TNF receptor-associated factor 2

Overview
NameTNF receptor-associated factor 2
Smed IDSMED30007410
Length (bp)1947
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor 2 (SMED30007410) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor 2 (SMED30007410) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor 2 (SMED30007410) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor 2 (SMED30007410) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007410

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007410SMESG000018435.1 SMESG000018409.1 Contig1574GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30007410SMESG000081190.1 SMESG000018409.1 dd_Smed_v4_2703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007410SMESG000081190.1 SMESG000018409.1 dd_Smed_v4_2703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007410SMESG000081190.1 SMESG000018409.1 dd_Smed_v4_2703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007410SMESG000018435.1 SMESG000018409.1 dd_Smed_v4_1110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007410SMESG000018435.1 SMESG000018409.1 dd_Smed_v4_1110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007410SMESG000018435.1 SMESG000018409.1 dd_Smed_v4_1110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007410SMESG000018435.1 SMESG000018409.1 dd_Smed_v4_1110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007410SMESG000018435.1 SMESG000018409.1 dd_Smed_v4_1110_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor 2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 167.162 bits (422), Expect = 8.464e-44
Identity = 133/529 (25.14%), Postives = 229/529 (43.29%), Query Frame = 3
Query:  162 EYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEI-PNEIIKDRAIDREISNLEIRCL--LNGCDHIGQFKYLDDHLRM-CKWRLENCDK--CPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSE--IHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLR-------HEMRINENQIE--------------------AIKSDINSYKEQL---------GGGIN-----------------SDEDVSIVE--------------GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            E F+K +     ++ C KCH +L  P QT+CG RFC SC+    +S    C  CQ  I  +++ KD    REI  L+I C     GC       +L  HL+  C +    C +  C +   ++    H+++ C      CS C  ++     Q  H + +  C+          CP++C+ +  + + +  HL +C N  + C     GC F G    +  H +   V H+ ++     +L +K   L+ + VE N    +    +     ++++Q E LR       H  R+ ++Q E                    ++KS + S + ++          G +                  S  D+ + +              G+ IW +R+ ++R  +A  G    + S+PFY    GY+   +VY NGDG GK   LS++F+I++GEYD  L WPF +KV L L+   +  +++    KPD N   + +P  E N+ +G P FV    ++++  +I   +I I+
Sbjct:   41 EKFVKTVE---DKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-HEDTDCPCV-------VVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIK 557          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 167.162 bits (422), Expect = 8.464e-44
Identity = 133/529 (25.14%), Postives = 229/529 (43.29%), Query Frame = 3
Query:  162 EYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEI-PNEIIKDRAIDREISNLEIRCL--LNGCDHIGQFKYLDDHLRM-CKWRLENCDK--CPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSE--IHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLR-------HEMRINENQIE--------------------AIKSDINSYKEQL---------GGGIN-----------------SDEDVSIVE--------------GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            E F+K +     ++ C KCH +L  P QT+CG RFC SC+    +S    C  CQ  I  +++ KD    REI  L+I C     GC       +L  HL+  C +    C +  C +   ++    H+++ C      CS C  ++     Q  H + +  C+          CP++C+ +  + + +  HL +C N  + C     GC F G    +  H +   V H+ ++     +L +K   L+ + VE N    +    +     ++++Q E LR       H  R+ ++Q E                    ++KS + S + ++          G +                  S  D+ + +              G+ IW +R+ ++R  +A  G    + S+PFY    GY+   +VY NGDG GK   LS++F+I++GEYD  L WPF +KV L L+   +  +++    KPD N   + +P  E N+ +G P FV    ++++  +I   +I I+
Sbjct:   41 EKFVKTVE---DKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-HEDTDCPCV-------VVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIK 557          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 153.295 bits (386), Expect = 2.304e-39
Identity = 123/495 (24.85%), Postives = 203/495 (41.01%), Query Frame = 3
Query:  141 GSLETRTEYFIKNI---RLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEI----------PNEIIKDRAIDREISNLEIRCLLNGCDHIGQFK-YLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSG-------MRNLMRKNGELEQKIVEANDKNGTETKL---LKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDV---------SIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            GSLE     F K +   +LE  +++CS C  +L  P Q QCG R+C  C+    +S    C  C  E            +    D A  RE+ +L   C  +GC   G  K Y   H   C   L  C  C        KE HL+ EC      C  C       + +  H         ++C      C      +I     ++H+  C      C  + +GC          +H       H+ +++S        + +      EL Q+      K  T   +   L  E  ++    E+   + R+++++IEA+ S +   +  +G    +  D+         S  +G+ IW + +  ++  +A +G    I S  FY  + GY+  L++Y NGDG G+   LS++F+++KG  D  LRWPF +KV L L+  N     I    +PD     + RPV + N+ +G P F  + K+   + ++   +I I+
Sbjct:   10 GSLELLQPGFSKTLLGTKLEA-KYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHH---------EVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAF-RPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIK 493          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 148.288 bits (373), Expect = 2.527e-37
Identity = 139/521 (26.68%), Postives = 222/521 (42.61%), Query Frame = 3
Query:  126 NNIQLGSLETRTEY-FIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCI-NKHFASCGNICPNCQTEIPN-EIIKDRAIDREISNLEIRCL-LNGCDHIGQFKYLDDHLRMCKWRLENC--DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSG-----------MRNLMRKNGELEQ-------------KIVEANDKNGT---------------------ETKLLKEENFQ--------LKKQIESLRHEMRINENQIEAIK----------SDINSYKEQLGGGINSDEDVSIVEGIC-----IWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFV 1463
            N+I L   E   EY F++  RLE  R+ C+ CH +L +P QT CG RFC  CI +    +   ICP  +  I + E+ KD    RE+ NL + C    GC+         DHL+ C ++   C  +KC +   ++  + HL   C     KC  C  ++     Q    N        LC      CP  C   I    +  HL  CP     C     GC     + ++ +H       HM +V+              ++L +K  +++Q             +  +   KNG+                       +LL+  N Q        L + +++++ ++ + EN  + +           + IN +K QL     ++E   ++EG C     IW V + + +  +A  G    I S+ FY  + GYR   + Y NGDG G+   LS+YF++++GE+D  L+WPF ++V L L+  +   +NI    KPD N   + RP  E N+ +G P FV
Sbjct:   21 NSISL-DFEPSIEYQFVE--RLE-ERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEEN--------LCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLS---KNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSG-KKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFV 525          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 148.288 bits (373), Expect = 2.527e-37
Identity = 139/521 (26.68%), Postives = 222/521 (42.61%), Query Frame = 3
Query:  126 NNIQLGSLETRTEY-FIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCI-NKHFASCGNICPNCQTEIPN-EIIKDRAIDREISNLEIRCL-LNGCDHIGQFKYLDDHLRMCKWRLENC--DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSG-----------MRNLMRKNGELEQ-------------KIVEANDKNGT---------------------ETKLLKEENFQ--------LKKQIESLRHEMRINENQIEAIK----------SDINSYKEQLGGGINSDEDVSIVEGIC-----IWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFV 1463
            N+I L   E   EY F++  RLE  R+ C+ CH +L +P QT CG RFC  CI +    +   ICP  +  I + E+ KD    RE+ NL + C    GC+         DHL+ C ++   C  +KC +   ++  + HL   C     KC  C  ++     Q    N        LC      CP  C   I    +  HL  CP     C     GC     + ++ +H       HM +V+              ++L +K  +++Q             +  +   KNG+                       +LL+  N Q        L + +++++ ++ + EN  + +           + IN +K QL     ++E   ++EG C     IW V + + +  +A  G    I S+ FY  + GYR   + Y NGDG G+   LS+YF++++GE+D  L+WPF ++V L L+  +   +NI    KPD N   + RP  E N+ +G P FV
Sbjct:   21 NSISL-DFEPSIEYQFVE--RLE-ERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEEN--------LCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLS---KNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSG-KKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFV 525          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 134.806 bits (338), Expect = 1.136e-33
Identity = 116/437 (26.54%), Postives = 177/437 (40.50%), Query Frame = 3
Query:  204 VCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPNEIIK-DRAIDREISNLEIRCLL--NGCDHIGQFKYLDDHLRMCKWRLE-NCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYEC--NSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQ---NISILMKP---DSNMICYGRPVKEFNLGAGQPEFVNLGKL 1478
             C  C + L DP +  C   +C  C      + G  C  CQT I  E+ + DRA  ++I  L + C    +GC   GQ   L DHL  C ++    C+KC + + K   E H + +C      CS C  +  R   +  H         K C  +   CP++C         I  H   CPN    C     GC F G +  + +HLSD+ V H+  +   + +L      +E+ +   ND+   +T++L                             S   +  E  G  +             IW +  ++QR  +AKSG DT I S PF   + GY+        GDG    + +S+Y +++KGE+D  L WPF   + +SL+  N   +   NI+ ++ P    +N     RP  E N   G   F +L  L
Sbjct:   17 TCPICEQALRDPIKLNCDHHYCRQCFENENRTPG--CAACQTIIQPELCQHDRAKQKQILALPVVCTFESSGCPWDGQLGTLHDHLSECTFKSSLKCEKCGRQFAKNDLEKH-RAKCELNRAVCSFCN-KTIRDSDRERH--------PKTCPQVIISCPFQCGLTDRPRLEIEAHCPSCPNVDNVCPFVPYGCTFAGGKESIQQHLSDEPVRHLMYLCDEITDLKGTYELMERDMGSFNDR---QTRIL-----------------------------SAAETCTEMFGPQL-------------IWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAIL 396          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 56.225 bits (134), Expect = 3.268e-8
Identity = 48/210 (22.86%), Postives = 84/210 (40.00%), Query Frame = 3
Query:  726 PNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSN 1355
            P+    C   E GC   G   ++ +H+ DD   H+ ++   +                    N   TK+  +++  + K +  L++ M I E+  E   S       ++G        +++V+       +N   R           I S+PFY    GY+      P GDG     + S++  ++KGE+DD L WPF   V  S++S +
Sbjct:   80 PDNWIDCPFKEHGCHKKGENSEVKRHVRDDRNLHLVLLCQSL--------------------NPIRTKINIQQSAYVDKYVGMLQY-MSIAESAFEKYGSQHTFRIPKIG--------LTVVKA-----TKNKSHR----------SIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDD 245          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 99.3673 bits (246), Expect = 9.970e-22
Identity = 91/429 (21.21%), Postives = 165/429 (38.46%), Query Frame = 3
Query:  279 INKHFASC---GNICPN-CQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCD-KCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI--HNNIRNHLYD-CPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALV--QNISILMKPDSNMICYGRPVKEFN-LGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEM 1532
            +  H  +C      CPN C  +IP  ++ D  +    +    RC     +  G    L++H   C      C+ KC Q   +    +H  ++C   + +C+ C  E +                   C      CP  C++       +  HL D C +    C   E GCRF G +  +  HL  +  +H++++++    L  + G+                                          QI+ +KS ++         IN         G  +W + +   ++ +A+     ++ S PFY  Q GY+    ++ NG+G G++  +S+Y  ++ GEYD  L+WPF   +  +L    A      ++    PD     + RP  E + LG G P F++  +L+ S  FI   ++ +R ++
Sbjct:  113 LKGHLNACKHDATQCPNKCGAQIPRIMMTDH-LQYTCTMRRTRCEFCQSEFSG--AGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQ---------CPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMVA----LSSRQGQ------------------------------------------QIQMLKSAVSKLS------IN-------YTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKV 469          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 99.3673 bits (246), Expect = 1.171e-21
Identity = 91/429 (21.21%), Postives = 164/429 (38.23%), Query Frame = 3
Query:  279 INKHFASC---GNICPN-CQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCD-KCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI--HNNIRNHLYD-CPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISIL--MKPDSNMICYGRPVKEFN-LGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEM 1532
            +  H  +C      CPN C  +IP  ++ D  +    +    RC     +  G    L++H   C      C+ KC Q   +    +H  ++C   + +C+ C  E +                   C      CP  C++       +  HL D C +    C   E GCRF G +  +  HL  +  +H++++++    L  + G+                                          QI+ +KS ++         IN         G  +W + +   ++ +A+     ++ S PFY  Q GY+    ++ NG+G G++  +S+Y  ++ GEYD  L+WPF   +  +L    A      +     PD     + RP  E + LG G P F++  +L+ S  FI   ++ +R ++
Sbjct:  122 LKGHLNACKHDATQCPNKCGAQIPRIMMTDH-LQYTCTMRRTRCEFCQSEFSG--AGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQ---------CPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMVA----LSSRQGQ------------------------------------------QIQMLKSAVSKLS------IN-------YTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKV 478          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 60.077 bits (144), Expect = 3.858e-9
Identity = 64/318 (20.13%), Postives = 130/318 (40.88%), Query Frame = 3
Query:  624 VECIDKLCENLSGKCPYECNS-EIHNNIRNHLYDCPNKVT------KCFLYELGCRFVG----NQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEAND----------------KNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRF--SLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLI--SSNALVQNISILMKPDSNMICYGRPVKEFNL-GAGQPEFVNLGKLI 1481
            +E + + C N S  C    +  E+H     HL  CP +        KC   ++ C FVG    NQ++  +HL  D   HM +++   +       +  +                        NG + ++++     + ++I  L    R  E ++E ++  +   ++Q      +  D     G  +W +  +   +   ++  + Q+ S   Y    GY+F   L + P      K   LS++  +++ E D  L WPF  ++ L ++  +   L Q+ +I+ KP+  ++ + +P +  +  G G  E+ N+  +I
Sbjct:  162 IEQLKRDCPNSSLGCSVVASPIELHR----HLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLE--EHLKADMPHHMQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQYANGVDEQIVQT----MYQRIVVLEQRTREQETRLENMQKQLRLARQQ------APVDPRYSNGTIVWRIEQLGALVARLRANANNQVYSHECYTSPHGYKFCARLNIQPR-----KPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADATLSQHDTIMTKPE--ILAFHKPREAISTRGFGFLEYANISNII 456          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 49.6766 bits (117), Expect = 5.698e-6
Identity = 25/79 (31.65%), Postives = 41/79 (51.90%), Query Frame = 3
Query: 1080 VSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWP 1316
            V  + G  IW +++  +++ ++K  +DT + S  F  +  GY   L +Y NG G  K R +     ++ GEYD  L WP
Sbjct:  250 VQNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWP 327          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074274)

HSP 1 Score: 49.6766 bits (117), Expect = 5.698e-6
Identity = 25/79 (31.65%), Postives = 41/79 (51.90%), Query Frame = 3
Query: 1080 VSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWP 1316
            V  + G  IW +++  +++ ++K  +DT + S  F  +  GY   L +Y NG G  K R +     ++ GEYD  L WP
Sbjct:  250 VQNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWP 327          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 178.718 bits (452), Expect = 3.796e-48
Identity = 133/522 (25.48%), Postives = 227/522 (43.49%), Query Frame = 3
Query:  195 PRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICP-NCQTEIPNEIIKDRAIDREISNLEIRCLL--NGCDHIGQFKYLDDHLRMCKWRLENCD--KCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYEC--NSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRN-------------------------------------LMRKNGELEQKIVEANDKNGTETKLLKEENFQLK--KQIESLRHEMRINENQIEAIKSDIN-----------------SYKEQLG--GGINSDEDVSIVE--------------GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            P++ C  C  +L +P QT+CG RFC SCIN+  +    +CP +      ++I +D   +REI  L++ C    NGC      + + +HL +C +    C   KC +   ++    HL  +C +    C  C L+M   E Q           + +C      CP  C  +S + + + +H +DCP     C     GC + G   +M +H S     H+   M  +RN                                     +  KN +LEQK+V       + ++ L E   +L+  + + ++R E+      +E+++S ++                 S ++QL     + S  DV + E              G  IW +R+ ++R  +A       + S+PFY    GY+   +VY NGDG GK   LS++F++++GEYD  L+WPF +KV L L+      +++    KPD +   + RP  E N+ +G P FV    ++++  +I   +I I+
Sbjct:   52 PKYCCETCRLVLCNPRQTECGHRFCESCINELLSKPNPVCPADLLPLFEDKIFRDVCCNREIMALKVYCRSEKNGCKEQMCLQQVMEHLVICPYFEVPCPLGKCKEKMMRKDMPEHLSRKCKHREVTCEFCSLKMALTELQKHK--------ETVCPAFPVACPNHCSFSSILRSELSSHQHDCPKAQVTCSFIRYGCSYKGLNQEMREHESSFASEHLR--MMAVRNTTLEAKVEDVKSELMERYKVLPSLSSRLAEVERQYEEMREKNRQLEQKLVSMQMLMSSHSEKLLEVEMELRELRPLRAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQLTRHDDLMSVHDVRLAEMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDAFKPDPSSSSFRRPTGEMNIASGCPLFVA-QTVLENGTYIKDDTIFIK 562          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 166.007 bits (419), Expect = 7.166e-44
Identity = 129/500 (25.80%), Postives = 211/500 (42.20%), Query Frame = 3
Query:  195 PRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNI-CPNCQTEIPNE----------IIKDRAIDREISNLEIRCLLNGCDHIGQFK-YLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSH---MTIVMSGMRNLMRKNGELEQKI------------------VEANDKNGTETKLLKEENFQ--LKKQIE-------SLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVE--------------GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            P++ C +C +IL  P Q QCG RFC  C  K   S G I C  C+ E   E             D A  REI +L  +C   GC   G  K + + H   C +    C+ C        K+ H + EC      C  C +        TF+    ++  D++C+    +C      +I     + H   C    + C   E+GCR V +     +H     + H   M  ++S MR      GE ++ +                  V      G + K+   EN    L K++E       ++  + R+++ +IE + + +   +  L     +  D+ + E              G+ IW +    +R  DA +G    + S  FY  + GY+  L++Y NGDG G+   LS++F+++KG+YD  L+WPF +KV L L+  N   ++I    +PD +   + RP+ E N+ +G P F  L KL     ++   +I I+
Sbjct:   41 PKYQCQQCKDILRKPFQAQCGHRFCVFCF-KQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKV--------TFNFK-EIKAHDEICQKFPMQCKDCGKKKIPREKFQEHTKSCAKSKSACQFREIGCRAVVDNCKQQEHEQTSIMEHLRLMLALLSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTL-----TTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNR-EHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 524          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 166.007 bits (419), Expect = 7.166e-44
Identity = 129/500 (25.80%), Postives = 211/500 (42.20%), Query Frame = 3
Query:  195 PRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNI-CPNCQTEIPNE----------IIKDRAIDREISNLEIRCLLNGCDHIGQFK-YLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSH---MTIVMSGMRNLMRKNGELEQKI------------------VEANDKNGTETKLLKEENFQ--LKKQIE-------SLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVE--------------GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            P++ C +C +IL  P Q QCG RFC  C  K   S G I C  C+ E   E             D A  REI +L  +C   GC   G  K + + H   C +    C+ C        K+ H + EC      C  C +        TF+    ++  D++C+    +C      +I     + H   C    + C   E+GCR V +     +H     + H   M  ++S MR      GE ++ +                  V      G + K+   EN    L K++E       ++  + R+++ +IE + + +   +  L     +  D+ + E              G+ IW +    +R  DA +G    + S  FY  + GY+  L++Y NGDG G+   LS++F+++KG+YD  L+WPF +KV L L+  N   ++I    +PD +   + RP+ E N+ +G P F  L KL     ++   +I I+
Sbjct:   41 PKYQCQQCKDILRKPFQAQCGHRFCVFCF-KQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKV--------TFNFK-EIKAHDEICQKFPMQCKDCGKKKIPREKFQEHTKSCAKSKSACQFREIGCRAVVDNCKQQEHEQTSIMEHLRLMLALLSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTL-----TTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNR-EHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 524          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 166.007 bits (419), Expect = 8.325e-44
Identity = 129/501 (25.75%), Postives = 212/501 (42.32%), Query Frame = 3
Query:  195 PRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNI-CPNCQTEIPNE----------IIKDRAIDREISNLEIRCLLNGCDHIGQFK-YLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSE--IHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSH---MTIVMSGMRNLMRKNGELEQKI------------------VEANDKNGTETKLLKEENFQ--LKKQIE-------SLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVE--------------GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            P++ C +C +IL  P Q QCG RFC  C  K   S G I C  C+ E   E             D A  REI +L  +C   GC   G  K + + H   C +    C+ C        K+ H + EC      C  C +        TF+    ++  D++C+    +C  +C  +       + H   C    + C   E+GCR V +     +H     + H   M  ++S MR      GE ++ +                  V      G + K+   EN    L K++E       ++  + R+++ +IE + + +   +  L     +  D+ + E              G+ IW +    +R  DA +G    + S  FY  + GY+  L++Y NGDG G+   LS++F+++KG+YD  L+WPF +KV L L+  N   ++I    +PD +   + RP+ E N+ +G P F  L KL     ++   +I I+
Sbjct:   54 PKYQCQQCKDILRKPFQAQCGHRFCVFCF-KQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKV--------TFNFK-EIKAHDEICQKFPMQCK-DCGKKKIPREKFQEHTKSCAKSKSACQFREIGCRAVVDNCKQQEHEQTSIMEHLRLMLALLSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTL-----TTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNR-EHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 537          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Zebrafish
Match: traf1 (TNF receptor-associated factor 1 [Source:ZFIN;Acc:ZDB-GENE-071120-4])

HSP 1 Score: 147.517 bits (371), Expect = 2.432e-37
Identity = 127/535 (23.74%), Postives = 221/535 (41.31%), Query Frame = 3
Query:  138 LGSLETRTEY---FIKNIRLECPR--FVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGN-ICPNCQTE-----------IPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCD-KCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTK---CFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEAND------KNGTETKL--------------LKEENFQLK---------KQIESLRHEMRINENQIEAIKSDINSYK--------------------------------------EQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKL 1478
            + S     EY   F ++I  E P+  ++CS C+ +L    QT CG R+C +C+N    +  + +C  C+ E            PN+   D AI++EI +L++ C   GC      K  +DH   C++ L  C+  C     ++    HL+  C N    C  C   +T  E Q  HV                 CP   + +     +    + P    K   C   ++GC F GN   + +H S  +  H+ +++   R L R      +++ + +        NG+                  + ++ F L          +Q+++L+ ++++ EN I A+  ++   +                                        L   I++ +DVS  +G   W V +V Q+  +A +       S  FY  + G++  L++Y NGDG GK   +S++F+I+KGEYD  L WPF  KV   L+  N   +++    +PD + + + +PV + N+ +G P F  L KL
Sbjct:   14 VSSTPDENEYPSGFPQSICDEVPKDKYLCSNCNNVLNKARQTVCGHRYCLACVNWLVRNNKDLVCTKCKGEDSNVESDTSVLTPNQFFNDVAINKEILDLKVHCANQGCPWRSTLKNFEDHQSQCEYALIPCNIGCGIMVQRKTLATHLESGCPNNKTACPSCTSVLTPRELQK-HV-----------------CPSSGDKKTAKTDKKQKNNQPANSKKKEPCIFSDVGCPFKGNPDKVKEHESCSHAGHLQLLLDVTRALQRTLNSATERVYQDSPVFLEPGPNGSSLAPQADGDIETDGGDPGVSDKAFSLHDDQVELAAGQQLDALQQKVQVIENIISALNREVEKTQISVVAMNRDHCNSQQIIQHLEATVAELQQRLVRKDILISSLQQSISAQQDVSY-DGTFYWRVCDVSQKQREAANSQKISQYSPAFYTARYGFKVCLRLYLNGDGAGKGSHISLFFVIMKGEYDPILSWPFKHKVTFFLLDQNQR-EHVIDAFRPDLSSMSFHQPVSDMNVASGCPLFFPLKKL 528          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 145.591 bits (366), Expect = 5.627e-37
Identity = 124/493 (25.15%), Postives = 220/493 (44.62%), Query Frame = 3
Query:  168 FIKNIRLECPRFVCSKCHEILIDPSQ-TQCGCRFCYSCINKHFASCGNICPNCQTEIP-NEIIKDRAIDREISNLEIRCLLN--GCDHIGQFKYLDDHLRMCKWRLENC-DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFH---VNINVECIDKL----------------CENLSGKCPYECNSE-IHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVM---SGMRNLMRK---NGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLI----SSNALVQNISILMKPDSNMICYGRP------VKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            F++ +R    +F+C  C + + +P Q + CG RFC +C+ +  +     CP  Q  +   +I  DR ++ ++  L IRC+ +  GC   GQ K L  HL +C + +  C ++C     ++    H+Q +C     +C  CG + T   Y+         +V C +K                 C   +  CPY CN E + + I++H Y CP   T C   + G   +  + D+S HL D   S + +     SG ++   K   +  LE+ +        +     ++E  +L+KQ+E L            ++ S                      EG+ IW + +  +++ +AK   + +  S PFY  + GY+  +  + NG+G G+  +LS+Y  ++ GEYD+ L WPF  +V  SL+     S +  Q+I+    PD N   + +P      + E  LG G P+F++  + I   +++   +I +R
Sbjct:    8 FLEKLRR---KFLCPLCGKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDRDLETQVMGLSIRCIHSEEGCRWSGQLKQLQPHLNICAFNVIPCPNRCSTKLIRRDLPEHMQHDCPKRKVRCEFCGADFTGEAYEDHQGCCPQESVYCENKCGARMMRRVLSQHSLVECPKRTQPCPY-CNKEFVFDTIQSHQYQCPRYPTPC-PNQCGIASIARE-DLSNHLKDSCSSALVLCPFKDSGCKHRGPKITISRHLEENMRAHLSMMSSLVSRQRQEILELRKQVEEL------------SVSS----------------------EGVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNFQKPTGSRNSLDESTLGFGYPKFIS-HEDIRKRNYVRDNAIFLR 459          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 144.436 bits (363), Expect = 4.113e-36
Identity = 126/488 (25.82%), Postives = 210/488 (43.03%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPN----EIIKDRAIDREISNLEIRCLLN-GCDHIGQFKYLDDHLRMCKWRLENC--DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKL--CENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKH-LSDDNVSHMTIVMSGMRNLMRKNGELEQ----------------KIVEANDKNGTETKLLK---EENFQLKKQI------ESLRHEMRINENQIEAIK---SDINSYKEQLGG------------------GINSDEDVSIVEGIC-----IWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKL 1478
            R+ C+ CH +L +P QT CG RFC  CI+          P C  ++ N    EI KD    RE+ NL + C  +  CD         +HL  C + +  C  D C     ++  + HL+ EC      C  C   M+          + + C+D +  C N   K  +         +  HL +CP    +C     GC  +     +S H L     + ++ V+   +NL  K  +++Q                +   +N  + + TK L    +++  L++Q+      E  R ++R   + +E+ K   S + +YK+++                      +++E   +VEG       IW + +  ++  +A  G    I S+ FY    GYR   + Y NGDG GK  FLS+YF+++KGE+D  L WPF +KV L L+  +    +I+ + + D N   + RP  E N+ +G P F +  +L
Sbjct:   41 RYKCASCHLVLHNPHQTGCGHRFCEKCISNLIELSET--PQCPIDMENIKSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQCLYEMTLCSNDGCHDQMIRKELKGHLESECKLRQEACIYCKQTMS----------LCLACLDYMFSCRNNYKKIFFS------FQLDKHLCECPEAELQCTFSNYGCNVMVLYHSLSVHFLYLCTFTSVSQVLGLQQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQL 510          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 140.584 bits (353), Expect = 7.665e-35
Identity = 126/511 (24.66%), Postives = 231/511 (45.21%), Query Frame = 3
Query:  162 EYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIP-NEIIKDRAIDREISNLEIRCL--LNGCDHIGQFKYLDDHLRM-CKWRLENCDK--CPQTYPKQMKEIHLQEECVNGICKCSKCG-----LEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSE-------IHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNL---------MRKNGELE----QKIVEAN-------DKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEA----------IKSDINSYKEQLGGG----INSDEDVSIVE-----GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            E F+K +     ++ C KC  +L +P QT+CG RFC +C+N   +S    C  C+  I  +++ KD    RE+  L++ C     GC  +     L  HL+  C++   +C +  C +   ++    H+++ C      C  C      +EM +HE             D  C ++   CP+ C+ +        +  I+ H  +  + V    L +    ++  +V M ++ S +    + I+ + M +            +N E      Q+++E         DK     +   +E   +K   ESL++  R+++ ++ A          +++ IN + + L        + D    ++E     G+ IW +R+ ++R  +A  G    + S+PFY    GY+   +VY NGDG GK   LS++F+I++GEYD  L WPF +KV+L L+      +++    KPD N   + +P  E N+ +G P FV    ++++  +I   +I I+
Sbjct:   36 ERFLKPVE---EKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHE-------------DVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAH--EASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQN--RLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIK 525          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 139.813 bits (351), Expect = 1.269e-34
Identity = 126/497 (25.35%), Postives = 208/497 (41.85%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPN----EIIKDRAIDREISNLEIRCLLN-GCDHIGQFKYLDDHLRMCKWRLENC--DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMT-RHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVM-----------SGMRNLMRKNGELEQ----------------KIVEANDKNGTETKLLK---EENFQLKKQI------ESLRHEMRINENQIEAIK---SDINSYKEQLGG------------------GINSDEDVSIVEGIC-----IWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKL 1478
            R+ C+ CH +L +P QT CG RFC  CI+          P C  ++ N    EI KD    RE+ NL + C  +  CD         +HL  C + +  C  D C     ++  + HL+ EC      C  C   M+  HE     +  + + +DK                       HL +CP    +C     GC  +  +  + +H       HM  V+           S ++NL  K  +++Q                +   +N  + + TK L    +++  L++Q+      E  R ++R   + +E+ K   S + +YK+++                      +++E   +VEG       IW + +  ++  +A  G    I S+ FY    GYR   + Y NGDG GK  FLS+YF+++KGE+D  L WPF +KV L L+  +    +I+ + + D N   + RP  E N+ +G P F +  +L
Sbjct:   41 RYKCASCHLVLHNPHQTGCGHRFCEKCISNLIELSET--PQCPIDMENIKSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQCLYEMTLCSNDGCHDQMIRKELKGHLESECKLRQEACIYCKQTMSFNHENNYKKIFFSFQ-LDK-----------------------HLCECPEAELQCTFSNYGCNVMVKRGKVKEHEDTFLRDHMLYVLNRNMKLEEQVLSVLQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQL 511          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 134.035 bits (336), Expect = 1.628e-32
Identity = 131/531 (24.67%), Postives = 230/531 (43.31%), Query Frame = 3
Query:  162 EYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIP-NEIIKDRAIDREISNLEIRCL--LNGCDHI-------------GQF----------------KYLDDHL-RMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSK-CGLEMTRHEYQTFHVNINVECIDKLCENLSGKCP---YECNSEIHNN-IRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNL---------MRKNGELE----QKIVEAN-------DKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEA----------IKSDINSYKEQLGGG----INSDEDVSIVE-----GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            E F+K +     ++ C KC  +L +P QT+CG RFC +C+N   +S    C  C+  I  +++ KD    RE+  L++ C     GC  +              QF                K L DH+ + CK+R   C  C    P    + H   +C + +  C   C ++         H+   +EC+     N    C    Y C  +  N  I+ H  +  + V    L +    ++  +V M ++ S +    + I+ + M +            +N E      Q+++E         DK     +   +E   +K   ESL++  R+++ ++ A          +++ IN + + L        + D    ++E     G+ IW +R+ ++R  +A  G    + S+PFY    GY+   +VY NGDG GK   LS++F+I++GEYD  L WPF +KV+L L+      +++    KPD N   + +P  E N+ +G P FV    ++++  +I   +I I+
Sbjct:   36 ERFLKPVE---EKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSELNAHL---LECV-----NAPSTCSFKRYGCTFKGTNQQIKAH--EASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQN--RLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIK 550          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 159.844 bits (403), Expect = 7.048e-42
Identity = 127/495 (25.66%), Postives = 212/495 (42.83%), Query Frame = 3
Query:  141 GSLETRTEYFIKNI---RLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPNE----------IIKDRAIDREISNLEIRCLLNGCDHIGQFK-YLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDK-NGTETKLLKEENF---------QLKKQIESLRHEMRINENQIEAIKSDINSYKEQLG---------GGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            GSLE     F K +   RLE  +++CS C  IL  P Q QCG R+C  C+    +S    C  C  E   E             D A  RE+ +L   C  +GC   G  K Y   H  +C + L  C  C        KE H ++EC      C  C    +       HV++ V    ++C      C      +I     ++H+  C      C  + +GC  +    ++  H       H+ +++S         G L Q   E   +    E K+   EN          ++    E+   + R+++++IEA+ + +   +  +G             S+ +VS  +G+ IW + +  ++  +A +G    I S  FY  + GY+  L+VY NGDG G+   LS++F+++KG  D  L+WPF +KV L L+  N   +++    +PD     + RPV + N+ +G P F  + K+   + ++   +I I+
Sbjct:   10 GSLELLQPGFSKTLLGTRLEA-KYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCS-------HVDLEVH--YEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNR-EHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIK 493          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 154.451 bits (389), Expect = 6.240e-40
Identity = 128/503 (25.45%), Postives = 213/503 (42.35%), Query Frame = 3
Query:  141 GSLETRTEYFIKNI---RLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNI--------CPNCQTEIPNE----------IIKDRAIDREISNLEIRCLLNGCDHIGQFK-YLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDK-NGTETKLLKEENF---------QLKKQIESLRHEMRINENQIEAIKSDINSYKEQLG---------GGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            GSLE     F K +   RLE  +++CS C  IL  P Q QCG R+C  C+      C +I        C  C  E   E             D A  RE+ +L   C  +GC   G  K Y   H  +C + L  C  C        KE H ++EC      C  C    +       HV++ V    ++C      C      +I     ++H+  C      C  + +GC  +    ++  H       H+ +++S         G L Q   E   +    E K+   EN          ++    E+   + R+++++IEA+ + +   +  +G             S+ +VS  +G+ IW + +  ++  +A +G    I S  FY  + GY+  L+VY NGDG G+   LS++F+++KG  D  L+WPF +KV L L+  N   +++    +PD     + RPV + N+ +G P F  + K+   + ++   +I I+
Sbjct:   10 GSLELLQPGFSKTLLGTRLE-AKYLCSACKNILRRPFQAQCGHRYCSFCLTS-ILRCASILSSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCS-------HVDLEVH--YEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNR-EHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIK 500          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 153.68 bits (387), Expect = 2.252e-39
Identity = 138/526 (26.24%), Postives = 215/526 (40.87%), Query Frame = 3
Query:  126 NNIQLGSLETRTEY-FIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINK-HFASCGNICPNCQTEI-PNEIIKDRAIDREISNLEIRCL-LNGCDH---IGQFKYLDDHLRMCKWRLENC--DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKH-------------------------------------LSDDNVSHMTIVMSGMRNLMR------------KNGELEQKIVEANDKNGTETKLLKEENF--------QLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGIC-----IWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDS 1487
            N+I L   E  TEY F++ +     R+ C+ CH +L +P QT CG RFC  CI      +   ICP  +  I P E+ KD    RE+ NL + C    GC+    +G+F+   DHL+ C ++   C  + C +   ++  + HL   C     KC  C  ++     Q    N         C      CP  C   I    +  HL  CP     C     GC   G + ++ +H                                      +D  + H T  MS  +++              K+  LE ++ +       +   L   +         Q   Q+E+    + + E +     + IN +K QL     ++E    +EG C     IW V + R +  +A  G    + S+PFY  + GYR   + Y NGDG GK   LS+YF++++GE+D  L+WPF ++V L L+  +    +I    K D N   + RP  E N+ +G P FV+   L +S
Sbjct:   21 NSISL-DFEPDTEYQFVEQLE---ERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQ---DHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENS--------CPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRVNALLSSLERKKKMAAADSAIQHATNPMSRFQDIFSFLYRKALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLN---KNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENS 528          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 153.68 bits (387), Expect = 2.252e-39
Identity = 138/526 (26.24%), Postives = 215/526 (40.87%), Query Frame = 3
Query:  126 NNIQLGSLETRTEY-FIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINK-HFASCGNICPNCQTEI-PNEIIKDRAIDREISNLEIRCL-LNGCDH---IGQFKYLDDHLRMCKWRLENC--DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKH-------------------------------------LSDDNVSHMTIVMSGMRNLMR------------KNGELEQKIVEANDKNGTETKLLKEENF--------QLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGIC-----IWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDS 1487
            N+I L   E  TEY F++ +     R+ C+ CH +L +P QT CG RFC  CI      +   ICP  +  I P E+ KD    RE+ NL + C    GC+    +G+F+   DHL+ C ++   C  + C +   ++  + HL   C     KC  C  ++     Q    N         C      CP  C   I    +  HL  CP     C     GC   G + ++ +H                                      +D  + H T  MS  +++              K+  LE ++ +       +   L   +         Q   Q+E+    + + E +     + IN +K QL     ++E    +EG C     IW V + R +  +A  G    + S+PFY  + GYR   + Y NGDG GK   LS+YF++++GE+D  L+WPF ++V L L+  +    +I    K D N   + RP  E N+ +G P FV+   L +S
Sbjct:   21 NSISL-DFEPDTEYQFVEQLE---ERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQ---DHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENS--------CPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRVNALLSSLERKKKMAAADSAIQHATNPMSRFQDIFSFLYRKALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLN---KNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENS 528          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 144.821 bits (364), Expect = 1.776e-36
Identity = 115/461 (24.95%), Postives = 200/461 (43.38%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICP-NCQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHL-YDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNL---MRK-NGELEQKIVEANDKNGTET-KLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPN-GDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLI-SSNALV-QNISILMKPDSNMICYGRPVKEFNL-GAGQPEFVNL-----GKLIDSDDFIHSGSIRIRFEM 1532
            ++ C  C   L +  QT CG RFC +CI K     G+ CP + +  + N++  D    REI +L ++C   GC    + ++L+DH   C++ L NC +C + + K     H+ E+C      C  C + M  +E +  H        D+ C   +  C Y     I   + NH   DCP     C     GC     +  +++HL ++   HM ++   + N+   +R  +     +     D N  ET K L+    +   QI  L  +M      +  +K  I + ++++     ++ +     GI IW + N    +   +      I S  FY  +PGY+  ++++      Q    ++S++   ++GEYD  L WPF   + L+++  S AL+ QN   +M     ++ + RP    N  G G   F++L     G  I  D  +    +  RF+M
Sbjct:   67 KYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMA-YEEKEIH--------DQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKV-----AEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDM 513          
BLAST of TNF receptor-associated factor 2 vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 4.065e-43
Identity = 133/529 (25.14%), Postives = 229/529 (43.29%), Query Frame = 3
Query:  162 EYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEI-PNEIIKDRAIDREISNLEIRCL--LNGCDHIGQFKYLDDHLRM-CKWRLENCDK--CPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSE--IHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLR-------HEMRINENQIE--------------------AIKSDINSYKEQL---------GGGIN-----------------SDEDVSIVE--------------GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            E F+K +     ++ C KCH +L  P QT+CG RFC SC+    +S    C  CQ  I  +++ KD    REI  L+I C     GC       +L  HL+  C +    C +  C +   ++    H+++ C      CS C  ++     Q  H + +  C+          CP++C+ +  + + +  HL +C N  + C     GC F G    +  H +   V H+ ++     +L +K   L+ + VE N    +    +     ++++Q E LR       H  R+ ++Q E                    ++KS + S + ++          G +                  S  D+ + +              G+ IW +R+ ++R  +A  G    + S+PFY    GY+   +VY NGDG GK   LS++F+I++GEYD  L WPF +KV L L+   +  +++    KPD N   + +P  E N+ +G P FV    ++++  +I   +I I+
Sbjct:   41 EKFVKTVE---DKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQK-HEDTDCPCV-------VVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIK 557          
BLAST of TNF receptor-associated factor 2 vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 4.930e-41
Identity = 127/495 (25.66%), Postives = 212/495 (42.83%), Query Frame = 3
Query:  141 GSLETRTEYFIKNI---RLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPNE----------IIKDRAIDREISNLEIRCLLNGCDHIGQFK-YLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDK-NGTETKLLKEENF---------QLKKQIESLRHEMRINENQIEAIKSDINSYKEQLG---------GGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            GSLE     F K +   RLE  +++CS C  IL  P Q QCG R+C  C+    +S    C  C  E   E             D A  RE+ +L   C  +GC   G  K Y   H  +C + L  C  C        KE H ++EC      C  C    +       HV++ V    ++C      C      +I     ++H+  C      C  + +GC  +    ++  H       H+ +++S         G L Q   E   +    E K+   EN          ++    E+   + R+++++IEA+ + +   +  +G             S+ +VS  +G+ IW + +  ++  +A +G    I S  FY  + GY+  L+VY NGDG G+   LS++F+++KG  D  L+WPF +KV L L+  N   +++    +PD     + RPV + N+ +G P F  + K+   + ++   +I I+
Sbjct:   10 GSLELLQPGFSKTLLGTRLEA-KYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCS-------HVDLEVH--YEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNR-EHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIK 493          
BLAST of TNF receptor-associated factor 2 vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 3.026e-39
Identity = 141/531 (26.55%), Postives = 221/531 (41.62%), Query Frame = 3
Query:  126 NNIQLGSLETRTEY-FIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINK-HFASCGNICPNCQTEI-PNEIIKDRAIDREISNLEIRCL-LNGCDH---IGQFKYLDDHLRMCKWRLENC--DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDK------------------------NGTETKLLK------EENFQLKKQIESL---------RHEMRINENQIEAIKSDINSYKEQ-----LGGGINSDEDVSI----------------VEGIC-----IWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDD 1493
            N+I L   E  TEY F++ +     R+ C+ CH +L +P QT CG RFC  CI      +   ICP  +  I P E+ KD    RE+ NL + C    GC+    +G+F+   DHL+ C ++   C  + C +   ++  + HL   C     KC  C  ++     Q    N         C      CP  C   I    +  HL  CP     C     GC   G + ++ +H       HM +V+     L ++  +L Q + +   K                        NGT    ++      +++  L+ Q+  L         R ++R   + ++++K  I   +       L  G  S  D  I                +EG C     IW V + R +  +A  G    + S+PFY  + GYR   + Y NGDG GK   LS+YF++++GE+D  L+WPF ++V L L+  +    +I    K D N   + RP  E N+ +G P FV+   L +S +
Sbjct:   21 NSISL-DFEPDTEYQFVEQLE---ERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQ---DHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENS--------CPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKELKQFTQMFGRNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKN 536          
BLAST of TNF receptor-associated factor 2 vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 1.106e-38
Identity = 123/495 (24.85%), Postives = 203/495 (41.01%), Query Frame = 3
Query:  141 GSLETRTEYFIKNI---RLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEI----------PNEIIKDRAIDREISNLEIRCLLNGCDHIGQFK-YLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSG-------MRNLMRKNGELEQKIVEANDKNGTETKL---LKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDV---------SIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            GSLE     F K +   +LE  +++CS C  +L  P Q QCG R+C  C+    +S    C  C  E            +    D A  RE+ +L   C  +GC   G  K Y   H   C   L  C  C        KE HL+ EC      C  C       + +  H         ++C      C      +I     ++H+  C      C  + +GC          +H       H+ +++S        + +      EL Q+      K  T   +   L  E  ++    E+   + R+++++IEA+ S +   +  +G    +  D+         S  +G+ IW + +  ++  +A +G    I S  FY  + GY+  L++Y NGDG G+   LS++F+++KG  D  LRWPF +KV L L+  N     I    +PD     + RPV + N+ +G P F  + K+   + ++   +I I+
Sbjct:   10 GSLELLQPGFSKTLLGTKLEA-KYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHH---------EVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAF-RPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIK 493          
BLAST of TNF receptor-associated factor 2 vs. UniProt/SwissProt
Match: sp|A7XUJ6|TRAF6_PIG (TNF receptor-associated factor 6 OS=Sus scrofa OX=9823 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.639e-38
Identity = 126/474 (26.58%), Postives = 215/474 (45.36%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICP-NCQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSE-IHNNIRNHL-YDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNG---TETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINS---YKEQLGGGINSDED-VSIVE-----GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPN-GDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLI--SSNALVQNISILMKPDSNMICYGRPVKEFNL-GAGQPEFVNLGKLIDSDDFIHSGSIRIRFEM--RSDSDSLR 1556
            ++ C  C   L +  QT CG RFC +CI K     G+ CP + +  + N++  D    REI +L ++C   GC H  + ++L+DH   C++ L NC +C + + K    IH+ +EC      C  C + M   E +  H        D+ C   +  C Y CN+  I   + NH   DCP     C     GC     +  +++HL ++  SHM ++   ++ L      + Q+ +   D +      +    ++NFQ  + I+ L   +   ++QI  + + + +   Y  +L   I S ED V+ +E     GI IW + N    +   +      I S  FY  +PGY+  ++++      Q    ++S++   ++GEYD  L WPF   + L+++  S   + QN   +M     ++ + RP    N  G G   F++L  L     FI   ++ +R E+  R D  SLR
Sbjct:   68 KYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLTVKCPNVGCLHKMELRHLEDHQAHCEFALMNCPQCQRPFQKCQLNIHILKECPRRQVSCVNCAVSMA-FEDKEIH--------DQNCPLANVICEY-CNTVLIREQMPNHYDLDCPTAPVPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMMAQALQGLSLAVAPVPQRDMLPYDSSPLSRISSGCCSDQNFQ--ETIQQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRSLEDKVAEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPIRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLDAL-RQRTFIKDDTLLVRCEVSTRFDMGSLR 528          
BLAST of TNF receptor-associated factor 2 vs. TrEMBL
Match: T1DF65 (TRAF-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 3.007e-91
Identity = 160/469 (34.12%), Postives = 270/469 (57.57%), Query Frame = 3
Query:  138 LGSLETRTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEI--PNEIIK-DRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEMR 1535
            L  ++ R++ F      +  R  C KCH++LI+P QTQCGCR C +C+ +      + CP C   +  P+   K D+AI++EI  L I C   GC++  + K LD+HL  C++  + C  C ++YP++  + H +  C   I  C  CGLE+++ + +  H N+N E ID +C      CP++C+ +   NI++HL  C  +  +C L E+GCR V  + +M +H + +   H  ++M  +  L +++ +L   +   N++N  E K LKE+   L  +IE L+ +++  ++  E ++++ N  K  L        +     G   W V N+ +++ DAK G +TQI S+ FY   PGYR  LK+YPNGDG     +LS+YF+++KG+YDD+++WPF   +++ L++     ++  + M+P+ N  CYGRP +E NL AGQP+FV+  +L++ DDFI  G+I +R  ++
Sbjct:    9 LKVIKDRSKLFYFECEQQKQRISCVKCHQVLIEPYQTQCGCRLCSNCLEECSKDEESHCPGCNETMNSPSNYSKHDKAIEKEILELNIICTNKGCEYTCKVKDLDNHLETCEYIEKRCTACNESYPRKELKKHEEFTCKMIITTCEDCGLELSKGDLEKKHKNVN-ELIDNVCSKWRDICPFKCSEDTLVNIKDHLLTCERRPVECSLNEMGCRKVLPREEMREHFNLEANYHTVLLMDALFLLRKEHQDLSVSVSVQNERNSAEIKELKEKLSSLLTEIEDLKTKLKQFQSMYEKLENERNLAKCSLS-------ETKERYGEYTWKVENIMEKVNDAKKGVNTQILSESFYSSNPGYRMCLKIYPNGDGSAFGNYLSVYFVLMKGKYDDQIQWPFNSIISIRLVNIARRGEDRVLNMRPNINDQCYGRPKEEHNLAAGQPKFVSHLQLVNEDDFIKDGAIILRVNVK 469          
BLAST of TNF receptor-associated factor 2 vs. TrEMBL
Match: T1D122 (TRAF-5 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 2.572e-86
Identity = 146/460 (31.74%), Postives = 265/460 (57.61%), Query Frame = 3
Query:  168 FIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPNEI--IKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGI---CIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEM 1532
            F+ ++R    R  C  C +I+ +P+Q+QCGCRFC  CI +  +     CP C  +   ++  I+D+AI++EI  + ++C   GC     ++    H R C + +  C+KC + Y +  KE H +EEC   + KC  CG EM R + +  H N + +  + LCE    KCPY+C  E + N++ H   C  + T C L ++GC   G Q ++  HL +    H  +++  +++L  +  E+++ + E  + +  + + L+E N   +  ++ L+ ++       E++ S++ +YK       +  E ++ +E       W+++++R++I +AK G + ++ S+ FY+ +PGY  SLKV+ NGDG+  +++LS +F+I KGEYD ++ WPF  +V LS++S+N   ++I + MKP++N  CYGRP    NLGAGQP+ V L ++++ D ++H G++++R  +
Sbjct:   10 FLDDLRT-LSRCSCGICKQIMFEPTQSQCGCRFCSKCIEEFISKEKRKCPICTDQNIEKVSLIRDKAIEKEIMRMRVQCPQEGCGENIMYREWGGHERACVYGVNECEKCGEEYVRSRKEDHEREECGESVVKCDDCGKEMRREDLKNVHKNYDGD-EESLCEKWMCKCPYQCTEEQYVNMKEHASSCRERCTPCPLKDIGCEVKGPQGELKVHLKEAVGLHQILMLKEIKDLREQKEEMKKMLREKEEDHRKKYEELREINKDNETSVKELKEKVDHITKYSESLLSELTTYK----SNSHPKEPLTDIEASLRDVTWSIKDIRKKIQEAKCGGNNELISECFYVFRPGYNMSLKVFLNGDGRATNKYLSTFFVINKGEYDSQISWPFKSRVLLSILSNNLSKEDIVVRMKPNNNDQCYGRPSGRCNLGAGQPDLVELSEILNKDYYLHHGALKLRLTL 463          
BLAST of TNF receptor-associated factor 2 vs. TrEMBL
Match: D5JG60 (TNF receptor-associated factor-2-like protein B OS=Dugesia japonica OX=6161 GN=TRAF-2B PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 6.840e-65
Identity = 128/424 (30.19%), Postives = 214/424 (50.47%), Query Frame = 3
Query:  207 CSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKL 1478
            C  C ++L++  QT CGCR+C  C+ ++ A     C          II D A++REI  L ++CL  GC+H    K + DHL  C  +  NC  C +   K   + H +++C   +  C+ CG EM        H+N++ E   KLC  L GKCPY+C++    N+ +H   C  K   C   E+GC  V  + D+ KH +++++ H  ++M  +  +     EL+ K +E N        +LK E  + + +I           ++I++++              +S+E      G+ IW +    +  ++A+ G    ITS  FY ++ GY+ S+K+YP GDG GK   LS++F +++GE+DD L+WPF  KV L+++       + S   KPD    CY +P  ++N+ +G P+F+   +L
Sbjct:   30 CIICSQLLLEALQTDCGCRYCKECLKEYQAKGKTKCLTDGCGDLGNIIPDNAVNREIGKLTVKCLFPGCEHSELLKDIGDHLDSCIHQTINCKSCNEELTKIELKEHTEKKCPMRLVSCTHCGEEMEYSNLTELHLNVHTE---KLCAKLVGKCPYKCDNGKEVNLLDHRKSCSKKPVTCLFSEIGCNRVMTKEDLIKHNNEESLQHSRLLMKEIITMKNDISELKMKTLEFN--------ILKIEFSKFQSEIL----------DKIKSLEKIPRHTSPSTSSVRSSEEKTVYRNGVFIWKIERFSELKSEAERGNRISITSDYFYTKEFGYKMSMKIYPAGDGVGKGTHLSVFFTLMRGEFDDLLQWPFKNKVTLTILDQKNKTNDHSDTFKPDVRSTCYQQPTDDYNIASGSPKFITFSQL 432          
BLAST of TNF receptor-associated factor 2 vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.121e-60
Identity = 134/445 (30.11%), Postives = 219/445 (49.21%), Query Frame = 3
Query:  207 CSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNIC----PNCQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDK--LCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            C  C +IL+D  QT CGCR+C  CI+ +  +    C     +C++ I +  I DRA ++EIS L+++CL  GC      K +  HL  C++R E C  C   Y  + +  HL  EC+     C  C   +T  EY   H+     C +   LC      CPY C  E   N+ +H   C NK  +C L+   C+ +  +  M++HL+  +  H   +++ +R L ++N  +E+++            +L EEN  LK  +E ++ ++  N   I    S            +          G  +W +++  +   +A  G +  I S+ FY    GY+  +K+YP GDG GK   LSI+F+I+KG+YDD L WPF  KV +++    +   N+S   KPD   ICY RP +E+N+ +G P+F++  +L    +F+   ++ I+
Sbjct:   31 CVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCRSVITS-YIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMCSLCGMEYIIKEESNHLANECLLREVLCQYCRTLLTFKEYNESHL-----CFESRDLCGKYEAICPYGCTGESKVNLLHHRKSCENKPLECPLHVFDCKQLIPKDQMTEHLNTSSYEHTLTIVTELRKLEKQNKHMEERM-----------NILIEENQLLKATLEVMKLDLPKNSGSISRDTS------------LKRANKTIFRNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSDTFKPDPKSICYQRPEEEYNIASGSPKFISFSEL---KNFLKKDTLYIQ 443          
BLAST of TNF receptor-associated factor 2 vs. TrEMBL
Match: A0A3P9LMP4 (TNF receptor-associated factor OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 3.480e-48
Identity = 138/517 (26.69%), Postives = 230/517 (44.49%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICP-NCQTEIPNEIIKDRAIDREISNLEIRCL--LNGCDHIGQFKYLDDHLRMCKWRLENCD--KCPQ-TYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSE--IHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRK----NGELEQ--KIVEANDKN----GTETKLLKEENFQLKKQIES------------------------LRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVE---------------------------------GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            ++ C  C  +L  P QT+CG RFCYSCIN   +    +CP + +    ++I +D    REI  L++ C    NGC      + + DHL +C +    C   KC + T  K++ E HL  +C      C  C  +M   E Q           + +C      CP  C S     + + +H +DCP     C  +  GC F G  +DM +H S     H+ ++ +    L  K     GEL +  K++ A         ++T  L+E+N Q+++++ +                        LR EM      ++ +++ +++ ++   GG  S   ++ +E                                 G  IW +R+ ++R  DA +G    + S+PFY    GY+   +VY NGDG GK   LS++F++++GEYD  L WPF +KV L L+      +++    KPD +   + RPV E N+ +G P FV+   +++S  +I   +I I+
Sbjct:   75 KYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADMEPLFKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHLNVCPFFEVPCPLGKCKERTMRKEIPE-HLAWKCKYRESTCEFCKNKMPLTELQKHK--------ETVCPAFPVSCPNHCTSSSLPRSELSSHQHDCPKAQVSCQFHRYGCSFKGLNLDMRQHESSFAAEHLKMMATRTGLLETKVEEVKGELMERYKVLPALSTRLSDLDSQTDELREKNRQMEQKLAAMQKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLSALEQGGRGGSGSAHTLASLETQLNRHDDMLSVHEIRLADMDLRFQVLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMNIASGCPLFVS-QSVLESGTYIKDDTIFIK 581          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 155.992 bits (393), Expect = 1.509e-40
Identity = 116/496 (23.39%), Postives = 205/496 (41.33%), Query Frame = 3
Query:  201 FVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGN-ICPNCQTEIPNE-----------IIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCD-KCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRN-------------------LMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYK--------------------------------------EQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKL 1478
            F+CS C+ +L +  QTQCG R+C +C+     +  + IC  C+ +  +E              D AI++EI  L + C+  GC      K  +DH   C++ L  C+  C     ++    HL++ C N    C  C   +T  E Q+                          +     +++   + P +   C   E+GC F GN   + +H      +H+ +++  +RN                   L    GELE    +    +   +    +   ++ +Q+ +L+  ++I EN I A+  ++   +                                        L   I++ +DVS  +G  +W + +V Q++ +A +G  +   S  FY  + G++  +++Y  GDG GK   +S++F+I+KG+YD  L WPF +KV   LI  N   +++    +PD     + RPV E N+ +G P F  L KL
Sbjct:   27 FLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPCNIGCGLMVLRKTLATHLEKGCPNNKTTCQVCCSALTPAELQSV-------------------------TYFSLFLKDSKQESPKRKETCVFSEIGCTFKGNPDKVREHEVSSTSAHLHLLVEVVRNVQMSVPPPPERTVQYPALDLTLNGGELETDSGDTGANDKALSLHDDQAELEVGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNMNLIQHLEAVVAEQQQRLIRKDLQISSLQQSISAQQDVSY-DGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQR-EHVVDAFRPDLRSASFQRPVSEMNVASGCPLFFPLSKL 495          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 155.221 bits (391), Expect = 3.941e-40
Identity = 121/498 (24.30%), Postives = 212/498 (42.57%), Query Frame = 3
Query:  195 PRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNI-CPNCQTE----------IPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFK-YLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSE--IHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNL-MRKNGELEQK----------------------IVEANDKNGTETKLLKEENF---------QLKKQIESLRHEMRINENQIEAIKSDINSYKE-------QLGGGINSDEDVSI--VEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            P++ C +C  +L  P Q QCG RFC  C  K   S G I C  C+ E             E   D A  REI  L  +C  +GC   G  K Y   H   C++    C+ C        K+ H + EC      C  C +        TF    +++  D++C+    +C  +C  +         H   C    + C   E+GCR V +     +H     + H+ ++++ +  + +R +G  E +                         A    G + K+   EN          +   ++E+L  + ++++ +IE + + +   +        QL     +  ++     +G+ +W + +  +R  DA +G    + S  FY  + GY+  L++Y NGDG G+   LS++F++++G+YD  L+WPF +KV L L+  N   ++I    +PD +   + RP+ E N+ +G P F  L KL     ++   +I I+
Sbjct:   38 PKYQCQQCKGVLRKPFQAQCGHRFCVFCF-KQLTSSGPIPCEACRAEGIFEMEHSMLSITEAFPDNAARREIDGLPAKCPNDGCSWNGTLKEYEVQHEGRCEFERVKCEACQMMILLSDKDRHNERECEARTLNCKYCKV--------TFSFK-DIKAHDEICQKFPMQCK-DCGKKKIPREKFAEHSKSCAKSKSACQFSEIGCRAVVDNGKQHEHEQSSIIEHLRLMLAVLSTVRVRSDGPGEWQEDSGLGLYRGPEDAAPPGAHAAAHNAAGGPGVQQKMTALENIVCVLNREVERTVLRLEALTRQQQLDQEKIENLSNKVRQLERTLTMRDLQLAESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNR-EHIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 523          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 152.525 bits (384), Expect = 3.637e-39
Identity = 124/517 (23.98%), Postives = 214/517 (41.39%), Query Frame = 3
Query:  201 FVCSKCHEILIDPSQTQCGCRFCYSCI------NKHFASCGNICPNCQTEIPNE-----------IIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCD-KCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRK--------------------------------NGELEQKIVEANDKNGTETKL-LKEENFQLK--KQIESLRHEMRINENQIEAIKSDINSYK--------------------------------------EQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKL 1478
            F+CS C+ +L +  QTQCG R+C +C+      NK       IC  C+ +  +E              D AI++EI  L + C+  GC      K  +DH   C++ L  C+  C     ++    HL++ C N    C  C   +T  E Q         C +   ++LS         +     ++   + P +   C   E+GC F GN   + +H      +H+ +++  +RN+                                    GELE    ++ D    +  L L ++  +L+  +Q+ +L+  ++I EN I A+  ++   +                                        L   I++ +DVS  +G  +W + +V Q++ +A +G  +   S  FY  + G++  +++Y  GDG GK   +S++F+I+KG+YD  L WPF +KV   LI  N   +++    +PD     + RPV E N+ +G P F  L KL
Sbjct:   27 FLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDL-----ICTKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPCNIGCGLMVLRKTLATHLEKGCPNNKTTCQVCCSALTPAELQKH------SCSNGTEKDLS---------KAEKRKKDSKQESPKRKETCVFSEIGCTFKGNPDKVREHEVSSTSAHLHLLVEVVRNVQMSVPPPPERTVQYPALDLHLQNQDMTPLPDITLNGGELE---TDSGDTGANDKALSLHDDQAELEVGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNMNLIQHLEAVVAEQQQRLIRKDLQISSLQQSISAQQDVSY-DGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQR-EHVVDAFRPDLRSASFQRPVSEMNVASGCPLFFPLSKL 518          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 145.206 bits (365), Expect = 3.868e-37
Identity = 109/456 (23.90%), Postives = 197/456 (43.20%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFK-YLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQ---IESLRHEMRINENQIEAIKSDINSYKEQLG---------GGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            + +C+ C +IL  P Q QCG RF                       P     D A  RE+  LE  C+  GC   G  K Y   H   C + +  C  C +       E H + EC      C  C         + FH   N++  D++C      C      +I      +H+  C    T C  + +GC    ++   +  L+  ++ + +  +   +    K  EL ++  E   K GT   ++   N ++++    +E+   + R+++++IE + + +   +  +G          G   +   +  +G+ +W + +  ++  DA +G    + S  FY  + GY+  L++Y NGDG G+   LS++F++++G  D  L+WPF +KV L L+  N   ++I    +PD +   + RPV + N+ +G P F  L KL   + +I   +I I+
Sbjct:   31 KHLCNICQKILRRPFQAQCGHRFS----------------------PASAFPDNAAKREVEALEAVCINEGCSWTGTIKEYEATHEGQCDFMIIPCPSCKELLRANELERHNERECPERTLNCKYCK--------EPFHFK-NIKAHDEICPKYPMICEGCAKKKIPREKYVDHIKLCTKFRTPCRFHVVGCDMSVSKPQWNLILTPRDLLYTSFTVPLSQT---KVAELSRRCQELELKVGTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIK 451          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 133.65 bits (335), Expect = 4.291e-33
Identity = 123/507 (24.26%), Postives = 211/507 (41.62%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQ-TQCGCRFCYSCINKHFASCGNICPNCQTEIP-NEIIKDRAIDREISNLEIRCLLN--GCDHIGQFKYLDDHLRMCKWRLENC-DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNI----NVECIDK---------LCENLSGKCPYE------CNSE-IHNNIRNHLYDCP-----------------------------NKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIV-EGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLI----SSNALVQNISILMKPDSNMICYGRP------VKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            RF C  C + + +P Q + CG RFC +C+ +  +     CP  Q  +   +I  D  ++++I  L IRC+ +  GC   GQ K L  H   C + +  C ++C     ++    HLQ +C     KC  CG E T   ++  H  I    +V C +K         L ++   +CP        C  E +++ I+NH Y CP                             + +  C   + GC+    ++ + +HL +   SH+T++ S +       G   Q+I+E                         LR EM                            E++S+  +G+ IW + +  +++ +AK   + +  S PFY  + GY+  +  + NG+G G+   LSIY  ++ GEYD+ L WPF  KV  S++     S +  Q+I+    PD N   + +P      + E  LG G P+F++  + I   ++I   +I ++
Sbjct:   15 RFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCAVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAFEN-HQGICPQESVYCENKCGARMMRRLLAQHTMAECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLATHVKESCGSALVLCPFKDAGCKHRCPKLAIGRHLEETTKSHLTMMCSLV-------GRQRQEIIE-------------------------LRREM----------------------------EELSVSHDGVLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPSSSRNSLDESTLGFGYPKFISHDE-IRKRNYIRDNAIFLK 459          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 9.312e-27
Identity = 82/338 (24.26%), Postives = 143/338 (42.31%), Query Frame = 3
Query:  645 CENLSGKCPYECNSE--IHNNIRNHLYDCPNKVTKCFLYELGCRF-VGNQVDMSKHLSDDNVSHMTIVMSGMRN-----------------------LMRKNGELEQKIVEA-------NDKNGTETKLLKEENFQLKK------------QIESLRHEMRINENQIEAIKSDINS----------YKEQLG---GGINSDE------DVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVN 1466
            C      CP  C         +  H+  C      C  + LGC F  G    + +H      SH T+V+S  RN                       L ++  +LEQ +          N + G+  ++L + N QL+                +LR +M     ++ A+++ + +          ++++L    G +++ E      + +   G  +W +R+  +R  +A SG    + S+PFY    GY+   + Y NGDG G+   LS++F++++GEYD  L WPF  +V LSL+   A  +++S    PD     + RP  + N+ +G P FV+
Sbjct:   56 CAQYPLPCPNNCEEHGIPRAELSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTLVIS--RNSELELQCARLQCSIEDHTNMSEMLTQRVAQLEQDLSHWSTLTGSNNTRLGSTLEMLTQHNEQLQSLHVAQRAPQRDADTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMHDGLLDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFVS 391          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 8.293e-26
Identity = 51/143 (35.66%), Postives = 81/143 (56.64%), Query Frame = 3
Query: 1095 GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            G  +W +R+  +R  DA SG    + S+PFY    GYR   + Y NGDG G+   LS++F++++GEYD  L WPF ++V L+L+   A  + +S   KPD     + RP  + N+ +G P FV+   L +S  ++   +I I+
Sbjct:  325 GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLFVSHVAL-ESASYLQDDTIFIK 466          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 100.523 bits (249), Expect = 1.954e-22
Identity = 100/493 (20.28%), Postives = 191/493 (38.74%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCI--NKHFASCGNICPNCQTEI-PNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHL-YDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQ-------------------------KIVEANDKNGTETKLL---KEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGIN---------SDEDVSIVEGICIWTVRNVRQRITDA-KSGFDTQ---------ITSKPFYLRQPGYRFSLKV-------YPNGDGQ------GKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISS-NALVQNISILMKPDSNMICYGRPVKEFNL-GAGQPEFVNLGKL 1478
            ++ C  C   L +P QT CG RFC +CI  +      G  CP     +   ++  D    REI +L +RC    C H G+ + L +H   C++    C +C     ++    H ++EC+  I  C  C  +M   + +           +++C  +   C +     I   +  HL  DC      C    LGC     +  ++ H+ +    HM ++ +G++ L  + G+  Q                         +   A+   G+  +      +E  +L++   +L   + +  +QI  + +  ++ +  L              ++ +  +  GI  W V    + +     SGF +          + S  FY   PGYR  L++        P G         G+   L+++  +++G+YD  L WPF  ++ +S++        +++ +M  D  +  + RP    N  G G   F+++  L
Sbjct:   62 KYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPVDNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKDSKNH---------EQMCPLVVVNCKHCQQELIREQLGPHLEVDCQQAQVPCTFSPLGCEAQMVRSLLAAHMHEHTQVHMRLLANGLKILRIQVGQGAQPSSAAGSSAPPNSLSWLSSTSGGDVQTAGASRSQGSRDRAACDCAQELDRLREITRTLEERVVLQLHQIRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTL 545          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 2.841e-21
Identity = 92/406 (22.66%), Postives = 165/406 (40.64%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNIC------PNCQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQ-FKYLDDHLRMCKWRL--ENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMR----NLMRKNGE-----LEQKIVEANDKNGTETKLLKEENFQLKKQI---ESLRHEMRINENQIEAIK--------SDINSYKEQLGGGINSDE-DVSIVEGICIWTVRNVRQRITDAKSGFD--TQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPF 1319
            RF C  C  +L D  QT CG RFC  CI +   S    C       N     P +   D A+ RE+  L +RC+  GC+  G+  +Y   H+  C W L       C    P+     H+ +EC      C+ C   +   + Q   ++       + C+    K   E   + H   R     C      C    LGC + G+   +  H  +    H+ IV    +     L++ + +        ++V A  +  T  + ++E   ++++ +   E+   +  I+ ++   ++        SD  + +  LG      E + +   G+ +W +++V  R+ +A +G +   QI S  F+  + GYR  L++  +G+       +S Y ++  G YD  L WP+
Sbjct:    2 RFACGSCQGLLRDAVQTHCGHRFCKPCIARLITSVHRSCNDTLMNSNFLVYSPTQFFPDAALRREMGVLPVRCVSEGCEWRGRLLEYDVAHVERCDWVLVPCLLAGCALLLPRAELHRHVAQECSVRPVPCAACAQLLPYRQLQKHQLHCRSR-RTRECKLCGQKSIPEDKWQHHEERR-----CMKNRDTCPYSPLGCLYRGHGESLHNHDKNSVEVHLAIVYDAFKKTFEQLIKGHADNIKHPPSARLVAAEAQLATMDRRVEEVAKRVERDVRVSEASTRQGNIDRDETARLQNKMARVEHSDQETERSILGLTRRLAELENTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSGE------HVSAYAMLGPGPYDATLAWPY 395          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 140.969 bits (354), Expect = 5.947e-36
Identity = 121/491 (24.64%), Postives = 205/491 (41.75%), Query Frame = 3
Query:  201 FVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNI-CPNCQTEI-PNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENC--DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRN-------LMRKNGELEQKIVEANDKNGTETKLLKEENFQL----KKQIESLRHEMRINENQIEAIKSDINSYKEQLG-------------GGINSDEDVSIVEGICIWTVRNVR------------QRITDAKSGFDTQIT-------SKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMI----CYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRI 1520
             +C+ CH ++ +P  T CG  +C  CI K       + CP    ++ P++I  D+  DR + +LE++C  N C   G+ +    HL++C  +   C  + C    P+ + E H    C   +  C  C L   + + +T                                   H  DCP     C   E+GC F G +    +H      +H+ I    +R+       L ++  ++ Q++   +  +  E   ++E++ +     K QIE+L  E  I  N I   K  +++ K++LG               +++       +G  +W + N +            Q +    S  D  I+       S PFY  + GY+  LK YPNG G GK   LS+   I+KGEYD  L WPF  K+ LSLI+ +   ++ ++ + PD         + RP++  N+G G   F++  +L +S D+I    I I
Sbjct:   28 LICAICHMVVNEPVLTSCGHSYCKYCIEKWCNGKEVVTCPVDNEQLKPSQIFPDKKTDRIVLSLEVKCTNNPCRWKGELRQKQKHLKICSHKAVKCILEGCNVKVPRILMEKHTNT-CGWRLLHCKPCNLSYPKKDEETVQ---------------------------------HKDDCPLAFLPCRFSEIGCTFKGRESARDEHCESAVQTHLHIACETIRDNKEQISDLHKELDKVRQELQTKSCDHMKEVNAIREKHDEAIRDNKGQIEALSKEHGIASNTIHENKEQLDTLKKELGIASETIRKNRDQIAKLSTACKTQYTDGTFVWRICNYKDKYKKAVAFATNQEVKGGNSDSDDDISMAGDIMVSLPFYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSEQWRSETVEIYPDDATPDKKHKFERPIENENVGCGYSCFISHMEL-NSGDYIKDDVIFI 483          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 139.813 bits (351), Expect = 2.690e-35
Identity = 122/510 (23.92%), Postives = 206/510 (40.39%), Query Frame = 3
Query:  156 RTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIP-NEIIKDRAIDREISNLEIRCLLN--GCDHIGQFKYLDDHLRMCKWRLENCDK--CPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSE--IHNNIRNHLYD-CPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRH--------EMRINEN-----------QIEAIKSDINSYKEQLG-------------------GGINSDE-------------DVSIVE--------------GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVN 1466
            +TE F++ +    P++ C  C   L  P QT CG RFC  C+          CP    E+  + + KD    REI  L   C     GC+ +   +YL++H   C+++   C    C +   K+  E HL E C      C  C   + R    +   ++        CE     CP+ C +E    + + +H  + C      C   + GC F G +  +  H  D    H+ ++++  +N  +   E+  K+ +   +   + + + E+   L    ++LR         E  + E            Q++ +++ I     +LG                   GG  + E             D+ + E              G  IW +    +R  +  SG    I S PFY+ + GY+   +VYPNGDG GK   LS++F++++GE+D  L WPF +KV   L+  +  V +I    +PD     + RP    N+ +G P F++
Sbjct:    7 QTELFVEPLD---PKYRCPVCGNALKHPVQTPCGHRFCEGCLEPILRGPSK-CPVDGEELKIDGVFKDVCCRREILCLACYCPNRQLGCEWMKDLQYLEEHRANCEYKGVQCHNPGCQEKVAKRDLEAHL-ERCEFKPSDCQYC---LQRIPAASMEDHLQT------CEKHPVVCPH-CGAEGICRDELLHHQTNICEQAELPCSFAKHGCHFKGTREALETHFRDQASVHVNLLLTATQNEEKARSEMAAKLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKLNVIERSVAEQRRELAELKERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDR-VHDIGDTFRPDPTSSSFKRPTSNMNIASGCPLFIS 500          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 134.035 bits (336), Expect = 1.534e-33
Identity = 113/451 (25.06%), Postives = 202/451 (44.79%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPN-EIIKDRAIDREISNLEIRCL--LNGCDHIGQFKYLDDHLRMCKWRLENC--DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGC-------------------RFVGNQVDMSKHLS-DDNVSHMTI--VMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQ---IESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEF 1460
            + +C+KC  I+ D  QT CG R+C  CI+   +     C  C + I   E  +D+  DREI  L + C+   +GC   G+ ++  +H   C++   +C   +C +         HLQ EC      CS C   +     +  H        +K C +    CP +C+ E+   IR  ++  P           GC                   R  G  V+  + +   +N+ +  I  V+  + N+  K  + E  +VEA+       + +   N +L++    I  L  ++ +++         I   +E+L    N+ +  +  + + +W + NV  + ++A SG  T   S  F+    GY+   ++Y NGDG G++  +S++F+I++GE+D  LRWPF +KV L L+  +  V+++    +PD +   + RP  E N+ +G P F
Sbjct:   21 KHLCAKCRLIVKDAVQTACGHRYCSPCISPLLSRGPIQCDVCGSTITKPETFRDKFADREILELHVHCVNQPHGCPWEGELRHRQNHHTKCEFNPISCVHPECGKKLSVAKLPEHLQNECQYREETCSYCEQPVVVARMKEHH--------EKTCPSYPVNCP-KCSKEL---IRVEVHSTPFTREPRLEKGRGCENTLEVLEDHESRIKKLEQRGGGIGVNGLQSMRISENIDNEAIGDVLRRVANVEAKGADHEVLVVEAHSAVDELRREVGRLNVKLQESDDIIRRLERQLELHDQGTGLRNLAIADLEERL----NTLQGTTF-DSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDN-VEHVIDAFRPDPSSSSFQRPRAEMNIASGCPLF 453          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 125.176 bits (313), Expect = 1.334e-30
Identity = 112/464 (24.14%), Postives = 208/464 (44.83%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPN-EIIKDRAIDREISNLEIRCLLN---GCDHIGQFKYLDDHLRMCKWRLENC-DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSG------KCPYECNSEIHNN-IRNHLYD-CPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLR--HEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQN---ISILMKPDSNMICYGRPVKEFN-LGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEM 1532
            ++ C  C   L DP QT CG RFC++CI +     G  CP   T +   E+ +D    RE+ +  + C L    GC   G  K L++HL+ C     NC ++C     ++  + H  E C N    C  C +++T               I K+ E+L G       CP EC + +    +  H  + CPN+   C      C+   ++ + + H   ++  H   +    R  + ++  +++++    D  G+     ++    L++++E ++   + RI E   + ++  + + + +L G         +  G  IW + N RQ    + +G    I S PFY    GY+  L++  NG   G    +S++  +++G++D  L WPFI ++ LS++  +  + +   IS  +    N++ + RP    N  G G  EF  + +L +   +I + SI +R ++
Sbjct:   55 KYECPICLLGLRDPVQTPCGHRFCFNCIRRSIRDAGPKCPVDNTPLSERELYRDNFAKREMMSFIVWCRLKKERGCTWKGALKELEEHLKGCPCMDTNCPNECGAVMQRKEVDKHCAEACPNRSVPCDHCKMKVT---------------ISKIEEHLKGCPCMDTNCPNECGAVMQRKEVDKHCAEACPNRSVPCD----HCKMKSSK-EQASHGPQEHTPHEAELR---REALFQSANMQREV----DMLGSRGDEYRQFLAYLERKVEDVKTSSDRRIAELTHKLMR--LETREIELEG--------RVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDSRRPISETLVAKPNLLAFQRPTSPRNHKGYGYVEFCPIDQLTEG-QYIKNNSILVRIQI 480          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 122.865 bits (307), Expect = 3.152e-30
Identity = 112/455 (24.62%), Postives = 190/455 (41.76%), Query Frame = 3
Query:  201 FVCSKCHEILIDPSQTQ-CGCRFCYSCIN--KHFASCGNICPNCQTEIPN-EIIKDRAIDREISNLEIRCL--LNGCDHIGQFKYLDDHLRMCKWRLENC--DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSE--IHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNM----ICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            + C  C     DP Q + CG RFC SC+   +       +CP  +  I + ++  D+A  R I  L ++C      C+  G+   +++H + C     +C   +C +  P++  + HL  +C   I  C  C  EM  ++    H+        K C+ L  +C  +C ++      +  H+ +CP  V  C   ++GC F G +  + +H  +   +H+ I                QKI E       E++ L      L K                      I++YK Q    + S E+++I                            S PFY  Q GY+  LK Y NG  +GK   LS+Y II+KG+YD  L WPF +K+   LI  +    + + L+ P+ ++    + + RP  + NLG G P FV   ++++S +++    + I+
Sbjct:   24 YECPICQLAFRDPIQIEECGHRFCQSCLQELRRLQGSPVLCPMDRRPISSTKVFVDKAARRAILGLGVKCWNWKRKCEWTGELSNIEEHAKNCAHEDVHCTNPECNEVMPRRSLQYHLVSKCKWRIVSCHFC-TEMYTYKDGKTHM--------KSCKRLPIECVNKCGAKDIPREEMPFHMSECPLAVHPCMYRDIGCPFKGRRDALEEHCKNAVHTHLNIAC--------------QKIRE------NESRSLCTNGIFLWK----------------------ISNYKHQYDQAVASPEELAIF---------------------------SPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEKQNHRTHLLSPNRSLPNIKVVFNRPTVKENLGIGNPCFVP-NEVLESGEYVKDDVMFIK 399          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 169.474 bits (428), Expect = 2.699e-45
Identity = 124/493 (25.15%), Postives = 216/493 (43.81%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEI----------PNEIIKDRAIDREISNLEIRCLLNGCDHIGQFK-YLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSE--IHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRK------NGELEQ-----------------KIVEANDKNGTETKL------LKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLG-GGINSDEDVSIV--------EGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            ++ C +C ++L  P Q QCG RFC  C  +  +S    C  C+ E            +E   D A  REI++L  RCL  GCD  G  K Y   H   C++    C+ C     ++ K+ H   EC      C  C +        TF+   +++  D++C+    +C  +C  +        +H   C    + C   E+GC+ V     +S+H     + H+ +++  + ++ R       +GE ++                   V + D +   + L      L  E  +    +E+  H+ R+++ +IE + + I   +  L    +   E   +V        +GI +W + +   R  +A SG    + S  FY  + GY+  L++Y NGDG G+   LS++F++++ +YD  L+WPF +KV L L+  N   ++I    +PD     + RPV E N+ +G P F  L KL     ++   +I I+
Sbjct:   27 KYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKV--------TFNFK-DIKAHDEICQKFPLQCK-DCGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNR-EHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIK 508          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 169.088 bits (427), Expect = 3.957e-45
Identity = 124/493 (25.15%), Postives = 216/493 (43.81%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEI----------PNEIIKDRAIDREISNLEIRCLLNGCDHIGQFK-YLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSE--IHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRK------NGELEQ-----------------KIVEANDKNGTETKL------LKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLG-GGINSDEDVSIV--------EGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            ++ C +C ++L  P Q QCG RFC  C  +  +S    C  C+ E            +E   D A  REI++L  RCL  GCD  G  K Y   H   C++    C+ C     ++ K+ H   EC      C  C +        TF+   +++  D++C+    +C  +C  +        +H   C    + C   E+GC+ V     +S+H     + H+ +++  + ++ R       +GE ++                   V + D +   + L      L  E  +    +E+  H+ R+++ +IE + + I   +  L    +   E   +V        +GI +W + +   R  +A SG    + S  FY  + GY+  L++Y NGDG G+   LS++F++++ +YD  L+WPF +KV L L+  N   ++I    +PD     + RPV E N+ +G P F  L KL     ++   +I I+
Sbjct:   34 KYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKV--------TFNFK-DIKAHDEICQKFPLQCK-DCGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNR-EHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIK 515          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 151.754 bits (382), Expect = 1.675e-39
Identity = 114/447 (25.50%), Postives = 191/447 (42.73%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICP-NCQTEIPNEIIKDRAIDREISNLEIRCL--LNGCDHIGQFKYLDDHLRMCKWRLENCD--KCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIR 1523
            ++ C  C  +L  P QT+CG RFCYSCIN   +    +CP + +    ++I +D    REI  L++ C    NGC      + + DH+ +C +    C   KC +   ++    HL  +C      C  C  +M   E Q           + +C      CP  C S         +     K+ +  L     R + ++++  +   D   + ++ +  G R        LE ++   +D                        HE+R+ +  +     +  SY                  G  IW +R+ ++R  DA +G    + S+PFY    GY+   +VY NGDG GK   LS++F++++GEYD  L WPF +KV L L+      +++    KPD +   + RPV E N+ +G P FV+   +++S  +I   +I I+
Sbjct:   45 KYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADMEPLFKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCPLGKCKERMMRKEIPEHLAWKCKYRESTCEFCKNKMPLTELQKHK--------ETVCPAFPVSCPNHCTSSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLSALEQGGR------ASLETQLNRHDDMLSV--------------------HEIRLADMDLRFQVLETASYN-----------------GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMNIASGCPLFVS-QSVLESGTYIKDDTIFIK 439          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 150.214 bits (378), Expect = 3.546e-38
Identity = 117/547 (21.39%), Postives = 233/547 (42.60%), Query Frame = 3
Query:  135 QLGSLETRTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFAS---CGNICPNCQTEI-PNEIIKDRAIDREISNLEIRCLLNG-CDHIGQFKYLDDHLRMCKWRLENCDK--CPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEI-HNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRI----------NENQIEAIKSDINSYKEQLGGGINS---------------------DEDVSIVE---------------------------------GICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKE--FNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEMRSDSDSL 1553
            +L SL+   ++ +K ++ E   F+C  C  ++++P Q  CG  +C+ C+     S    G +CP  +  I P+E+ +D    REIS+LE+ C  +  C  +     L +HL+ C++    C    C +   +++ + HL   C +    C  C         Q F +++  + +   C  +   CP  C++ +  N +  H   CP   T C     GC   G +  +  H       H+ +V+    +L ++   ++++ +    +  T+T LL +   QL   ++  R +  I           E+ + +++ D+      +G G++                       E ++ +E                                 G  IW +++ ++R     +G    ++S PF+  + GY+ ++K Y NGDG+G+   LS+Y +++ G++D  L WPF + V+LS++  +    + S   +PD    C+ +P  E   N+  G P F++L  L    + ++     +  +++ D+  L
Sbjct:   48 ELASLQHSLKFVMK-LKEE---FICPICKGVVLNPQQNSCGHIYCFHCLQGLLESSLLSGPVCPVEKAAITPSEVFQDNCCKREISSLEVYCTNSPLCTSVLALNQLQEHLKSCQYEQLLCSNPGCTELLQRRLLQEHLNATCPHRRESCPHC--------LQPFQLSVIQDHVQSSCPEVKVGCPDGCSTLVPRNRLTEHGESCPEVHTDCSFKMFGCSVKGKRRKVKLHEEAAVCHHVLLVLKSSAHLEQQVVFVQKEALLRQQEVQTDTLLLSDLQEQLGSVLQQSRSQEHIVATAQRTLSRQEDALSSVQLDLQQVSCGMGSGLDELRRFKTSLDGVMQELLAAETLREHIATLEENRKRHSGLLELHVAQLALNKQHLQELELTSYDGRLIWKIKDFQKRREAEATGQHPCLSSVPFHTGRCGYKMAMKAYLNGDGEGRGTHLSLYVVLMPGDFDALLPWPFKQTVSLSVLDQSGARNHQSFNFRPDPTNTCFHQPAAESASNVAVGFPCFISLDALEAPGNAVYVKDDTLFVKVKVDTTGL 582          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 129.798 bits (325), Expect = 7.789e-32
Identity = 116/462 (25.11%), Postives = 206/462 (44.59%), Query Frame = 3
Query:  198 RFVCSKCHEILIDPSQ-TQCGCRFCYSCINKHFASCGNICPNCQTEIP-NEIIKDRAIDREISNLEIRCLLN--GCDHIGQFKYLDDHLRMCKWRLENC-DKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSG--------------KCPYE------CNSE-IHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENF--QLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIV-EGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLI----SSNALVQNISILMKPDSNMICYGRP------VKEFNLGAGQPEFVN 1466
            RF C  C + + +P Q + CG RFC +C+ +  +     CP  Q  +   +I  D  ++++I +L IRC+ +  GC   GQ K L  H   C + +  C ++C     ++    HLQ +C     KC  CG E T   ++        E +   CEN  G              +CP        C  E + + I+NH + CP    +C   + G   +  + D++ H+ D+  S   +V+   ++   K+    +  +  + ++ T++ L    N   + +++I  LR EM                            E++S+  +G+ IW + +  +++ +AK   + +  S PFY  + GY+  +  + NG+G G+   LS+Y  ++ GEYD+ L WPF  KV  S++     S +  Q+I+    PD N   + +P      + E  LG G P+F++
Sbjct:   15 RFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESV--YCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQC-PNQCGTPNIARE-DLANHVKDNCGS--ALVLCPFKDAGCKH-RCPKLAIGRHLEDTTKSHLTMMCNLVSRQRQEILELRREM----------------------------EELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFIS 441          
BLAST of TNF receptor-associated factor 2 vs. Planmine SMEST
Match: SMESG000018409.1 (SMESG000018409.1)

HSP 1 Score: 1011.91 bits (2615), Expect = 0.000e+0
Identity = 492/494 (99.60%), Postives = 493/494 (99.80%), Query Frame = 3
Query:  114 MLEINNIQLGSLETRTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEMRSDSDSLRHSNAFLQSVRKIK 1595
            MLEINNIQLGSLETRTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHL+MCKWRLENCDKC QTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEMRSDSDSLRHSNAFLQSVRKIK
Sbjct:    1 MLEINNIQLGSLETRTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLKMCKWRLENCDKCHQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEMRSDSDSLRHSNAFLQSVRKIK 494          
BLAST of TNF receptor-associated factor 2 vs. Planmine SMEST
Match: SMESG000018435.1 (SMESG000018435.1)

HSP 1 Score: 989.564 bits (2557), Expect = 0.000e+0
Identity = 480/493 (97.36%), Postives = 484/493 (98.17%), Query Frame = 3
Query:  117 LEINNIQLGSLETRTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEMRSDSDSLRHSNAFLQSVRKIK 1595
               + IQL S + RTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASC NICPNCQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGC+FVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEA DK+GTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEMRSDSDSLRHSNAFLQSVRKIK
Sbjct:    4 FTFSGIQLASFDKRTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCENICPNCQTEIPNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCQFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEAKDKDGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEMRSDSDSLRHSNAFLQSVRKIK 496          
BLAST of TNF receptor-associated factor 2 vs. Planmine SMEST
Match: SMESG000018404.1 (SMESG000018404.1)

HSP 1 Score: 354.755 bits (909), Expect = 5.680e-116
Identity = 176/442 (39.82%), Postives = 275/442 (62.22%), Query Frame = 3
Query:  225 ILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEI-PNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGG-GINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEMRSDS 1544
            + I+P QT+CGCRFCY+CI  +  +  + CPNC  EI  N+ I+D+A+++EI N +I+C    CD I   K L +H   C++R++ CD C Q Y  + KE H+ E C   I  C +C  +MT ++++  H NI +  ID LC+     CP  C++     I+ HL +CPN    C    +GC       +++KHL  ++  H T +M  +  L  +N  L+  +   N     E +L+K  N  L K +E L+ ++  NE+ I  IKS++   K+ +    IN++  +++V G  +W + N+RQ+I  AKSG   QI S+PFY  +PGYR  LK+YPNGDG GKD++LS+YF+I++GEYDDE+ WPF +KV+LS++SS +  QNI++ MKPD+N+ CYG+P+   N+GAGQPEF+ L +L+ S D++H  SI++  ++++ +
Sbjct:    7 VFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHQIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDECQQQMTSNDHEINHRNIEMG-IDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQVNCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHYAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGTGKDKYLSVYFMIVQGEYDDEIAWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTST 447          
BLAST of TNF receptor-associated factor 2 vs. Planmine SMEST
Match: SMESG000039089.1 (SMESG000039089.1)

HSP 1 Score: 235.343 bits (599), Expect = 4.852e-70
Identity = 133/430 (30.93%), Postives = 221/430 (51.40%), Query Frame = 3
Query:  207 CSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPNEIIK---DRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQ--LKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINS-DEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKL 1478
            C  C E+L++  QT CGCR+C  CI  H  +       C T+  + II    D AI++EI  L ++CL +GC+H    K + DHL  C++    C+KC    P +M   HL ++CV  + KC  C   M       FH+++     D +C  L  KCPY C+     N+  H  +C  K  +C   ELGC  V     +S H+  +  +H+  ++     + ++   LE K++E+     ++T  L+  NFQ  +  +I ++      + +   +    + S    +   + S DE ++   G+ IW V +  +   +A+ G    +TS+PFY ++ GY+ S+K+YP GDG GK   LS++F ++KG++DD L WPF  KV L+++       + S   KPD    CY +P +E+N+ +G P+F++  +L
Sbjct:   30 CVICSELLLNAMQTDCGCRYCQKCIEDHLVNSRQ----CSTKGCSTIISTMPDNAINKEIGKLMVKCLYDGCNHEEMLKDIGDHLNSCEYLTVVCEKCKLEMPGKMLPNHLLKDCVKRVVKCLNCESRMEYEILMKFHLDLYA---DNICPKLVDKCPYGCDIVGAVNLLAHRKECVKKPVRCPFVELGCSKVLTNQQLSDHMKTEFPAHIRTLVEEFIKMKKEITSLETKLIES-----SKTIKLELSNFQNEISTKISNIDQMSNSSLSLQSSSSLTLQSSASSMANILKSNDEKINYRNGVFIWKVEHFPELKANAERGNRISVTSEPFYTKEFGYKMSMKIYPAGDGVGKSTHLSVFFTLMKGDFDDLLVWPFKNKVTLTILDQKNKTSDYSDTFKPDPRSTCYQQPTEEYNIASGSPKFISFTQL 447          
BLAST of TNF receptor-associated factor 2 vs. Planmine SMEST
Match: SMESG000027153.1 (SMESG000027153.1)

HSP 1 Score: 211.46 bits (537), Expect = 4.390e-61
Identity = 136/476 (28.57%), Postives = 232/476 (48.74%), Query Frame = 3
Query:  138 LGSLETRTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEIPN-------EIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVG-NQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEE-NFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGGGINSDEDVSIV--EGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEM 1532
            L  + T  E +  N      R  C  C  IL +  QT CGC+ C +CI  + A+    CP+ Q +  N       +I  D A ++EI++L+++C    C      + + +H+  C++R  +C+KC      + KE H + +C     KC  C  EM+  + ++ H+N + E     C   +  CP  C+      ++ HL  C  K  +C  + L C      + ++ KHL+++ VSH +       NL+ K  ++E  I    D+   +  L KE  +   K  +  L+      +  IE +K+      +     I + E+ S++      IW   +   +  DA+SG    +TS PFY  + GY+  L++YP GDG GK   LS++F I+KGE+DD L WPF +KV LS++   A  ++ S   KPD+   CY +PV E N+ +G P+F+ L  ++++  +  + +I ++  +
Sbjct:    5 LSQIPTILELYEFNFPSLSDRLKCVLCQRILKNAKQTSCGCKACENCIKSYLANGPKPCPSKQIDCENVMLHMDEDINADNATNKEIASLKVKCPFKLCSSEMPLRNMVEHINSCEFREISCNKCQSKLQAKDKESHDKNKCEMRKLKCEYCLEEMSFRDLKSIHLNSDRE---DFCVKYTAICPNNCDVHTKVCLKEHLKLCSKKKLECPFHSLNCNVDKMTKENLMKHLNEEYVSHTS-------NLISKIKDMENTIKNLTDELENQKVLTKELLDMNKKSSLSVLK-----TQETIEKLKT------KSFPTPIQAVENKSVIFRNATFIWKFTDFESKRIDAESGRKVSVTSDPFYTSEFGYKMCLRIYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSIMDQEAGTKHHSDTFKPDARSACYQKPVDECNIASGSPKFILLSLIMNNSLYCKNDTIYLKIAV 459          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF38.464e-4425.14TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF38.464e-4425.14TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF22.304e-3924.85TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF52.527e-3726.68TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF52.527e-3726.68TNF receptor associated factor 5 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-11.136e-3326.54TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-23.268e-822.86TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf49.970e-2221.21gene:FBgn0026319 transcript:FBtr0334401[more]
Traf41.171e-2121.21gene:FBgn0026319 transcript:FBtr0077429[more]
Traf63.858e-920.13gene:FBgn0265464 transcript:FBtr0071188[more]
Traf-like5.698e-631.65gene:FBgn0030748 transcript:FBtr0308606[more]
Traf-like5.698e-631.65gene:FBgn0030748 transcript:FBtr0074274[more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf33.796e-4825.48TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf2b7.166e-4425.80Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b7.166e-4425.80Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b8.325e-4425.75Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf12.432e-3723.74TNF receptor-associated factor 1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl25.627e-3725.15synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
slc12a14.113e-3625.82solute carrier family 12 member 1 [Source:Xenbase;... [more]
ssh27.665e-3524.66slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
slc12a11.269e-3425.35solute carrier family 12 member 1 [Source:Xenbase;... [more]
ssh21.628e-3224.67slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf27.048e-4225.66TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf26.240e-4025.45TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf52.252e-3926.24TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf52.252e-3926.24TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf61.776e-3624.95TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13114|TRAF3_HUMAN4.065e-4325.14TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|P39429|TRAF2_MOUSE4.930e-4125.66TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|P70191|TRAF5_MOUSE3.026e-3926.55TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN1.106e-3824.85TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|A7XUJ6|TRAF6_PIG1.639e-3826.58TNF receptor-associated factor 6 OS=Sus scrofa OX=... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1DF653.007e-9134.12TRAF-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1D1222.572e-8631.74TRAF-5 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
D5JG606.840e-6530.19TNF receptor-associated factor-2-like protein B OS... [more]
T1DBK62.121e-6030.11TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A3P9LMP43.480e-4826.69TNF receptor-associated factor OS=Oryzias latipes ... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf11.509e-4023.39TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf2b3.941e-4024.30TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf13.637e-3923.98TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf2a3.868e-3723.90TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf4a4.291e-3324.26TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002130.19.312e-2724.26pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.18.293e-2635.66pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf61.954e-2220.28TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.12.841e-2122.66pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO483945.947e-3624.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494642.690e-3523.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388731.534e-3325.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487731.334e-3024.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495453.152e-3024.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b2.699e-4525.15TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b3.957e-4525.15TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf31.675e-3925.50TNF receptor associated factor 3 [Source:NCBI gene... [more]
ENSORLT00000001369.23.546e-3821.39TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf4a7.789e-3225.11TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018409.10.000e+099.60SMESG000018409.1[more]
SMESG000018435.10.000e+097.36SMESG000018435.1[more]
SMESG000018404.15.680e-11639.82SMESG000018404.1[more]
SMESG000039089.14.852e-7030.93SMESG000039089.1[more]
SMESG000027153.14.390e-6128.57SMESG000027153.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007410 ID=SMED30007410|Name=TNF receptor-associated factor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1947bp
AAAAAATCAAATTTTAAATATTTTTTTATTAACGGATATTTTCATTTTTT
ACATGATTTAACGGTTAAATTTTAACCTAACTATATCAAATTTCTAAAAA
ACAAAAAATTTAAATGTTGGAAATCAATAACATTCAATTGGGTTCACTTG
AGACAAGAACGGAATATTTTATTAAAAATATTAGACTTGAGTGTCCAAGA
TTTGTTTGTTCAAAATGTCACGAAATCCTAATCGATCCATCTCAAACTCA
GTGTGGATGTCGTTTTTGCTATAGCTGTATTAACAAACATTTTGCATCAT
GTGGAAATATTTGTCCTAACTGTCAAACCGAAATCCCTAATGAAATTATT
AAGGATCGCGCAATTGACCGGGAAATATCAAATTTAGAAATAAGATGTCT
TCTAAATGGATGTGATCACATCGGGCAATTTAAATATCTAGACGACCATT
TGAGAATGTGTAAATGGCGTTTGGAGAACTGTGATAAATGTCCCCAAACA
TATCCTAAGCAAATGAAAGAAATTCACCTACAAGAAGAATGTGTAAACGG
AATTTGTAAATGCAGTAAATGTGGGTTAGAAATGACAAGACATGAATATC
AAACCTTCCATGTCAATATCAATGTTGAATGCATTGATAAATTATGTGAA
AATTTGAGCGGGAAATGTCCCTATGAATGCAACAGTGAAATTCATAACAA
TATCAGAAATCATTTATATGATTGCCCGAATAAAGTAACAAAATGCTTTC
TCTATGAACTTGGATGTCGATTCGTAGGAAATCAAGTGGATATGTCGAAG
CATTTGTCAGATGATAATGTTAGTCACATGACAATTGTGATGAGTGGAAT
GAGGAATTTAATGAGAAAAAATGGAGAATTAGAGCAAAAAATCGTCGAGG
CCAATGATAAAAATGGAACAGAAACCAAATTATTAAAAGAAGAAAATTTT
CAGTTGAAAAAGCAAATTGAAAGTTTGCGACATGAAATGAGAATCAATGA
GAATCAAATTGAAGCTATCAAATCAGATATCAATTCGTACAAGGAACAAC
TCGGAGGAGGAATAAATAGCGATGAGGACGTTTCGATTGTAGAAGGAATT
TGCATCTGGACAGTGAGGAATGTTCGTCAGAGAATCACTGATGCCAAATC
TGGATTCGACACGCAAATTACCAGCAAGCCTTTTTATCTCCGCCAGCCCG
GATATCGATTCAGTTTGAAAGTCTACCCGAACGGTGACGGCCAAGGGAAA
GACCGATTTCTATCGATCTATTTCATAATAATCAAGGGCGAATATGACGA
TGAGCTCCGCTGGCCATTCATTGAGAAAGTGAATTTGAGTTTAATTAGCA
GCAACGCGCTCGTGCAAAATATATCGATTCTCATGAAACCCGACAGCAAT
ATGATTTGCTACGGGCGACCGGTGAAGGAATTTAATTTGGGGGCGGGCCA
GCCGGAATTTGTCAATTTGGGGAAATTGATCGACTCGGATGATTTCATTC
ATTCCGGATCGATACGGATCCGGTTTGAGATGAGATCCGACAGCGATTCG
TTGCGTCATAGCAACGCATTTTTGCAGAGTGTCAGGAAAATTAAATAAAT
CAATTGCTGTTTTTTATTGGATTGCTTTCGGATTTATTATTTTAAATTAG
CTTTATGTTGTGATAATTATTATTTTATTGTGTCTAACTGTTGCTAGGCG
GTTTCAGCGTAGTGATTTATGCTAGTGATTCAAATGTAATGAAAAATTAA
AGTTTTGTAATGAATAATTTCTTTCCGGTGATTAATTTATGTTTAATTAT
GATCAAATTTCACATATTCATTGATTTCTAAGTATATATGTTATGTAATA
ATTTATGTTTGAAATGTTTCGTTAAAAAGTATGTATTTCACTTGCAATCA
CGGAAACCTGGGATAAGAGGAAATCAGTTAAATCTAGAGATCGGAAG
back to top

protein sequence of SMED30007410-orf-1

>SMED30007410-orf-1 ID=SMED30007410-orf-1|Name=SMED30007410-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=495bp
MLEINNIQLGSLETRTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCR
FCYSCINKHFASCGNICPNCQTEIPNEIIKDRAIDREISNLEIRCLLNGC
DHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKC
SKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNH
LYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLM
RKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIE
AIKSDINSYKEQLGGGINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDT
QITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRW
PFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFV
NLGKLIDSDDFIHSGSIRIRFEMRSDSDSLRHSNAFLQSVRKIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR012227TNF_rcpt-assoc_TRAF_met
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR002083MATH/TRAF_dom
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0042981regulation of apoptotic process
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 226..246
NoneNo IPR availableCOILSCoilCoilcoord: 251..292
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 9..454
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 8..70
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 6..107
e-value: 1.9E-17
score: 65.3
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 249..455
e-value: 1.5E-40
score: 140.9
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 164..231
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 307..453
IPR012227TNF receptor-associated factor TRAF, metazoaPIRSFPIRSF015614TRAFcoord: 4..459
e-value: 2.5E-79
score: 264.9
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 9..454
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 307..453
score: 17.348
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 12..51
score: 10.011