 101/158 (63.92%), Postives = 132/158 (83.54%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL       E++KC    FR IQVD+ N+L WQGLIVP+NPPYNKGAF+++I+FP EYPFKPP+IT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++ +++ F KNAEE+TKKY EKRP
Sbjct:    1 MAASRRLMKELE------EIRKCGMENFRNIQVDEANLLTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKPPRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSNDRKKFCKNAEEFTKKYGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Human
Match: UBE2L5 (ubiquitin conjugating enzyme E2 L5 [Source:HGNC Symbol;Acc:HGNC:13477])

HSP 1 Score: 200.675 bits (509), Expect = 4.520e-64
Identity = 101/158 (63.92%), Postives = 132/158 (83.54%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL       E++KC    FR IQVD+ N+L WQGLIVP+NPPYNKGAF+++I+FP EYPFKPP+IT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++ +++ F KNAEE+TKKY EKRP
Sbjct:    1 MAASRRLMKELE------EIRKCGMENFRNIQVDEANLLTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKPPRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSNDRKKFCKNAEEFTKKYGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Human
Match: UBE2L3 (ubiquitin conjugating enzyme E2 L3 [Source:HGNC Symbol;Acc:HGNC:12488])

HSP 1 Score: 191.815 bits (486), Expect = 8.848e-60
Identity = 94/140 (67.14%), Postives = 123/140 (87.86%), Query Frame = 2
Query:  107 EVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            E++KC    FR IQVD+ N+L WQGLIVP+NPPY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKKY EKRP
Sbjct:   71 EIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRP 210          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Celegans
Match: ubc-18 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:Q21633])

HSP 1 Score: 176.407 bits (446), Expect = 4.471e-55
Identity = 89/154 (57.79%), Postives = 122/154 (79.22%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            MSA+RR+QKEL D++N     K +  ++ ++ N+L W  L++P+  PYNKGAFKV I FPV+YPFKPPK+  +TKIYHPNVDE+G+ C+PI+T ENWKPATK EQV+  L+++I++P+  H +RADVAEEF K+ + FMK AEE+T+K+AEKRP
Sbjct:    1 MSATRRLQKELGDLKNCG--VKAYENVECEETNLLKWTVLLIPDKEPYNKGAFKVGITFPVDYPFKPPKVAFETKIYHPNVDEEGKFCLPIVTAENWKPATKTEQVMMALLSLINEPEPSHPIRADVAEEFQKDHKKFMKTAEEHTRKHAEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Celegans
Match: let-70 (Ubiquitin-conjugating enzyme E2 2 [Source:UniProtKB/Swiss-Prot;Acc:P35129])

HSP 1 Score: 92.8189 bits (229), Expect = 5.790e-23
Identity = 57/149 (38.26%), Postives = 87/149 (58.39%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RIQKEL D+   P  Q C      DD  +  WQ  I+ P   PY  G F + I FP +YPFKPPK+   T+IYHPN++  G IC+ I+    W PA  I +V+ ++ +++ DP+ D  L  ++A  +  +++ + + A E+T+KYA
Sbjct:    2 ALKRIQKELQDLGRDPPAQ-CSAGPVGDD--LFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRERYNQLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Celegans
Match: ubc-13 (Ubiquitin-conjugating enzyme E2 13 [Source:UniProtKB/Swiss-Prot;Acc:Q95XX0])

HSP 1 Score: 78.1814 bits (191), Expect = 1.844e-17
Identity = 44/123 (35.77%), Postives = 76/123 (61.79%), Query Frame = 2
Query:  140 DDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAE 505
            D+ N   +  +I  P++ P+  G FK+++  P EYP   PK+   TKIYHPN+D+ G+IC+ I+  + W PA +I  V+ ++ A++  P+ +  L  DVAE++  N+   +K A+++T  YA+
Sbjct:   29 DESNARYFHVMIAGPDDSPFAGGVFKLELFLPEEYPMAAPKVRFMTKIYHPNIDKLGRICLDILK-DKWSPALQIRTVLLSIQALLSAPNPEDPLATDVAEQWKTNEAEAIKTAKQWTMNYAQ 150          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Celegans
Match: ubc-24 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:Q20617])

HSP 1 Score: 72.7886 bits (177), Expect = 1.807e-15
Identity = 54/146 (36.99%), Postives = 86/146 (58.90%), Query Frame = 2
Query:   68 RIQKELSDI-QNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDE-KGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKY 499
            RI+KE++D+ +NK    K FR+I+   K   ++Q  I+ +   Y    F + +D  VEYPFKPP +     +YHPNVD    ++C P++  ENWKP T +E V+ NL+ ++++PD    +  D A ++  NK  F+K + E  KK+
Sbjct:   17 RIRKEIADLAKNKRRFIKDFRKIE---KCKDIFQFKIIGDGVLYKNMIFTLTLDVNVEYPFKPPYLKFCHNVYHPNVDPVTCELCSPMLLQENWKPETTMEDVLLNLIVLLNEPDLSRPVNIDAAHDYIHNKVEFVKKSTELAKKW 159          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Celegans
Match: ubc-21 (Probable ubiquitin-conjugating enzyme E2 21 [Source:UniProtKB/Swiss-Prot;Acc:P52484])

HSP 1 Score: 74.3294 bits (181), Expect = 1.915e-15
Identity = 44/153 (28.76%), Postives = 83/153 (54.25%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLI-VPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNV-DEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKR 511
            A  R+ ++  ++ N  ++ +    +++ + N++  +G I  PE  PY  G F++++D P  YPF+PPK    T+I+HPN+  + G IC+ I+  + W  +  +  V+ +L AM+  P+      A VA++F  N  +F   A  +T  +A  +
Sbjct:   19 ALARVTRKCKEVANASDITEAGIHVEIKENNLMDIKGFIKGPEGTPYAGGTFEIKVDIPEHYPFEPPKAKFVTRIWHPNISSQTGTICLDILK-DKWTASLTLRTVLLSLQAMLCSPEPSDPQDAVVAKQFINNYPMFTATAVYWTSYFANSK 170          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Fly
Match: Ubc10 (gene:FBgn0026316 transcript:FBtr0089553)

HSP 1 Score: 199.134 bits (505), Expect = 6.997e-64
Identity = 98/154 (63.64%), Postives = 131/154 (85.06%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+A RR++KELSD+Q      K FR+I+ DD N+L W GLIVP+NPPYNKGAF+++I+FP EYPFKPPKI  KT+IYHPN+DEKGQ+C+PII+ ENWKPAT+ +QV+Q LV +I+DP+ +H LRA++AEEF K+++ F+KNAE+YTKK++EKRP
Sbjct:    1 MTAPRRLRKELSDLQG--NALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFLKDRKKFVKNAEDYTKKHSEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Fly
Match: Ubc84D (gene:FBgn0017456 transcript:FBtr0081552)

HSP 1 Score: 180.644 bits (457), Expect = 1.477e-56
Identity = 88/154 (57.14%), Postives = 121/154 (78.57%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+A+RR+ +ELSD+          R I+  D+++L+W GL+VPE  PYNKGAF+++I+FP +YPF PPKI  KTKIYHPNVDEKG++C+PII+ +NWKP T+ EQV+Q LVA++H+P+ +H LR+D+AEEF +  + FMK AEE+TKK AEKRP
Sbjct:    1 MAATRRLTRELSDLVEAK--MSTLRNIESSDESLLMWTGLLVPEKAPYNKGAFRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVREHKKFMKTAEEFTKKNAEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Fly
Match: CG17030 (gene:FBgn0035584 transcript:FBtr0073374)

HSP 1 Score: 128.642 bits (322), Expect = 4.670e-36
Identity = 68/157 (43.31%), Postives = 111/157 (70.70%), Query Frame = 2
Query:   50 IMSASRRIQKELS-DIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRPN 517
            +M   +R+ +EL+  +++K  +Q  FR + V+  NI  W GL++P  PPY+KGA+K++IDFP++YPFKPP+I I T++YH NV+E+GQ+C+PI+  E+W P T+I+QV+Q L+A I+DP  ++    ++A E+  +   F K A+ + +KY+E RP 
Sbjct:    8 LMDGPKRMNRELALMLEDKQNLQ--FRNLLVEPNNIYKWTGLLMPVAPPYDKGAYKMEIDFPLDYPFKPPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRNDPVRFFKMADAWVQKYSEPRPT 162          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Fly
Match: eff (gene:FBgn0011217 transcript:FBtr0310554)

HSP 1 Score: 92.0485 bits (227), Expect = 1.458e-22
Identity = 56/149 (37.58%), Postives = 87/149 (58.39%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RI KEL D+   P  Q C      DD  +  WQ  I+ P + PY  G F + I FP +YPFKPPK+   T+IYHPN++  G IC+ I+    W PA  I +V+ ++ +++ DP+ D  L  ++A  +  +++ + + A E+T+KYA
Sbjct:    2 ALKRINKELQDLGRDPPAQ-CSAGPVGDD--LFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Fly
Match: eff (gene:FBgn0011217 transcript:FBtr0336876)

HSP 1 Score: 92.0485 bits (227), Expect = 1.458e-22
Identity = 56/149 (37.58%), Postives = 87/149 (58.39%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RI KEL D+   P  Q C      DD  +  WQ  I+ P + PY  G F + I FP +YPFKPPK+   T+IYHPN++  G IC+ I+    W PA  I +V+ ++ +++ DP+ D  L  ++A  +  +++ + + A E+T+KYA
Sbjct:    2 ALKRINKELQDLGRDPPAQ-CSAGPVGDD--LFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Zebrafish
Match: ube2l3a (ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;Acc:ZDB-GENE-030131-2977])

HSP 1 Score: 201.06 bits (510), Expect = 1.882e-64
Identity = 101/154 (65.58%), Postives = 131/154 (85.06%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL +I+      K FR IQVD+ NIL WQGLIVP+NPPY+KGAF+++I FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKK+ EKRP
Sbjct:    1 MAASRRLHKELDEIRK--SGMKNFRNIQVDESNILTWQGLIVPDNPPYDKGAFRIEITFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKHGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Zebrafish
Match: ube2l3a (ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;Acc:ZDB-GENE-030131-2977])

HSP 1 Score: 201.445 bits (511), Expect = 2.549e-64
Identity = 101/154 (65.58%), Postives = 131/154 (85.06%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL +I+      K FR IQVD+ NIL WQGLIVP+NPPY+KGAF+++I FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKK+ EKRP
Sbjct:   19 MAASRRLHKELDEIRK--SGMKNFRNIQVDESNILTWQGLIVPDNPPYDKGAFRIEITFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKHGEKRP 170          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Zebrafish
Match: ube2l3a (ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;Acc:ZDB-GENE-030131-2977])

HSP 1 Score: 201.445 bits (511), Expect = 2.549e-64
Identity = 101/154 (65.58%), Postives = 131/154 (85.06%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL +I+      K FR IQVD+ NIL WQGLIVP+NPPY+KGAF+++I FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKK+ EKRP
Sbjct:   19 MAASRRLHKELDEIRK--SGMKNFRNIQVDESNILTWQGLIVPDNPPYDKGAFRIEITFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKHGEKRP 170          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Zebrafish
Match: ube2l3b (ubiquitin-conjugating enzyme E2L 3b [Source:ZFIN;Acc:ZDB-GENE-030131-662])

HSP 1 Score: 199.904 bits (507), Expect = 5.577e-64
Identity = 101/154 (65.58%), Postives = 131/154 (85.06%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL +I+      K FR IQVD+ NIL WQGLIVP+NPPY+KGAF+++I FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKK+ EKRP
Sbjct:    1 MAASRRLHKELEEIRK--SGMKNFRNIQVDESNILTWQGLIVPDNPPYDKGAFRIEIIFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKHGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Zebrafish
Match: ube2l3b (ubiquitin-conjugating enzyme E2L 3b [Source:ZFIN;Acc:ZDB-GENE-030131-662])

HSP 1 Score: 184.882 bits (468), Expect = 2.153e-58
Identity = 92/133 (69.17%), Postives = 118/133 (88.72%), Query Frame = 2
Query:  116 KCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            K FR IQVD+ NIL WQGLIVP+NPPY+KGAF+++I FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKK+ EKRP
Sbjct:    2 KNFRNIQVDESNILTWQGLIVPDNPPYDKGAFRIEIIFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKHGEKRP 134          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Xenopus
Match: themis (thymocyte selection associated [Source:Xenbase;Acc:XB-GENE-994469])

HSP 1 Score: 201.445 bits (511), Expect = 1.663e-64
Identity = 101/154 (65.58%), Postives = 132/154 (85.71%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL +I+      K FR IQV+D N+L WQGLIVP+NPPY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKKY EKRP
Sbjct:    1 MAASRRLMKELEEIRKT--GMKNFRNIQVEDSNLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Xenopus
Match: themis (thymocyte selection associated [Source:Xenbase;Acc:XB-GENE-994469])

HSP 1 Score: 187.578 bits (475), Expect = 4.569e-59
Identity = 92/133 (69.17%), Postives = 119/133 (89.47%), Query Frame = 2
Query:  116 KCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            K FR IQV+D N+L WQGLIVP+NPPY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKKY EKRP
Sbjct:   22 KNFRNIQVEDSNLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRP 154          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Xenopus
Match: chmp2b (charged multivesicular body protein 2B [Source:Xenbase;Acc:XB-GENE-948820])

HSP 1 Score: 99.7525 bits (247), Expect = 3.111e-25
Identity = 60/149 (40.27%), Postives = 91/149 (61.07%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RIQKEL+D+Q  P  Q C      DD  +  WQ  I+ P + PY  G F + I FP +YPFKPPK+   TKIYHPN++  G IC+ I+    W PA  + +V+ ++ +++ DP+ D  L  D+A+ +  +K+ + + A E+T+KYA
Sbjct:    2 ALKRIQKELNDLQRDPPAQ-CSAGPVGDD--LFHWQATIMGPTDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR-SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Xenopus
Match: eif2s2 (eukaryotic translation initiation factor 2 subunit beta [Source:Xenbase;Acc:XB-GENE-964372])

HSP 1 Score: 95.1301 bits (235), Expect = 2.228e-23
Identity = 55/149 (36.91%), Postives = 88/149 (59.06%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RIQKEL D+Q  P  Q     +  D   +  WQ  I+ P + P+  G F + I FP +YPFKPPK+   TKIYHPN++  G IC+ I+    W PA  + +V+ ++ +++ DP+ D  L  ++A  +  +++ + + A E+T+KYA
Sbjct:    2 ALKRIQKELMDLQRDPPAQCSAGPVGED---LFHWQATIMGPNDSPFQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR-SQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Xenopus
Match: ube2d3 (ubiquitin conjugating enzyme E2 D3 [Source:NCBI gene;Acc:548818])

HSP 1 Score: 92.8189 bits (229), Expect = 1.293e-22
Identity = 56/149 (37.58%), Postives = 88/149 (59.06%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RI KEL+D+   P  Q C      DD  +  WQ  I+ P + PY  G F + I FP +YPFKPPK+   T+IYHPN++  G IC+ I+    W PA  I +V+ ++ +++ DP+ D  L  ++A  +  +++ + + A E+T+KYA
Sbjct:    2 ALKRIHKELNDLARDPPAQ-CSAGPVGDD--MFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Mouse
Match: Ube2l3 (ubiquitin-conjugating enzyme E2L 3 [Source:MGI Symbol;Acc:MGI:109240])

HSP 1 Score: 200.675 bits (509), Expect = 2.753e-64
Identity = 102/158 (64.56%), Postives = 133/158 (84.18%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL       E++KC    FR IQVD+ N+L WQGLIVP+NPPY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKKY EKRP
Sbjct:    1 MAASRRLMKELE------EIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Mouse
Match: Ube2l3 (ubiquitin-conjugating enzyme E2L 3 [Source:MGI Symbol;Acc:MGI:109240])

HSP 1 Score: 200.675 bits (509), Expect = 2.753e-64
Identity = 102/158 (64.56%), Postives = 133/158 (84.18%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL       E++KC    FR IQVD+ N+L WQGLIVP+NPPY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKKY EKRP
Sbjct:    1 MAASRRLMKELE------EIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Mouse
Match: Ube2l3 (ubiquitin-conjugating enzyme E2L 3 [Source:MGI Symbol;Acc:MGI:109240])

HSP 1 Score: 172.94 bits (437), Expect = 1.347e-53
Identity = 89/143 (62.24%), Postives = 119/143 (83.22%), Query Frame = 2
Query:   56 SASRRIQKELSDIQNKPEVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMK 472
            +ASRR+ KEL       E++KC    FR IQVD+ N+L WQGLIVP+NPPY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F K
Sbjct:    2 AASRRLMKELE------EIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFWK 138          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Mouse
Match: Ube2l3 (ubiquitin-conjugating enzyme E2L 3 [Source:MGI Symbol;Acc:MGI:109240])

HSP 1 Score: 154.451 bits (389), Expect = 1.392e-46
Identity = 76/114 (66.67%), Postives = 103/114 (90.35%), Query Frame = 2
Query:  173 IVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            ++ +NPPY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKKY EKRP
Sbjct:    7 LMKDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRP 120          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Mouse
Match: Ube2l3 (ubiquitin-conjugating enzyme E2L 3 [Source:MGI Symbol;Acc:MGI:109240])

HSP 1 Score: 135.191 bits (339), Expect = 2.647e-39
Identity = 72/109 (66.06%), Postives = 90/109 (82.57%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQ 367
            M+ASRR+ KEL       E++KC    FR IQVD+ N+L WQGLIVP+NPPY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +Q
Sbjct:    1 MAASRRLMKELE------EIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQ 103          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. UniProt/SwissProt
Match: sp|P68037|UB2L3_MOUSE (Ubiquitin-conjugating enzyme E2 L3 OS=Mus musculus OX=10090 GN=Ube2l3 PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.926e-63
Identity = 102/158 (64.56%), Postives = 133/158 (84.18%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL       E++KC    FR IQVD+ N+L WQGLIVP+NPPY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKKY EKRP
Sbjct:    1 MAASRRLMKELE------EIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. UniProt/SwissProt
Match: sp|P68036|UB2L3_HUMAN (Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3 PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.926e-63
Identity = 102/158 (64.56%), Postives = 133/158 (84.18%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL       E++KC    FR IQVD+ N+L WQGLIVP+NPPY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKKY EKRP
Sbjct:    1 MAASRRLMKELE------EIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. UniProt/SwissProt
Match: sp|Q3MHP1|UB2L3_BOVIN (Ubiquitin-conjugating enzyme E2 L3 OS=Bos taurus OX=9913 GN=UBE2L3 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.926e-63
Identity = 102/158 (64.56%), Postives = 133/158 (84.18%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL       E++KC    FR IQVD+ N+L WQGLIVP+NPPY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKKY EKRP
Sbjct:    1 MAASRRLMKELE------EIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. UniProt/SwissProt
Match: sp|A0A1B0GUS4|UB2L5_HUMAN (Ubiquitin-conjugating enzyme E2 L5 OS=Homo sapiens OX=9606 GN=UBE2L5 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 2.170e-63
Identity = 101/158 (63.92%), Postives = 132/158 (83.54%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKC----FREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL       E++KC    FR IQVD+ N+L WQGLIVP+NPPYNKGAF+++I+FP EYPFKPP+IT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++ +++ F KNAEE+TKKY EKRP
Sbjct:    1 MAASRRLMKELE------EIRKCGMENFRNIQVDEANLLTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKPPRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSNDRKKFCKNAEEFTKKYGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. UniProt/SwissProt
Match: sp|Q7K738|UBC10_DROME (Ubiquitin-conjugating enzyme E2-18 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc10 PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 7.014e-63
Identity = 98/154 (63.64%), Postives = 131/154 (85.06%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+A RR++KELSD+Q      K FR+I+ DD N+L W GLIVP+NPPYNKGAF+++I+FP EYPFKPPKI  KT+IYHPN+DEKGQ+C+PII+ ENWKPAT+ +QV+Q LV +I+DP+ +H LRA++AEEF K+++ F+KNAE+YTKK++EKRP
Sbjct:    1 MTAPRRLRKELSDLQG--NALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFLKDRKKFVKNAEDYTKKHSEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. TrEMBL
Match: V4BEB1 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_198904 PE=3 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.203e-67
Identity = 109/156 (69.87%), Postives = 137/156 (87.82%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRPNN 520
            M+A+RR+QKEL+DI+     QK FR+I+VDD NIL WQGLIVP+ PPYNKGAFK++I FP EYPFKPPK+  KTKIYHPNVDEKGQIC+PII+PENWKPATK +QVIQ L+A+IHDP+ +H LR D+AEEFTK+K+ FMKNAE++TKK++E+RP++
Sbjct:    1 MAATRRLQKELNDIRQ--SDQKGFRDIRVDDSNILFWQGLIVPDVPPYNKGAFKIEISFPAEYPFKPPKLAFKTKIYHPNVDEKGQICLPIISPENWKPATKTDQVIQALLALIHDPEPEHPLRGDLAEEFTKDKKKFMKNAEDFTKKFSERRPSD 154          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. TrEMBL
Match: A0A1I8H8E7 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023549g1 PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.089e-65
Identity = 103/157 (65.61%), Postives = 133/157 (84.71%), Query Frame = 2
Query:   50 IMSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRPNN 520
            + +++RR+QKEL+DI     +Q+ FR++Q  + NIL W GLIVPENPPYNKGAF++ IDFPVEYPFKPPK+T KTKIYHPNVDEKGQ+C+PII PENWKPATK EQV+Q L+AM+HDP+ ++ LR D+AEEF ++K+ FMKNAEE+T+K AE RP++
Sbjct:    1 MGASTRRLQKELADITKSEALQRVFRDVQASENNILAWSGLIVPENPPYNKGAFRINIDFPVEYPFKPPKVTFKTKIYHPNVDEKGQVCLPIINPENWKPATKTEQVVQALIAMVHDPEPENPLRGDLAEEFLRDKKKFMKNAEEFTRKNAEPRPSD 157          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. TrEMBL
Match: R7TJY7 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_153554 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.457e-65
Identity = 105/156 (67.31%), Postives = 137/156 (87.82%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRPNN 520
            M+A+RR+ KELSDI+     QK FR+I VD+ NIL W GLIVPENPPYNKGAF+++IDFP EYPFKPPKIT +T+IYHPN+DEKGQ+C+PII+ ENWKPATK +QVIQ+LVA+++DP+ +H LR ++AEE+TK+++ FMKNAEE+TKKY+EKRP++
Sbjct:    1 MAATRRLGKELSDIRT--SGQKVFRDIIVDESNILQWNGLIVPENPPYNKGAFRIRIDFPAEYPFKPPKITFQTRIYHPNIDEKGQVCLPIISAENWKPATKTDQVIQSLVALVNDPEPEHPLRGELAEEYTKDRKKFMKNAEEFTKKYSEKRPSD 154          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. TrEMBL
Match: A0A2R5LJP3 (Putative ubiquitin-protein ligase OS=Ornithodoros turicata OX=34597 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.594e-65
Identity = 106/154 (68.83%), Postives = 135/154 (87.66%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+A+RR+QKEL+DI+      K FREIQVD+ NIL WQGLIVPENPPYNKGAF+++I+FP EYPFKPPKIT +TKIYHPN+DEKGQ+C+PIIT +NWKPATK +QVIQ L+ +++DP+ +H LRAD+AEE+ K+K+ F+KNAEEYTKK++EKRP
Sbjct:    1 MAATRRLQKELADIRK--SGIKAFREIQVDESNILTWQGLIVPENPPYNKGAFRIEINFPAEYPFKPPKITFRTKIYHPNIDEKGQVCLPIITADNWKPATKTDQVIQALITLVNDPEPEHPLRADLAEEYNKDKKKFLKNAEEYTKKHSEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. TrEMBL
Match: A0A1W7R9A8 (Ubiquitin-conjugating enzyme E2 L3 OS=Hadrurus spadix OX=141984 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 4.008e-65
Identity = 105/154 (68.18%), Postives = 136/154 (88.31%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+A+RR+QKEL DIQ      + FR+IQVD+ NIL WQGLIVP+NPPYNKGAF+++I+FP EYPFKPPKIT +TKIYHPN+DEKGQ+C+PII+ ENWKPATK +QVIQ LVA+I+DP+ +H LRAD+AEE++K+++ F+KNAEE+T+KY+EKRP
Sbjct:    1 MAATRRLQKELQDIQK--SGMRSFRDIQVDETNILTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKPPKITFRTKIYHPNIDEKGQVCLPIISAENWKPATKTDQVIQALVALINDPEPEHPLRADLAEEYSKDRKKFVKNAEEFTRKYSEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Cavefish
Match: ube2l3a (ubiquitin-conjugating enzyme E2 L3 [Source:NCBI gene;Acc:103024125])

HSP 1 Score: 199.904 bits (507), Expect = 5.326e-64
Identity = 101/154 (65.58%), Postives = 131/154 (85.06%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL +I+      K FR IQVD+ NIL WQGLIVP+NPPY+KGAF+++I FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F KNAEE+TKK+ EKRP
Sbjct:    1 MAASRRLHKELDEIRK--SGMKNFRNIQVDESNILTWQGLIVPDNPPYDKGAFRIEIIFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKHGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Cavefish
Match: ube2l3b (ubiquitin conjugating enzyme E2 L3 [Source:NCBI gene;Acc:103044625])

HSP 1 Score: 192.2 bits (487), Expect = 4.133e-61
Identity = 97/154 (62.99%), Postives = 126/154 (81.82%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL +I+      K FR +QVD+ NIL WQGLI+P+NPPY KGAF+++I FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPAT  EQVIQ+L+ +++DP  +H LRAD+A+++ KN+  F KNAEE+TKK+ EKRP
Sbjct:    1 MAASRRLHKELEEIRK--SGMKNFRIVQVDESNILAWQGLILPDNPPYEKGAFRIEIIFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATTAEQVIQSLITLVNDPQPEHPLRADLAQDYIKNRSKFFKNAEEFTKKHGEKRP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Cavefish
Match: ube2l3b (ubiquitin conjugating enzyme E2 L3 [Source:NCBI gene;Acc:103044625])

HSP 1 Score: 177.948 bits (450), Expect = 3.935e-55
Identity = 91/147 (61.90%), Postives = 119/147 (80.95%), Query Frame = 2
Query:   74 QKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
             +EL +I+      K FR +QVD+ NIL WQGLI+P+NPPY KGAF+++I FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPAT  EQVIQ+L+ +++DP  +H LRAD+A+++ KN+  F KNAEE+TKK+ EKRP
Sbjct:   31 SQELEEIRKS--GMKNFRIVQVDESNILAWQGLILPDNPPYEKGAFRIEIIFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATTAEQVIQSLITLVNDPQPEHPLRADLAQDYIKNRSKFFKNAEEFTKKHGEKRP 175          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Cavefish
Match: ube2d1b (ubiquitin conjugating enzyme E2 D1 [Source:NCBI gene;Acc:103029965])

HSP 1 Score: 99.3673 bits (246), Expect = 3.430e-25
Identity = 60/149 (40.27%), Postives = 89/149 (59.73%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RIQKEL D+Q  P  Q C      DD  +  WQ  I+ P + PY  G F + I FP +YPFKPPK+   TKIYHPN++  G IC+ I+    W PA  + +V+ ++ +++ DP+ D  L  D+A  +  +K+ + + A E+T+KYA
Sbjct:    2 ALKRIQKELQDLQRDPPAQ-CSAGPVGDD--LFHWQATIMGPSDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR-SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAHIYKSDKEKYNRLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Cavefish
Match: ube2d4 (ubiquitin-conjugating enzyme E2 D4 [Source:NCBI gene;Acc:103022237])

HSP 1 Score: 97.8265 bits (242), Expect = 1.294e-24
Identity = 56/149 (37.58%), Postives = 89/149 (59.73%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RIQKEL+D+Q  P  Q     +  D   +  WQ  I+ P + PY  G F + I FP +YPFKPPK+   TKIYHPN++  G IC+ I+    W PA  + +V+ ++ +++ DP+ D  L  ++A  +  +++ + + A E+T+KYA
Sbjct:    2 ALKRIQKELTDLQRDPPAQCSAGPVGED---LFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR-SQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Sea Lamprey
Match: ube2l3a (ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;Acc:ZDB-GENE-030131-2977])

HSP 1 Score: 169.088 bits (427), Expect = 6.099e-53
Identity = 87/141 (61.70%), Postives = 114/141 (80.85%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKN 475
            ++A+    KEL+DI+      K FR I  +D NIL+W GLIVP+N PY+KGAF+++I+FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+PII  ENWKPATK +QVI  LVA+++DP+ +H LRADVAEE+TK+++ F+KN
Sbjct:    1 LAATTSFHKELTDIRT--SGMKNFRNILAEDSNILLWHGLIVPDNAPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPIINAENWKPATKTDQVINALVALVNDPEPEHPLRADVAEEYTKDRKKFLKN 139          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010378.1 (pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 gene:ENSPMAG00000009396.1 transcript:ENSPMAT00000010378.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 2.016e-19
Identity = 51/145 (35.17%), Postives = 81/145 (55.86%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEE 484
            M  +R + +EL+D+   P  Q C      DD  +  WQ  I+ P + PY  G F + I FP +YPFKPPK+   T+IYHPN++  G IC+ I+    W PA  I +V+ ++ +++ DP+ D  L  ++A  +  ++  + K A E
Sbjct:    1 MPPTRPLHQELNDLGRDPPAQ-CSAGPVGDD--LFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNKLARE 141          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Sea Lamprey
Match: ube2t (ubiquitin-conjugating enzyme E2T (putative) [Source:NCBI gene;Acc:768152])

HSP 1 Score: 73.559 bits (179), Expect = 2.335e-16
Identity = 40/107 (37.38%), Postives = 67/107 (62.62%), Query Frame = 2
Query:  191 PYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIIT--PEN-WKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            PY  G F +++  P  YPF+PPK+T  T IYHPN+D  G+IC+ I+   P+  W+P+  +  V+ ++  ++ +P+ D  L  D++ EF  NK  F+  A+ +T+K+A
Sbjct:   45 PYEGGIFSLEVQIPDRYPFEPPKVTFLTPIYHPNIDTAGRICLDILKMPPKGAWRPSLNVSTVLTSVQQLMGEPNPDDPLMPDISAEFKYNKPSFVSTAKSWTQKHA 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Sea Lamprey
Match: UBE2E1 (ubiquitin conjugating enzyme E2 E1 [Source:HGNC Symbol;Acc:HGNC:12477])

HSP 1 Score: 68.9366 bits (167), Expect = 7.131e-15
Identity = 38/119 (31.93%), Postives = 66/119 (55.46%), Query Frame = 2
Query:  149 NILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            NI  W+  I+ P    Y  G F + I F  EYPF    +T +T+IYH N++ +G IC+ I+  +NW PA  I +V+ ++ +++ D +    L   +A ++  N+    + A ++T +YA
Sbjct:    9 NIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFNTAGVTFRTRIYHCNINSQGVICLDIL-KDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRMARQWTMRYA 126          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Sea Lamprey
Match: ube2g2 (ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-050417-288])

HSP 1 Score: 65.0846 bits (157), Expect = 2.078e-13
Identity = 34/133 (25.56%), Postives = 72/133 (54.14%), Query Frame = 2
Query:  137 VDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPII------------TPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKK 496
            VD++N   W+ LI+ PE   +  G F   + FP +YP  PPK+    +++HPN+   G++C+ I+            + E W P   +E+++ ++V+M+ +P+ +     D ++ + ++++ F + A +  +K
Sbjct:    3 VDEENFFEWEALIMGPEGTCFEGGVFPAVLTFPPDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWREDREQFYRIAHQTVRK 135          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Yeast
Match: UBC5 (Ubiquitin-conjugating enzyme; mediates selective degradation of short-lived, abnormal, or excess proteins, including histone H3; central component of the cellular stress response; expression is heat inducible; protein abundance increases in response to DNA replication stress; UBC5 has a paralog, UBC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002466])

HSP 1 Score: 97.0561 bits (240), Expect = 3.396e-25
Identity = 59/151 (39.07%), Postives = 90/151 (59.60%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            MS+S+RI KELSD+   P    C      DD  +  WQ  I+ P + PY  G F + I FP +YPFKPPK+   TKIYHPN++  G IC+ I+  + W PA  + +V+ ++ +++ D + D  L  ++A+ +  +K  +   A+E+TKKYA
Sbjct:    1 MSSSKRIAKELSDLGRDPPAS-CSAGPVGDD--LYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINSSGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYA 147          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Yeast
Match: UBC4 (Ubiquitin-conjugating enzyme (E2); key E2 partner with Ubc1p for the anaphase-promoting complex (APC); mediates degradation of abnormal or excess proteins, including calmodulin and histone H3; regulates levels of DNA Polymerase-{alpha} to promote efficient and accurate DNA replication; interacts with many SCF ubiquitin protein ligases; component of the cellular stress response; UBC4 has a paralog, UBC5, that arose from the whole genome duplication [Source:SGD;Acc:S000000286])

HSP 1 Score: 95.1301 bits (235), Expect = 1.657e-24
Identity = 59/151 (39.07%), Postives = 90/151 (59.60%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            MS+S+RI KELSD++  P    C      DD  +  WQ  I+ P + PY  G F + I FP +YPFKPPKI+  TKIYHPN++  G IC+ I+  + W PA  + +V+ ++ +++ D + D  L  ++A  +  ++  +   A E+TKKYA
Sbjct:    1 MSSSKRIAKELSDLERDPPTS-CSAGPVGDD--LYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYA 147          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Yeast
Match: UBC13 (E2 ubiquitin-conjugating enzyme; involved in the error-free DNA postreplication repair pathway; interacts with Mms2p to assemble ubiquitin chains at the Ub Lys-63 residue; DNA damage triggers redistribution from the cytoplasm to the nucleus [Source:SGD;Acc:S000002499])

HSP 1 Score: 84.7297 bits (208), Expect = 1.169e-20
Identity = 50/125 (40.00%), Postives = 78/125 (62.40%), Query Frame = 2
Query:  143 DKNILVWQGLI-VPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            D N+  +Q  I  PE  PY  G F++++  P +YP + PK+   TKIYHPN+D  G+IC+ ++   NW PA +I  V+ ++ A++  P+ +  L  DVAE++ KN+Q     A E+TK YA+K+P
Sbjct:   29 DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYAKKKP 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Yeast
Match: UBC1 (Ubiquitin-conjugating enzyme; key E2 partner with Ubc4p for the anaphase-promoting complex (APC); mediates selective degradation of short-lived and abnormal proteins; plays a role in vesicle biogenesis and ER-associated protein degradation (ERAD); component of the cellular stress response; protein abundance increases in response to DNA replication stress key E2 partner with Ubc4p for the anaphase-promoting complex (APC) [Source:SGD;Acc:S000002584])

HSP 1 Score: 77.7962 bits (190), Expect = 1.697e-17
Identity = 50/157 (31.85%), Postives = 84/157 (53.50%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDE-KGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRPNN 520
            MS ++RI KE+  +++ P        +   D + L     + P   PY  G F V I+ P+EYPFKPPK+   TK+YHPN+    G IC+ I+    W P   ++  + +L A++  P+ +    A+VA+ + ++++ F K A  +T+ YA +  N 
Sbjct:    1 MSRAKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGT-FLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESFNKTAALWTRLYASETSNG 155          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Yeast
Match: UBC11 (Ubiquitin-conjugating enzyme; most similar in sequence to Xenopus ubiquitin-conjugating enzyme E2-C, but not a true functional homolog of this E2; unlike E2-C, not required for the degradation of mitotic cyclin Clb2 [Source:SGD;Acc:S000005866])

HSP 1 Score: 74.3294 bits (181), Expect = 9.130e-17
Identity = 48/146 (32.88%), Postives = 77/146 (52.74%), Query Frame = 2
Query:   62 SRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKK 496
            ++R+Q EL  +Q      +      VDD ++  W G I  P++ PY+   FKV + FP  YPF PP I   + ++HPNVD+ G IC+ I+  E W     +E ++ +L +++ +P+    L A  AE       ++  + EEY KK
Sbjct:   10 TKRLQNEL--LQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLSPMWHPNVDKSGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAE-------LWDADMEEYRKK 145          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Nematostella
Match: EDO33599 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRR4])

HSP 1 Score: 204.527 bits (519), Expect = 2.662e-66
Identity = 103/156 (66.03%), Postives = 133/156 (85.26%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRPNN 520
            M+A++R+ KEL +++      K FR+++VD+ NIL WQGLIVPE PPYNKGAF+++I FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+PII+PENWKPATK EQVIQ L+A++HDP+ +H LRAD+AEE++K+K+ FMKNAE+ TKKY EKRP +
Sbjct:    1 MAATKRLGKELDELRK--SGTKTFRDVKVDESNILYWQGLIVPEMPPYNKGAFRIEICFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPIISPENWKPATKTEQVIQALLALVHDPEPEHPLRADLAEEYSKDKKKFMKNAEDCTKKYGEKRPAD 154          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Nematostella
Match: EDO43669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXR8])

HSP 1 Score: 95.1301 bits (235), Expect = 3.728e-24
Identity = 58/149 (38.93%), Postives = 88/149 (59.06%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RI KEL D+   P  Q C      DD  +  WQ  I+ P + PY  G F + I FP +YPFKPPK++  TKIYHPN++  G IC+ I+    W PA  I +V+ ++ +++ DP+ D  L  ++A  F  +++ +   A+E+T+KYA
Sbjct:    2 ALKRINKELQDLGRDPPAQ-CSAGPVGDD--LFHWQATIMGPADSPYQGGVFFLTIHFPTDYPFKPPKVSFTTKIYHPNINSNGSICLDILR-SQWSPALTISKVLLSICSLMDDPNPDDPLVPEIARSFKTDRKKYNDMAKEWTRKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Nematostella
Match: EDO47887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL90])

HSP 1 Score: 87.4261 bits (215), Expect = 1.475e-20
Identity = 57/155 (36.77%), Postives = 91/155 (58.71%), Query Frame = 2
Query:   53 MSASRRIQKELSDI-QNKPEVQKCFREIQVDDKNILVWQG-LIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIIT--PEN-WKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            M  + R+++EL  + ++ P    C+    VD+  I   +  LI  E  PY+KG FK+ I  P  YPF+PPK+   T IYHPN+D  G+IC+  +   P+  WKPA  I  V+  ++ ++ +P+ D  L A+++ EF  NK  F++ A+E+T K+A
Sbjct:    1 MQRNARMKRELRLLAEDPPHGASCW---PVDENRIDKLEAKLIGAEGTPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPDDPLMAEISNEFKYNKAQFLEKAKEWTLKFA 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Nematostella
Match: EDO28400 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6K6])

HSP 1 Score: 84.3445 bits (207), Expect = 2.022e-20
Identity = 48/114 (42.11%), Postives = 72/114 (63.16%), Query Frame = 2
Query:  170 LIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIIT--PEN-WKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            LI  E  PY+KG FK+ I  P  YPF+PPK+   T IYHPN+D  G+IC+  +   P+  WKPA  I  V+  ++ ++ +P+ D  L A+++ EF  NK  F++ A+E+T K+A
Sbjct:    4 LIGAEGTPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPDDPLMAEISNEFKYNKAQFLEKAKEWTLKFA 117          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Nematostella
Match: EDO40595 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q0])

HSP 1 Score: 77.411 bits (189), Expect = 2.116e-17
Identity = 42/108 (38.89%), Postives = 69/108 (63.89%), Query Frame = 2
Query:  179 PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            P++ PY  G FK+++  P EYP   PK+   TKIYHPN+D+ G+IC+ I+  + W PA +I  V+ ++ A++  P+ D  L  DVAE++  N+   ++ A+ +T+ YA
Sbjct:   44 PKDSPYEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNIDKLGRICLDILK-DKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKVNEVQAIETAKAWTRLYA 150          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Medaka
Match: ENSORLT00000021696.2 (ubiquitin conjugating enzyme E2 L3 [Source:NCBI gene;Acc:101169213])

HSP 1 Score: 199.519 bits (506), Expect = 2.228e-63
Identity = 99/154 (64.29%), Postives = 132/154 (85.71%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            M+ASRR+ KEL +I+      K FR IQV++ N+L WQGLIVP+NPPY+KGAF+++I FP EYPFKPPKIT KTKIYHPN+DEKGQ+C+P+I+ ENWKPATK +QVIQ+L+A+++DP  +H LRAD+AEE++K+++ F+KNAEE+TKK+ EKRP
Sbjct:   36 MAASRRLAKELEEIRR--SGMKNFRNIQVEESNLLSWQGLIVPDNPPYDKGAFRIEIIFPTEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFLKNAEEFTKKHGEKRP 187          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Medaka
Match: ENSORLT00000000949.2 (ubiquitin-conjugating enzyme E2 L3 [Source:NCBI gene;Acc:101158291])

HSP 1 Score: 177.948 bits (450), Expect = 1.477e-55
Identity = 93/146 (63.70%), Postives = 119/146 (81.51%), Query Frame = 2
Query:   77 KELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRP 514
            +EL DI+      K FR IQ D+ NIL WQGLIVP+ PPY+KGAF+++I FP EYPFKPPKI+ KTKIYHPN+DEKGQ+C+PII+ ENWKPAT+  QVIQ L+A+++ P  +H LR D+AEE+TK++  FMKNAEE+TKK++EKRP
Sbjct:    2 QELEDIRK--SGMKHFRNIQADEANILTWQGLIVPDCPPYDKGAFRIEIIFPAEYPFKPPKISFKTKIYHPNIDEKGQVCLPIISVENWKPATRTLQVIQCLIALVNTPQPEHPLRTDLAEEYTKDRAKFMKNAEEFTKKHSEKRP 145          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Medaka
Match: ube2d4 (ubiquitin-conjugating enzyme E2 D4 [Source:NCBI gene;Acc:101172587])

HSP 1 Score: 100.523 bits (249), Expect = 9.911e-26
Identity = 60/149 (40.27%), Postives = 90/149 (60.40%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RIQKELSD+Q  P  Q C      DD  +  WQ  I+ P + PY  G F + I FP +YPFKPPK+   TKIYHPN++  G IC+ I+    W PA  + +V+ ++ +++ DP+ D  L  ++A  +  +++ + K A E+T+KYA
Sbjct:    2 ALKRIQKELSDLQRDPPAQ-CSAGPVGDD--LFHWQATIMGPSDSPYQSGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR-SQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNKLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Medaka
Match: UBE2D1 (ubiquitin-conjugating enzyme E2 D4 [Source:NCBI gene;Acc:101164669])

HSP 1 Score: 97.4413 bits (241), Expect = 1.443e-24
Identity = 57/149 (38.26%), Postives = 88/149 (59.06%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RIQKEL+D+Q  P        +  D   +  WQ  I  P + PY+ G F + + FP +YPFKPPK+   TKIYHPN++  G IC+ I+    W PA  I +V+ ++ +++ DP+ D  L  D+A  +  ++Q + K A E+T++YA
Sbjct:    2 ALKRIQKELNDLQRDPPASCSAGPVGED---MFHWQATISGPNDSPYHGGVFFLSVHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPDIAHIYKSDRQKYNKLAREWTQRYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Medaka
Match: UBE2D2 (ubiquitin-conjugating enzyme E2 D2 [Source:NCBI gene;Acc:101158902])

HSP 1 Score: 95.9005 bits (237), Expect = 6.089e-24
Identity = 58/149 (38.93%), Postives = 88/149 (59.06%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RI KEL+D+   P  Q C      DD  +  WQ  I+ P + PY  G F + I FP +YPFKPPK+   T+IYHPN++  G IC+ I+    W PA  I +V+ ++ +++ DP+ D  L  ++A  +  + Q + K A+E+T+KYA
Sbjct:    2 ALKRIHKELNDLARDPPAQ-CSAGPVGDD--MFHWQATIMGPSDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDGQKYTKMAKEWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Planmine SMEST
Match: SMESG000059431.1 (SMESG000059431.1)

HSP 1 Score: 295.819 bits (756), Expect = 5.662e-102
Identity = 156/156 (100.00%), Postives = 156/156 (100.00%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRPNN 520
            MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFKPPKITIKTKIYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRPNN
Sbjct:    1 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFKPPKITIKTKIYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKRPNN 156          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Planmine SMEST
Match: SMESG000069968.1 (SMESG000069968.1)

HSP 1 Score: 137.887 bits (346), Expect = 5.287e-40
Identity = 69/153 (45.10%), Postives = 105/153 (68.63%), Query Frame = 2
Query:   53 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKR 511
            M+A++R+ KELS +++K E+   F+  + D  NI  W+GL+ P++PP+N+ AF+V + F   +PFKPP IT+KT IYHPNVDE+G +C+ +I   NWKP  + EQ+I+    +I  PD +HFLR D+ EEFTK  + F + A ++  K A+K+
Sbjct:    1 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 153          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Planmine SMEST
Match: SMESG000064169.1 (SMESG000064169.1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.177e-22
Identity = 54/149 (36.24%), Postives = 89/149 (59.73%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA 502
            A +RI +EL D+   P  Q     +  D   +  WQ  I+ P + PY+ G F + I FP +YPFKPPK+T  TKIYHPN++  G IC+ I+  + W PA  I +V+ ++ +++ DP+ D  L  ++A  +  +++ +   A+++T+KYA
Sbjct:    2 ALKRIGRELQDLAKDPPAQCSAGPMHED---LFHWQATIMGPNDSPYDGGVFFLDIQFPTDYPFKPPKVTFTTKIYHPNINANGSICLDILRGQ-WSPALTISKVLLSICSLLTDPNPDDPLVPEIARIYKNDRKKYNDTAQDWTRKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Planmine SMEST
Match: SMESG000063640.1 (SMESG000063640.1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.162e-22
Identity = 53/150 (35.33%), Postives = 86/150 (57.33%), Query Frame = 2
Query:   59 ASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIV-PENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAE 505
            A +RIQ EL  +   P  Q      + D   ++ W   I+ P + PY  G F + I+FP +YPFKPP +   TKI+HPN++  G IC+ I+  + W PA  I +V+ ++ +++ DP+AD  L ++ A  + K+++ F + A  +T KYA 
Sbjct:    2 ALKRIQTELKSLMTDPPAQCSAGPKESD---LVHWSATIMGPADSPYEGGIFSLSIEFPPDYPFKPPMVKFDTKIFHPNINSNGSICLDILKGQ-WSPALTISKVLLSICSLLCDPNADDPLDSNAANLYKKDRKKFDETARSWTMKYAS 147          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Planmine SMEST
Match: SMESG000081859.1 (SMESG000081859.1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.255e-18
Identity = 56/151 (37.09%), Postives = 83/151 (54.97%), Query Frame = 2
Query:   56 SASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQG-LIVPENPPYNKGAFKVQIDFPVEYPFXXXXXXXXXXXYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAE 505
            SA +RIQKEL D    P        I   D N+  W G L+ P    Y  G F + I FP +YPFKPPKI  K +IYH NV+  G IC+ I+   NW P   + +++ ++ +++ D + D  L   +A+++  N++   K A ++TKKYA 
Sbjct:   35 SALKRIQKELQDFIKDPPPNCSAEPI---DGNLFHWNGTLLGPVGSVYEGGIFFLDIGFPSDYPFKPPKIAFKNRIYHCNVNSVGTICLDILK-NNWSPILNVGKILLSICSLMCDCNPDDPLVGYIAKQYIHNRKEHDKTARKWTKKYAS 181          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBE2L34.011e-6464.56ubiquitin conjugating enzyme E2 L3 [Source:HGNC Sy... [more]
UBE2L54.520e-6463.92ubiquitin conjugating enzyme E2 L5 [Source:HGNC Sy... [more]
UBE2L54.520e-6463.92ubiquitin conjugating enzyme E2 L5 [Source:HGNC Sy... [more]
UBE2L54.520e-6463.92ubiquitin conjugating enzyme E2 L5 [Source:HGNC Sy... [more]
UBE2L38.848e-6067.14ubiquitin conjugating enzyme E2 L3 [Source:HGNC Sy... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubc-184.471e-5557.79UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
let-705.790e-2338.26Ubiquitin-conjugating enzyme E2 2 [Source:UniProt... [more]
ubc-131.844e-1735.77Ubiquitin-conjugating enzyme E2 13 [Source:UniPro... [more]
ubc-241.807e-1536.99UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
ubc-211.915e-1528.76Probable ubiquitin-conjugating enzyme E2 21 [Sour... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ubc106.997e-6463.64gene:FBgn0026316 transcript:FBtr0089553[more]
Ubc84D1.477e-5657.14gene:FBgn0017456 transcript:FBtr0081552[more]
CG170304.670e-3643.31gene:FBgn0035584 transcript:FBtr0073374[more]
eff1.458e-2237.58gene:FBgn0011217 transcript:FBtr0310554[more]
eff1.458e-2237.58gene:FBgn0011217 transcript:FBtr0336876[more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2l3a1.882e-6465.58ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;A... [more]
ube2l3a2.549e-6465.58ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;A... [more]
ube2l3a2.549e-6465.58ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;A... [more]
ube2l3b5.577e-6465.58ubiquitin-conjugating enzyme E2L 3b [Source:ZFIN;A... [more]
ube2l3b2.153e-5869.17ubiquitin-conjugating enzyme E2L 3b [Source:ZFIN;A... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
themis1.663e-6465.58thymocyte selection associated [Source:Xenbase;Acc... [more]
themis4.569e-5969.17thymocyte selection associated [Source:Xenbase;Acc... [more]
chmp2b3.111e-2540.27charged multivesicular body protein 2B [Source:Xen... [more]
eif2s22.228e-2336.91eukaryotic translation initiation factor 2 subunit... [more]
ube2d31.293e-2237.58ubiquitin conjugating enzyme E2 D3 [Source:NCBI ge... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ube2l32.753e-6464.56ubiquitin-conjugating enzyme E2L 3 [Source:MGI Sym... [more]
Ube2l32.753e-6464.56ubiquitin-conjugating enzyme E2L 3 [Source:MGI Sym... [more]
Ube2l31.347e-5362.24ubiquitin-conjugating enzyme E2L 3 [Source:MGI Sym... [more]
Ube2l31.392e-4666.67ubiquitin-conjugating enzyme E2L 3 [Source:MGI Sym... [more]
Ube2l32.647e-3966.06ubiquitin-conjugating enzyme E2L 3 [Source:MGI Sym... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P68037|UB2L3_MOUSE1.926e-6364.56Ubiquitin-conjugating enzyme E2 L3 OS=Mus musculus... [more]
sp|P68036|UB2L3_HUMAN1.926e-6364.56Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens... [more]
sp|Q3MHP1|UB2L3_BOVIN1.926e-6364.56Ubiquitin-conjugating enzyme E2 L3 OS=Bos taurus O... [more]
sp|A0A1B0GUS4|UB2L5_HUMAN2.170e-6363.92Ubiquitin-conjugating enzyme E2 L5 OS=Homo sapiens... [more]
sp|Q7K738|UBC10_DROME7.014e-6363.64Ubiquitin-conjugating enzyme E2-18 kDa OS=Drosophi... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4BEB11.203e-6769.87UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A1I8H8E72.089e-6565.61UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
R7TJY72.457e-6567.31UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A2R5LJP32.594e-6568.83Putative ubiquitin-protein ligase OS=Ornithodoros ... [more]
A0A1W7R9A84.008e-6568.18Ubiquitin-conjugating enzyme E2 L3 OS=Hadrurus spa... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2l3a5.326e-6465.58ubiquitin-conjugating enzyme E2 L3 [Source:NCBI ge... [more]
ube2l3b4.133e-6162.99ubiquitin conjugating enzyme E2 L3 [Source:NCBI ge... [more]
ube2l3b3.935e-5561.90ubiquitin conjugating enzyme E2 L3 [Source:NCBI ge... [more]
ube2d1b3.430e-2540.27ubiquitin conjugating enzyme E2 D1 [Source:NCBI ge... [more]
ube2d41.294e-2437.58ubiquitin-conjugating enzyme E2 D4 [Source:NCBI ge... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2l3a6.099e-5361.70ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;A... [more]
ENSPMAT00000010378.12.016e-1935.17pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 ... [more]
ube2t2.335e-1637.38ubiquitin-conjugating enzyme E2T (putative) [Sourc... [more]
UBE2E17.131e-1531.93ubiquitin conjugating enzyme E2 E1 [Source:HGNC Sy... [more]
ube2g22.078e-1325.56ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, ... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UBC53.396e-2539.07Ubiquitin-conjugating enzyme; mediates selective d... [more]
UBC41.657e-2439.07Ubiquitin-conjugating enzyme (E2); key E2 partner ... [more]
UBC131.169e-2040.00E2 ubiquitin-conjugating enzyme; involved in the e... [more]
UBC11.697e-1731.85Ubiquitin-conjugating enzyme; key E2 partner with ... [more]
UBC119.130e-1732.88Ubiquitin-conjugating enzyme; most similar in sequ... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO335992.662e-6666.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436693.728e-2438.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478871.475e-2036.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284002.022e-2042.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405952.116e-1738.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021696.22.228e-6364.29ubiquitin conjugating enzyme E2 L3 [Source:NCBI ge... [more]
ENSORLT00000000949.21.477e-5563.70ubiquitin-conjugating enzyme E2 L3 [Source:NCBI ge... [more]
ube2d49.911e-2640.27ubiquitin-conjugating enzyme E2 D4 [Source:NCBI ge... [more]
UBE2D11.443e-2438.26ubiquitin-conjugating enzyme E2 D4 [Source:NCBI ge... [more]
UBE2D26.089e-2438.93ubiquitin-conjugating enzyme E2 D2 [Source:NCBI ge... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059431.15.662e-102100.00SMESG000059431.1[more]
SMESG000069968.15.287e-4045.10SMESG000069968.1[more]
SMESG000064169.12.177e-2236.24SMESG000064169.1[more]
SMESG000063640.13.162e-2235.33SMESG000063640.1[more]
SMESG000081859.12.255e-1837.09SMESG000081859.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007414 ID=SMED30007414|Name=Ubiquitin-conjugating enzyme E2 L3|organism=Schmidtea mediterranea sexual|type=transcript|length=939bp
TTTTAATTAAGGAATGTTTTAAATTACTGATTCCTTAATAATTTTTTTTA
TTATGTCAGCGTCAAGACGAATTCAAAAAGAATTAAGTGATATTCAAAAC
AAACCGGAAGTTCAAAAATGCTTTAGGGAAATCCAAGTGGATGATAAAAA
TATATTAGTTTGGCAAGGACTGATTGTTCCAGAAAATCCACCATATAACA
AAGGGGCATTTAAAGTTCAAATCGATTTTCCAGTCGAATATCCATTTAAA
CCTCCTAAGATTACCATTAAAACTAAAATATACCATCCTAATGTTGATGA
AAAAGGACAAATATGTATGCCCATTATCACTCCAGAAAATTGGAAACCCG
CCACAAAAATCGAACAAGTAATTCAAAATTTGGTGGCCATGATTCATGAT
CCGGATGCAGATCATTTTCTTAGAGCTGACGTTGCTGAAGAGTTTACTAA
AAACAAACAAATCTTTATGAAAAATGCAGAAGAATACACCAAGAAATATG
CGGAAAAGCGACCCAATAACTAATAATTTCACTGTTTAAATAAAATATTT
TATAGATATTTAGGTGTTTTAATGATCTGTATGTTTTGTTTTTTACAAAT
GATGGTTCGTTGACTCACGATTTGGATTTGTTCGAGTTTTTTTAATTGAT
AAACGATTGTTCTCTACCTAAAAAGTAATGATAAATATAACATACGCTCG
TCTTTAGATGAATGCCAATGTCAATTGTACAATTACTTAGCTGTTGACGA
GAATAAATCTTTTCCAATTACGCTTAGTGAATTTATTTCATGGGATGAAT
GCATGTGTGTGTCTATGAGAACTGAGTGACGCGTGTGTGCCACTATGGCA
TAGGTTTTTGCTAAAAGAAATTAATAGTTTTATTTGAATTATCTAATCAA
ATATGTGGTTTAGTTGAAAAAATAAATTTTCGAATCAGG
back to top

protein sequence of SMED30007414-orf-1

>SMED30007414-orf-1 ID=SMED30007414-orf-1|Name=SMED30007414-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp
MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNK
GAFKVQIDFPVEYPFKPPKITIKTKIYHPNVDEKGQICMPIITPENWKPA
TKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYA
EKRPNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1903508positive regulation of nucleic acid-templated transcription
GO:0000209protein polyubiquitination
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0008283cell proliferation
GO:0016567protein ubiquitination
GO:0031398positive regulation of protein ubiquitination
GO:0042787protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0044770cell cycle phase transition
GO:0051443positive regulation of ubiquitin-protein transferase activity
GO:0070979protein K11-linked ubiquitination
GO:0071383cellular response to steroid hormone stimulus
GO:0071385cellular response to glucocorticoid stimulus
GO:1903955positive regulation of protein targeting to mitochondrion
Vocabulary: INTERPRO
TermDefinition
IPR000608UBQ-conjugat_E2
IPR016135UBQ-conjugating_enzyme/RWD
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003713transcription coactivator activity
GO:0003723RNA binding
GO:0004842ubiquitin-protein transferase activity
GO:0005515protein binding
GO:0005524ATP binding
GO:0016740transferase activity
GO:0031625ubiquitin protein ligase binding
GO:0061631ubiquitin conjugating enzyme activity
GO:0097027ubiquitin-protein transferase activator activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00212ubc_7coord: 5..151
e-value: 5.9E-53
score: 191.9
NoneNo IPR availablePANTHERPTHR24068:SF170UBIQUITIN-CONJUGATING ENZYME E2 L5coord: 1..154
NoneNo IPR availablePANTHERPTHR24068FAMILY NOT NAMEDcoord: 1..154
IPR000608Ubiquitin-conjugating enzyme E2PFAMPF00179UQ_concoord: 6..145
e-value: 6.0E-40
score: 136.1
IPR000608Ubiquitin-conjugating enzyme E2PROSITEPS50127UBIQUITIN_CONJUGAT_2coord: 5..140
score: 31.445
IPR000608Ubiquitin-conjugating enzyme E2CDDcd00195UBCccoord: 4..146
e-value: 1.90021E-51
score: 158.905
IPR016135Ubiquitin-conjugating enzyme/RWD-likeGENE3DG3DSA:3.10.110.10coord: 1..156
e-value: 1.3E-53
score: 182.8
IPR016135Ubiquitin-conjugating enzyme/RWD-likeSUPERFAMILYSSF54495UBC-likecoord: 2..153