Peptidase S1 domain-containing protein

Overview
NamePeptidase S1 domain-containing protein
Smed IDSMED30007408
Length (bp)1116
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase S1 domain-containing protein (SMED30007408) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase S1 domain-containing protein (SMED30007408) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase S1 domain-containing protein (SMED30007408) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase S1 domain-containing protein (SMED30007408) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007408

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30007408SMESG000055023.1 dd_Smed_v4_2492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007408SMESG000055023.1 dd_Smed_v4_2492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30007408SMESG000055023.1 dd_Smed_v4_2492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007408SMESG000055023.1 dd_Smed_v4_2492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007408SMESG000055023.1 Contig45000uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007408SMESG000055023.1 Contig45000newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007408SMESG000055023.1 Contig38419uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007408SMESG000055023.1 Contig38419newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30007408SMESG000055023.1 OX_Smed_1.0.21995ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: KLKB1 (kallikrein B1 [Source:HGNC Symbol;Acc:HGNC:6371])

HSP 1 Score: 193.356 bits (490), Expect = 2.882e-55
Identity = 107/265 (40.38%), Postives = 148/265 (55.85%), Query Frame = 1
Query:  238 NKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFE--PHEKYPTLSTNPEIWTVRVGEHDM--LKQDIPHVDVEVQKIYIHYKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITK 1020
             K   RIVGG  +  GEWPW VSL V+L    + HLCGG+LI  QWVLTAAHCF+  P +         ++W +  G  ++  + +D P   ++   I+ +YK ++ N +DIAL+KL+ P+  TE+    CLP+  +   I   C+  GWG   E    I  ILQ V +P+V N +C   Y   +          I   MVCAG  EGGKDAC+ DSGGPL+CK N  W + GI S+G GC +   PG+YT+V  ++ WI   T+
Sbjct:  385 TKTSTRIVGGTNSSWGEWPWQVSLQVKLTA--QRHLCGGSLIGHQWVLTAAHCFDGLPLQ---------DVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGN-HDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKG-EIQNILQKVNIPLVTNEECQKRYQDYK----------ITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQ 626          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: KLKB1 (kallikrein B1 [Source:HGNC Symbol;Acc:HGNC:6371])

HSP 1 Score: 192.586 bits (488), Expect = 7.946e-55
Identity = 107/264 (40.53%), Postives = 148/264 (56.06%), Query Frame = 1
Query:  241 KMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFE--PHEKYPTLSTNPEIWTVRVGEHDM--LKQDIPHVDVEVQKIYIHYKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITK 1020
            K   RIVGG  +  GEWPW VSL V+L    + HLCGG+LI  QWVLTAAHCF+  P +         ++W +  G  ++  + +D P   ++   I+ +YK ++ N +DIAL+KL+ P+  TE+    CLP+  +   I   C+  GWG   E    I  ILQ V +P+V N +C   Y   +          I   MVCAG  EGGKDAC+ DSGGPL+CK N  W + GI S+G GC +   PG+YT+V  ++ WI   T+
Sbjct:  434 KTSTRIVGGTNSSWGEWPWQVSLQVKLTA--QRHLCGGSLIGHQWVLTAAHCFDGLPLQ---------DVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGN-HDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKG-EIQNILQKVNIPLVTNEECQKRYQDYK----------ITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQ 674          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: TMPRSS3 (transmembrane serine protease 3 [Source:HGNC Symbol;Acc:HGNC:11877])

HSP 1 Score: 180.259 bits (456), Expect = 7.099e-52
Identity = 102/262 (38.93%), Postives = 143/262 (54.58%), Query Frame = 1
Query:  247 QKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLN--YGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKK 1023
              RIVGG  +   +WPW  SL  +       HLCGG++I+  W++TAAHC   ++ Y      P+ WT++VG   +L  D P     V+KI  H K +     NDIALMKL  P+T  E     CLPN +EN    ++C+ +GWG   +     S +L H AVP+++N+ CN    YG +           I  +M+CAG   GG D+CQ DSGGPL+C++   W + G  SFG GC +   PG+YTRV SF+ WI    ++
Sbjct:  214 SSRIVGGNMSLLSQWPWQASLQFQ-----GYHLCGGSVITPLWIITAAHCV--YDLYL-----PKSWTIQVGLVSLL--DNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGI-----------ISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMER 450          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: PRSS27 (serine protease 27 [Source:HGNC Symbol;Acc:HGNC:15475])

HSP 1 Score: 175.637 bits (444), Expect = 7.103e-52
Identity = 108/288 (37.50%), Postives = 152/288 (52.78%), Query Frame = 1
Query:  193 FDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHV------DVEVQKIYIHYKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAIST-ILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF*FH 1035
            F    AK      +P +M  R+VGG  T++GEWPW VS+          H CGG+LI+ QWVLTAAHCF         ++   ++ V +G   ++ Q  PH        VE   +Y    +   +S D+AL++L+ P+  T Y    CLP+     +    C+  GWG  +E D      ILQ +AVPI+    CNL Y +  T+ G Q    I++ M+CAG +EG KDAC+ DSGGPL+C     WL +G+IS+G GC +   PG+Y RV +  +WI  I  K  F 
Sbjct:   15 FGSQRAKAATACGRP-RMLNRMVGGQDTQEGEWPWQVSIQRN-----GSHFCGGSLIAEQWVLTAAHCFRN-------TSETSLYQVLLGARQLV-QPGPHAMYARVRQVESNPLY----QGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSK-DTEFGYQ-PKTIKNDMLCAGFEEGKKDACKGDSGGPLVCLVGQSWLQAGVISWGEGCARQNRPGVYIRVTAHHNWIHRIIPKLQFQ 282          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: TMPRSS3 (transmembrane serine protease 3 [Source:HGNC Symbol;Acc:HGNC:11877])

HSP 1 Score: 179.104 bits (453), Expect = 2.134e-51
Identity = 103/262 (39.31%), Postives = 144/262 (54.96%), Query Frame = 1
Query:  247 QKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLN--YGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKK 1023
              RIVGG  +   +WPW  SL  +       HLCGG++I+  W++TAAHC   ++ Y      P+ WT++VG   +L  D P     V+KI  H K +     NDIALMKL  P+T  E     CLPN +EN    ++C+ +GWG   +   A S +L H AVP+++N+ CN    YG +           I  +M+CAG   GG D+CQ DSGGPL+C++   W + G  SFG GC +   PG+YTRV SF+ WI    ++
Sbjct:  212 SSRIVGGNMSLLSQWPWQASLQFQ-----GYHLCGGSVITPLWIITAAHCV--YDLY-----LPKSWTIQVGLVSLL--DNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGGDA-SPVLNHAAVPLISNKICNHRDVYGGI-----------ISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMER 447          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-1 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q23528])

HSP 1 Score: 149.443 bits (376), Expect = 4.033e-42
Identity = 105/330 (31.82%), Postives = 155/330 (46.97%), Query Frame = 1
Query:   31 IFLGLVVILTSVSTDKESQLVMDPDAEAIDFIVKRNFLKKSYDSEVKTHCGRNRFDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIR-EICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIE-DTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQ 1008
            IFL LV ++  VSTD ++           D I K      S + E+     + R  +  A Y+        +  R++GG  +    WPW V L+ RL      H CGG+LI   +VLTAAHCF    +       P  ++VRVG H       PH    V  + IH  Y     +S D A+M++  P+  +  A   CLP+L   P +   +C   GWG   E  +  +  L+ + VP+++   C+           P Y   I   +M+CAG   G  D+CQ DSGGPLMC ++  W ++G++S+G GC +   PG+Y  V S  +WI 
Sbjct:    5 IFLLLVGVINKVSTDNKN-----------DVIEKVGCGLHSTNVELA----QTRSAQEPADYVT-------LDHRLIGGSESSPHSWPWTVQLLSRLGH----HRCGGSLIDPNFVLTAAHCFAKDRR-------PTSYSVRVGGHRS-GSGSPH---RVTAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPICLPSL---PAVENRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSL---------PNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWIN 285          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: svh-1 (HGF/MSP/plasminogen-like protein [Source:UniProtKB/TrEMBL;Acc:Q17800])

HSP 1 Score: 137.887 bits (346), Expect = 2.093e-35
Identity = 85/256 (33.20%), Postives = 132/256 (51.56%), Query Frame = 1
Query:  253 RIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTNSNDIALMKLKDP-ITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNN-QWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNI 1014
            R+VGG  T  G +PW  +L  +     K H CG +++ +  ++TAAHCFE  E+  +       + V VG+ D  + D       +Q+I+ +    D  S+DIA++++  P I   EYA   CLP+ D        C  +GWG         +  LQ   +PI+   DC +N  Q+ + +          +  CAG  EGG D+CQ DSGGP  C++ +  ++++G+IS+G GC +   PGIYT V  ++SWI  I
Sbjct:  712 RVVGGFETVPGAFPWTAALRNK---ATKAHHCGASILDKTHLITAAHCFEEDERVSS-------YEVVVGDWDNNQTDGNEQIFYLQRIHFYPLYKDIFSHDIAILEIPYPGIEFNEYAQPICLPSKDFVYTPGRQCVVSGWGSMG---LRYAERLQAALIPIINRFDC-VNSSQIYSSM--------SRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWISAI 945          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 74.7146 bits (182), Expect = 7.742e-15
Identity = 75/271 (27.68%), Postives = 120/271 (44.28%), Query Frame = 1
Query:  253 RIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTD-TNSNDIALMKLKDPITLTEYANAACLPNLD-------ENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNN-QWLVSGIISFGFG-----CGKAYYPGIYTRVPSFISWIQNITKK 1023
            RI+GG +   G   W+  L+     G  I LCG T+I   W++TAAHC         L T   ++ VR  +++  +         V++ YIH    + T  NDIAL+++   ++        CL + D       +N  +       G     E     S  LQ  +VPI+++ DC   +  L        ++ I    +CAG    G      DSGGPL+  K+N +++  GI S+G         +  +PG+YTR+  ++ WIQ +  K
Sbjct:   37 RIIGGNSIDDGA-NWMAKLVSYGDNGQGI-LCGATVIDDFWLVTAAHC------ALQLQTRSFVY-VREPKNNRERS------FSVKEAYIHSGYNNQTADNDIALLRISSDLSKLG-IKPVCLVHDDSKLLKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSL-----LSVKITGYQICAGAYLHG--TAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWIQGVIGK 284          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 69.707 bits (169), Expect = 2.228e-13
Identity = 66/241 (27.39%), Postives = 107/241 (44.40%), Query Frame = 1
Query:  343 LCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTD-TNSNDIALMKLKDPITLTEYANAACLPNLD-------ENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNN-QWLVSGIISFGFG-----CGKAYYPGIYTRVPSFISWIQNITKK 1023
            LCG T+I   W++TAAHC         L T   ++ VR  +++  +         V++ YIH    + T  NDIAL+++   ++        CL + D       +N  +       G     E     S  LQ  +VPI+++ DC   +  L        ++ I    +CAG    G      DSGGPL+  K+N +++  GI S+G         +  +PG+YTR+  ++ WIQ +  K
Sbjct:   15 LCGATVIDDFWLVTAAHCAL------QLQTRSFVY-VREPKNNRERS------FSVKEAYIHSGYNNQTADNDIALLRISSDLSKLG-IKPVCLVHDDSKLLKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSL-----LSVKITGYQICAGAYLHG--TAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWIQGVIGK 234          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-5 (TRYpsin-like protease; Trypsin-like serine protease [Source:UniProtKB/TrEMBL;Acc:O01887])

HSP 1 Score: 64.3142 bits (155), Expect = 3.112e-11
Identity = 72/254 (28.35%), Postives = 109/254 (42.91%), Query Frame = 1
Query:  292 PWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPH-------EKYPTLS----------TNPEIWT---VRVGEH-DMLKQDIPHVD-------VEVQKIYI--HYKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDE-NPKIREICFAAGWGHK--NENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNN--QWLVSGIISFGFGC 948
            PW V + V+ + G    +CGGTLI+ + VLTAAHCF+ H        +  ++S          T+ EI T   V VG     L+Q    V+       +++ +  I   YK      NDI +++L+  I   E AN ACLP L E N +      + GWG       D A   ++Q + +       C  N+G             I     C   +E  K+ C  DSGG L   +++  +  +  I+S+G  C
Sbjct:   55 PWAVQIRVKARKGDFEVICGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGAMCTRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHCEQGNDIVILELESTIDDVEGANYACLPFLPEVNIQSGANVTSFGWGSDPGKGFDNAAFPMIQVLTLATETLATCEENWGT-----------SIPFDSFCT-AEEEDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYGSDC 296          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: CG10663 (gene:FBgn0036287 transcript:FBtr0346570)

HSP 1 Score: 159.458 bits (402), Expect = 7.854e-43
Identity = 87/259 (33.59%), Postives = 131/259 (50.58%), Query Frame = 1
Query:  253 RIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMC----KKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNI 1014
            +I+GG   ++GEWPW V+++ R K       CGGTLI+ +WVLTAAHC              ++  VR+GEH++  +D   + + V K Y H      T  +D+AL++L   +  T +   +CLP   +       C   GWG +   D   +++L    VPI+  ++C   Y          Y   I   M CAG  +G  D C  DSGGPL+C    K N+ W + GI SFG GC +    GIY +VP+++ W+ ++
Sbjct:  506 KIIGGRAARKGEWPWQVAILNRFKEAF----CGGTLIAPRWVLTAAHCVR------------KVLFVRIGEHNLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVY----------YDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSV 738          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: CG10663 (gene:FBgn0036287 transcript:FBtr0113167)

HSP 1 Score: 159.458 bits (402), Expect = 7.854e-43
Identity = 87/259 (33.59%), Postives = 131/259 (50.58%), Query Frame = 1
Query:  253 RIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMC----KKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNI 1014
            +I+GG   ++GEWPW V+++ R K       CGGTLI+ +WVLTAAHC              ++  VR+GEH++  +D   + + V K Y H      T  +D+AL++L   +  T +   +CLP   +       C   GWG +   D   +++L    VPI+  ++C   Y          Y   I   M CAG  +G  D C  DSGGPL+C    K N+ W + GI SFG GC +    GIY +VP+++ W+ ++
Sbjct:  506 KIIGGRAARKGEWPWQVAILNRFKEAF----CGGTLIAPRWVLTAAHCVR------------KVLFVRIGEHNLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVY----------YDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSV 738          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: CG18735 (gene:FBgn0042098 transcript:FBtr0071744)

HSP 1 Score: 152.14 bits (383), Expect = 2.177e-42
Identity = 99/270 (36.67%), Postives = 143/270 (52.96%), Query Frame = 1
Query:  223 NINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTN-SNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDC-NLNYGQLRTQLGPQYALDIEDTMVCAG-VDEGGKDACQFDSGGPL-MCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITK 1020
            NIN     + RIVGG  T+  E+PW++ LM           CG +L++ Q+ LTAAHC               + TVR+ EH+     +  VD  V ++ IH K +  N  +DIAL++  +P+ L    +  C+P   EN    +     GWG  +E    IS  LQ V VPI++  +C N NYG+ +          I D M+CAG V++GGKD+CQ DSGGP+ +    + + ++GI+S+G GC K   PG+YTRV SF  WI   T+
Sbjct:   76 NINT----RHRIVGGQETEVHEYPWMIMLMW-----FGNFYCGASLVNDQYALTAAHCVNGFYH--------RLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN-YAGQTAVVTGWGALSEGG-PISDTLQEVEVPILSQEECRNSNYGESK----------ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: tpr (gene:FBgn0034661 transcript:FBtr0071743)

HSP 1 Score: 152.14 bits (383), Expect = 3.153e-42
Identity = 93/263 (35.36%), Postives = 141/263 (53.61%), Query Frame = 1
Query:  244 MQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTN-SNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPL--MCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKK 1023
            +QKRIVGG  T+  ++PW+  L+     G + + C  +L++ Q++LTA+HC     K        E  +VR+ EHD     +  +D +V ++  H K    N  NDIA++KL +P+   E  +  C+P    + K  E     GWG         S  LQ V VPI++  +C  +          +Y   I D M+C G DEGGKD+CQ DSGGPL  +     +  ++G++S+G GC KA YPG+Y RV  + +WI+N+TK+
Sbjct:  123 IQKRIVGGQETEVHQYPWVAMLLY----GGRFY-CAASLLNDQFLLTASHCVYGFRK--------ERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFK-GENGIVTGWGALKVGGPT-SDTLQEVQVPILSQDECRKS----------RYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQ 360          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: Corin (gene:FBgn0033192 transcript:FBtr0088909)

HSP 1 Score: 157.532 bits (397), Expect = 6.350e-42
Identity = 99/290 (34.14%), Postives = 141/290 (48.62%), Query Frame = 1
Query:  238 NKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREI-----CFAAGWGHKNEND--TAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCK---KNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF*FHSNSIDDLRVNEF 1071
            +K  +RI+GG     G WP+L +++   +   KI  C G LIS QWVLTA+HC      Y  +    E WT+++G             V+V+ +  H  Y     + NDIAL +L   +   E+    CLP     P +R +     C   GWG + + D  +    I+  V VPI+    C+     L           + + MVCAG D+GGKDACQ DSGGPL+C    + N+W V GI+S+G  C     PG+Y  V  ++ WIQ    K   HS  I + RVN++
Sbjct: 1098 HKPSRRIIGGTQASPGNWPFLAAILGGPE---KIFYCAGVLISDQWVLTASHCVG---NYSVIDL--EDWTIQLGVTRRNSFTYSGQKVKVKAVIPHPQYNMAIAHDNDIALFQLATRVAFHEHLLPVCLPP----PSVRNLHPGTLCTVIGWGKREDKDPKSTYEYIVNEVQVPIITRNQCDEWLDNL----------TVSEGMVCAGFDDGGKDACQGDSGGPLLCPYPGEKNRWFVGGIVSWGIMCAHPRLPGVYANVVQYVPWIQEQIAK---HSRPIKEDRVNKY 1362          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:112038 (zgc:112038 [Source:ZFIN;Acc:ZDB-GENE-050522-271])

HSP 1 Score: 175.252 bits (443), Expect = 1.136e-51
Identity = 95/251 (37.85%), Postives = 140/251 (55.78%), Query Frame = 1
Query:  262 GGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQN 1011
            GG     G WPW  S+  R+ P  + H+CGG+LI++ WVL+AAHCF       T + N +I+   +G       +   +   + KI IH    T T +NDIAL++L   +T T+Y    CL + D         +  GW     +D  ++ +L+ V +P+V+N +CN +Y  +           I D M+CAG++EGGKDACQ DSGGP++ +  ++W+ SGI+SFG  CG   YPGIYTRV  + SWI +
Sbjct:   37 GGDDVVAGSWPWQASIH-RISP--EDHICGGSLINKDWVLSAAHCF-----MITATANIKIY---LGRQFQTGSNPNEISRTLTKIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLASADSVFAGGTKSWITGWDKHRSSDIQVTNVLREVQLPVVSNTECNADYKGI-----------ITDNMICAGINEGGKDACQGDSGGPMVSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITS 265          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-16l2.17 (si:dkey-16l2.17 [Source:ZFIN;Acc:ZDB-GENE-141212-262])

HSP 1 Score: 174.096 bits (440), Expect = 1.267e-51
Identity = 97/254 (38.19%), Postives = 137/254 (53.94%), Query Frame = 1
Query:  244 MQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCF-EPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTD-TNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAI-STILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCK-KNNQWLVSGIISFGFGCGKAYYPGIYTRVPSF 993
            + KRIVGGV    G WPW V + +    G   H+CGG++I++ WVL+AAHCF  P E           +T+ +G H +   +       VQ++ I    TD     D+AL++L+ P++ T+     CLP  D       +C+  GWGHK E  +   +  L+ V VPI+    C   Y  L +       +DI   M+CAG  EGGKD+CQ DSGGPL+C   N  W+ +G++SFG GC +   PGIY+RV SF
Sbjct:    1 LGKRIVGGVEASPGSWPWQVDIQM----GSNGHVCGGSIIAKNWVLSAAHCFPNPSEV--------SAYTLYMGRHLLNGYNQFEKVSYVQRVVIPEGYTDPQGGRDVALVQLRAPVSWTDRIQPVCLPFADFQFNSGTLCYVTGWGHKQEGVSLTGAAALREVEVPIIDQSSCQFMYQILSSD---SSTVDILSDMICAGYKEGGKDSCQGDSGGPLVCPVGNGTWIQAGVVSFGLGCAQKNRPGIYSRVSSF 239          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-16l2.17 (si:dkey-16l2.17 [Source:ZFIN;Acc:ZDB-GENE-141212-262])

HSP 1 Score: 174.096 bits (440), Expect = 3.617e-51
Identity = 97/254 (38.19%), Postives = 137/254 (53.94%), Query Frame = 1
Query:  244 MQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCF-EPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTD-TNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAI-STILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCK-KNNQWLVSGIISFGFGCGKAYYPGIYTRVPSF 993
            + KRIVGGV    G WPW V + +    G   H+CGG++I++ WVL+AAHCF  P E           +T+ +G H +   +       VQ++ I    TD     D+AL++L+ P++ T+     CLP  D       +C+  GWGHK E  +   +  L+ V VPI+    C   Y  L +       +DI   M+CAG  EGGKD+CQ DSGGPL+C   N  W+ +G++SFG GC +   PGIY+RV SF
Sbjct:   28 LGKRIVGGVEASPGSWPWQVDIQM----GSNGHVCGGSIIAKNWVLSAAHCFPNPSEV--------SAYTLYMGRHLLNGYNQFEKVSYVQRVVIPEGYTDPQGGRDVALVQLRAPVSWTDRIQPVCLPFADFQFNSGTLCYVTGWGHKQEGVSLTGAAALREVEVPIIDQSSCQFMYQILSSD---SSTVDILSDMICAGYKEGGKDSCQGDSGGPLVCPVGNGTWIQAGVVSFGLGCAQKNRPGIYSRVSSF 266          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:153968 (zgc:153968 [Source:ZFIN;Acc:ZDB-GENE-061027-211])

HSP 1 Score: 171.4 bits (433), Expect = 3.031e-50
Identity = 100/262 (38.17%), Postives = 135/262 (51.53%), Query Frame = 1
Query:  244 MQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDT--NSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKK 1023
            ++ RI+GG T   G WPW VS+      GL   LCGGTLI+R+WVL+AA CF+                V +G    L    P+V        I++ + D+  N NDIAL+KL  P++ T+Y    CL     +     + +  GWG  N   T   T LQ V +P+V+N DC   YG L           I D M+CAG +EGGK  C  D GGPL+   + QW+ SGI SFG GC +   PG++TRV  + SWI++   K
Sbjct:   34 LKPRIIGGQTAMAGSWPWQVSIHYIPTGGL---LCGGTLINREWVLSAAQCFQ--------KLTASNLVVHLGH---LSTGDPNVIHNPASQIINHPKYDSAKNKNDIALLKLSTPVSFTDYIKPVCLTASGSSLGKGAVSWITGWGSINTGGTQFPTTLQEVKIPVVSNGDCKSAYGSL-----------ITDGMICAGPNEGGKGICVGDGGGPLVHNSSEQWIQSGIASFGRGCAQPKNPGVFTRVSEYESWIKSQISK 270          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:123295 (zgc:123295 [Source:ZFIN;Acc:ZDB-GENE-051127-11])

HSP 1 Score: 170.629 bits (431), Expect = 8.447e-50
Identity = 94/260 (36.15%), Postives = 134/260 (51.54%), Query Frame = 1
Query:  244 MQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTD-TNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGV-DEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNIT 1017
            +  +IVGG     G WPW VSL     P    H CGG+LI++ WVL+AAHCF+  +   T+        V++G       +   +   V ++  H    + +N NDIAL+KL   +T  +Y    CL           + +  GWG  +     I  ILQ V +PIV+N DC              Y  +I   M+CAG+ D+GGKD+CQ DSGGP++ +  +QW+ SGI+SFG GC +  YPG+Y RV  +  WI + T
Sbjct:   32 LNTKIVGGQNAGAGSWPWQVSLQ---SPTYGGHFCGGSLINKDWVLSAAHCFQ--DSLGTVK-------VKLGLQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSNSDCKR-----------AYPGEITSNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWITSST 268          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: F11 (kallikrein B1 [Source:NCBI gene;Acc:100486524])

HSP 1 Score: 190.274 bits (482), Expect = 1.733e-54
Identity = 119/357 (33.33%), Postives = 173/357 (48.46%), Query Frame = 1
Query:   10 LLMIRETIFLGLVVILTSVSTDKESQLVMDPDAEAIDFIVKRNFLKKSYDSEVKTHCG----------RNRFDEIWA--------KYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDM--LKQDIPHVDVEVQKIYIHYKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITK 1020
            L ++ +  FLG  +++  VS +KE Q     +     F   R       +++ K H            R+   EI          K +K   +P +   RIVGG  +  GEWPW VS+ +RL    K H CGG++IS QW++TAAHCF  H         P++W +  G   +  + Q  P  + E   I+ HY     N  DIAL+KLK PI+  ++  A CLP  +    +   C+  GWG   E+  ++S ILQ   VP ++  +C  NY Q R          I+  ++CAG   G  D+C+ DSGGPL C  +  W ++GI S+G GC +   PG+YTRV  F  WI   T+
Sbjct:  261 LTILSDAEFLGDELLVEEVSGEKECQQECTNNIRC-QFFTYRPMQSGCSENKCKCHMKISSNGLPTGIRHGNGEISGFSLRLCKIKSVKGCGEPIEHANRIVGGTDSVLGEWPWQVSMHLRLTASYKKHACGGSIISNQWIVTAAHCFAMHPL-------PQMWIIYSGVVKLSNITQSTPFSETEQIIIHPHYTGAG-NGTDIALLKLKTPISFNDHQKAICLPPREPTFVLPNSCWITGWGFTEESG-SLSNILQKAEVPPISTEECQGNYEQTR----------IDKKILCAGYKRGKIDSCKGDSGGPLACVVDEIWYLTGITSWGEGCARPGKPGVYTRVSEFTDWIIEHTR 597          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ptrh1 (peptidyl-tRNA hydrolase 1 homolog [Source:Xenbase;Acc:XB-GENE-6048772])

HSP 1 Score: 179.489 bits (454), Expect = 5.323e-53
Identity = 99/257 (38.52%), Postives = 146/257 (56.81%), Query Frame = 1
Query:  244 MQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKI--YIHYKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTI-LQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWI 1005
            +  RI+GG + ++G+WPW VS   R   G   H CGGTLIS+Q+V++AAHCF       ++       T  +G + + + D   V + VQ    Y  Y   + +S DI+L++L  P+T T Y    CLP           C+  GWG+   + + +S + LQ VAVP++   +CN  Y Q     G   ++ +   M+CAG   GGKD+CQ DSGGPL+C  + QW ++G++SFG GCG+AY PG+YT +PS+  WI
Sbjct:   30 VSSRIMGGQSAQEGQWPWQVSF--RNNGG---HFCGGTLISKQYVISAAHCFPSSSSASSV-------TAVLGAYMIDQPDGNQVAIPVQSATNYPSYVN-EGDSGDISLVQLASPVTFTNYILPVCLPADTVTFPTGLQCWVTGWGNIASDVSLVSPMTLQKVAVPLIDANECNALY-QTPNSYGTS-SISVHSDMICAGFINGGKDSCQGDSGGPLVCSSSGQWFLAGVVSFGEGCGQAYRPGVYTLMPSYTDWI 271          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ptrh1 (peptidyl-tRNA hydrolase 1 homolog [Source:Xenbase;Acc:XB-GENE-6048772])

HSP 1 Score: 179.489 bits (454), Expect = 5.323e-53
Identity = 99/257 (38.52%), Postives = 146/257 (56.81%), Query Frame = 1
Query:  244 MQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKI--YIHYKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTI-LQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWI 1005
            +  RI+GG + ++G+WPW VS   R   G   H CGGTLIS+Q+V++AAHCF       ++       T  +G + + + D   V + VQ    Y  Y   + +S DI+L++L  P+T T Y    CLP           C+  GWG+   + + +S + LQ VAVP++   +CN  Y Q     G   ++ +   M+CAG   GGKD+CQ DSGGPL+C  + QW ++G++SFG GCG+AY PG+YT +PS+  WI
Sbjct:   30 VSSRIMGGQSAQEGQWPWQVSF--RNNGG---HFCGGTLISKQYVISAAHCFPSSSSASSV-------TAVLGAYMIDQPDGNQVAIPVQSATNYPSYVN-EGDSGDISLVQLASPVTFTNYILPVCLPADTVTFPTGLQCWVTGWGNIASDVSLVSPMTLQKVAVPLIDANECNALY-QTPNSYGTS-SISVHSDMICAGFINGGKDSCQGDSGGPLVCSSSGQWFLAGVVSFGEGCGQAYRPGVYTLMPSYTDWI 271          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ptrh1 (peptidyl-tRNA hydrolase 1 homolog [Source:Xenbase;Acc:XB-GENE-6048772])

HSP 1 Score: 179.104 bits (453), Expect = 5.852e-53
Identity = 99/257 (38.52%), Postives = 146/257 (56.81%), Query Frame = 1
Query:  244 MQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKI--YIHYKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTI-LQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWI 1005
            +  RI+GG + ++G+WPW VS   R   G   H CGGTLIS+Q+V++AAHCF       ++       T  +G + + + D   V + VQ    Y  Y   + +S DI+L++L  P+T T Y    CLP           C+  GWG+   + + +S + LQ VAVP++   +CN  Y Q     G   ++ +   M+CAG   GGKD+CQ DSGGPL+C  + QW ++G++SFG GCG+AY PG+YT +PS+  WI
Sbjct:   26 VSSRIMGGQSAQEGQWPWQVSF--RNNGG---HFCGGTLISKQYVISAAHCFPSSSSASSV-------TAVLGAYMIDQPDGNQVAIPVQSATNYPSYVN-EGDSGDISLVQLASPVTFTNYILPVCLPADTVTFPTGLQCWVTGWGNIASDVSLVSPMTLQKVAVPLIDANECNALY-QTPNSYGTS-SISVHSDMICAGFINGGKDSCQGDSGGPLVCSSSGQWFLAGVVSFGEGCGQAYRPGVYTLMPSYTDWI 267          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: gdap2 (ganglioside induced differentiation associated protein 2 [Source:Xenbase;Acc:XB-GENE-996028])

HSP 1 Score: 176.792 bits (447), Expect = 1.047e-51
Identity = 91/259 (35.14%), Postives = 143/259 (55.21%), Query Frame = 1
Query:  241 KMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTN-SNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAIS-TILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQN 1011
            ++  RI+GG  ++QG WPW V++            CGG+LI+ +WV++A+HCF            P  +TV +G + +   +   + + +Q+  +H   T     +DI L++L   +  T Y    CLP+   N      C+  GWG+   N +      LQ VAVP++ N+ CN +  Q  + LGP  +  I + M+CAG  +GGKD+CQ DSGGPL+C   NQW + G++SFG GCG+   PG+Y RV +++ WI++
Sbjct:   17 QVSTRIMGGQDSQQGMWPWQVNIRSN-----DFSFCGGSLITSKWVISASHCFNRTNP-------PSFYTVYLGSYQLTGANGNEIPMAIQRFIVHPNYTSPEYGHDITLVELSSDVNFTNYIQPVCLPSAGVNFPTGLQCWVTGWGNIASNVSLRDPNTLQQVAVPLIGNQQCN-SILQAPSPLGPS-SFAILNDMLCAGYIDGGKDSCQGDSGGPLVCAAANQWYLVGVVSFGDGCGQPNRPGVYVRVTAYLDWIES 261          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Prss30 (protease, serine 30 [Source:MGI Symbol;Acc:MGI:1353645])

HSP 1 Score: 188.348 bits (477), Expect = 1.491e-56
Identity = 105/283 (37.10%), Postives = 155/283 (54.77%), Query Frame = 1
Query:  217 LKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNI-----TKKF*FHSNS 1044
            L ++   ++   +IVGG    +G+WPW VSL +        H+CGG+LI   WVLTAAHCF         S NP  + V+VG   +   +     V V+ I++H  Y   D +S DIAL++L  P+  +++    CLP          +C+  GWG   E D A  ++LQ +AVP++ + DC   Y    + L  +    I+  M+CAG  EG KD+CQ DSGGPL+C  N+ W   GI S+G GC + Y PG+YTRVP+++ WIQ I     +  + +HS++
Sbjct:   24 LPSVCGHSRDAGKIVGGQDALEGQWPWQVSLWITEDG----HICGGSLIHEVWVLTAAHCFR-------RSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQF-TPVCLPAAQTPLTPGTVCWVTGWGATQERDMA--SVLQELAVPLLDSEDCEKMYHTQGSSLSGERI--IQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGIGCARPYRPGVYTRVPTYVDWIQRILAENHSDAYGYHSSA 290          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Prss30 (protease, serine 30 [Source:MGI Symbol;Acc:MGI:1353645])

HSP 1 Score: 188.348 bits (477), Expect = 1.491e-56
Identity = 105/283 (37.10%), Postives = 155/283 (54.77%), Query Frame = 1
Query:  217 LKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNI-----TKKF*FHSNS 1044
            L ++   ++   +IVGG    +G+WPW VSL +        H+CGG+LI   WVLTAAHCF         S NP  + V+VG   +   +     V V+ I++H  Y   D +S DIAL++L  P+  +++    CLP          +C+  GWG   E D A  ++LQ +AVP++ + DC   Y    + L  +    I+  M+CAG  EG KD+CQ DSGGPL+C  N+ W   GI S+G GC + Y PG+YTRVP+++ WIQ I     +  + +HS++
Sbjct:   24 LPSVCGHSRDAGKIVGGQDALEGQWPWQVSLWITEDG----HICGGSLIHEVWVLTAAHCFR-------RSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQF-TPVCLPAAQTPLTPGTVCWVTGWGATQERDMA--SVLQELAVPLLDSEDCEKMYHTQGSSLSGERI--IQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGIGCARPYRPGVYTRVPTYVDWIQRILAENHSDAYGYHSSA 290          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Tmprss3 (transmembrane protease, serine 3 [Source:MGI Symbol;Acc:MGI:2155445])

HSP 1 Score: 182.956 bits (463), Expect = 4.643e-53
Identity = 103/256 (40.23%), Postives = 146/256 (57.03%), Query Frame = 1
Query:  253 RIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLN--YGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQN 1011
            RIVGG  +   +WPW VSL  +       HLCGG++I+  W++TAAHC   ++ Y     +P+ WTV+VG   ++   +P   VE  KI  H K +     NDIALMKL +P+T  E     CLPN +EN    ++C+ +GWG   +   A S +L H AVP+++N+ CN    YG +           I  +M+CAG  +GG D+CQ DSGGPL+C++   W + G  SFG GC +   PG+YTR+ SF+ WI  
Sbjct:  214 RIVGGNMSSLTQWPWQVSLQFQ-----GYHLCGGSIITPLWIVTAAHCV--YDLY-----HPKSWTVQVGLVSLMDSPVPSHLVE--KIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPNSEENFPDGKLCWTSGWGATEDGGDA-SPVLNHAAVPLISNKICNHRDVYGGI-----------ISPSMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIHE 443          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Tmprss3 (transmembrane protease, serine 3 [Source:MGI Symbol;Acc:MGI:2155445])

HSP 1 Score: 182.956 bits (463), Expect = 4.795e-53
Identity = 103/255 (40.39%), Postives = 146/255 (57.25%), Query Frame = 1
Query:  253 RIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLN--YGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQ 1008
            RIVGG  +   +WPW VSL  +       HLCGG++I+  W++TAAHC   ++ Y     +P+ WTV+VG   ++   +P   VE  KI  H K +     NDIALMKL +P+T  E     CLPN +EN    ++C+ +GWG   +   A S +L H AVP+++N+ CN    YG +           I  +M+CAG  +GG D+CQ DSGGPL+C++   W + G  SFG GC +   PG+YTR+ SF+ WI 
Sbjct:  216 RIVGGNMSSLTQWPWQVSLQFQ-----GYHLCGGSIITPLWIVTAAHCV--YDLY-----HPKSWTVQVGLVSLMDSPVPSHLVE--KIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPNSEENFPDGKLCWTSGWGATEDGGDA-SPVLNHAAVPLISNKICNHRDVYGGI-----------ISPSMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIH 444          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Tmprss3 (transmembrane protease, serine 3 [Source:MGI Symbol;Acc:MGI:2155445])

HSP 1 Score: 182.956 bits (463), Expect = 4.795e-53
Identity = 103/255 (40.39%), Postives = 146/255 (57.25%), Query Frame = 1
Query:  253 RIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLN--YGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQ 1008
            RIVGG  +   +WPW VSL  +       HLCGG++I+  W++TAAHC   ++ Y     +P+ WTV+VG   ++   +P   VE  KI  H K +     NDIALMKL +P+T  E     CLPN +EN    ++C+ +GWG   +   A S +L H AVP+++N+ CN    YG +           I  +M+CAG  +GG D+CQ DSGGPL+C++   W + G  SFG GC +   PG+YTR+ SF+ WI 
Sbjct:  216 RIVGGNMSSLTQWPWQVSLQFQ-----GYHLCGGSIITPLWIVTAAHCV--YDLY-----HPKSWTVQVGLVSLMDSPVPSHLVE--KIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPNSEENFPDGKLCWTSGWGATEDGGDA-SPVLNHAAVPLISNKICNHRDVYGGI-----------ISPSMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIH 444          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9QYZ9|PRS30_MOUSE (Serine protease 30 OS=Mus musculus OX=10090 GN=Prss30 PE=2 SV=2)

HSP 1 Score: 188.348 bits (477), Expect = 1.043e-55
Identity = 105/283 (37.10%), Postives = 155/283 (54.77%), Query Frame = 1
Query:  217 LKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNI-----TKKF*FHSNS 1044
            L ++   ++   +IVGG    +G+WPW VSL +        H+CGG+LI   WVLTAAHCF         S NP  + V+VG   +   +     V V+ I++H  Y   D +S DIAL++L  P+  +++    CLP          +C+  GWG   E D A  ++LQ +AVP++ + DC   Y    + L  +    I+  M+CAG  EG KD+CQ DSGGPL+C  N+ W   GI S+G GC + Y PG+YTRVP+++ WIQ I     +  + +HS++
Sbjct:   24 LPSVCGHSRDAGKIVGGQDALEGQWPWQVSLWITEDG----HICGGSLIHEVWVLTAAHCFR-------RSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQF-TPVCLPAAQTPLTPGTVCWVTGWGATQERDMA--SVLQELAVPLLDSEDCEKMYHTQGSSLSGERI--IQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGIGCARPYRPGVYTRVPTYVDWIQRILAENHSDAYGYHSSA 290          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P03952|KLKB1_HUMAN (Plasma kallikrein OS=Homo sapiens OX=9606 GN=KLKB1 PE=1 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.472e-54
Identity = 107/264 (40.53%), Postives = 148/264 (56.06%), Query Frame = 1
Query:  241 KMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFE--PHEKYPTLSTNPEIWTVRVGEHDM--LKQDIPHVDVEVQKIYIHYKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITK 1020
            K   RIVGG  +  GEWPW VSL V+L    + HLCGG+LI  QWVLTAAHCF+  P +         ++W +  G  ++  + +D P   ++   I+ +YK ++ N +DIAL+KL+ P+  TE+    CLP+  +   I   C+  GWG   E    I  ILQ V +P+V N +C   Y   +          I   MVCAG  EGGKDAC+ DSGGPL+CK N  W + GI S+G GC +   PG+YT+V  ++ WI   T+
Sbjct:  386 KTSTRIVGGTNSSWGEWPWQVSLQVKLTA--QRHLCGGSLIGHQWVLTAAHCFDGLPLQ---------DVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGN-HDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKG-EIQNILQKVNIPLVTNEECQKRYQDYK----------ITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQ 626          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8K1T0|TMPS3_MOUSE (Transmembrane protease serine 3 OS=Mus musculus OX=10090 GN=Tmprss3 PE=1 SV=2)

HSP 1 Score: 182.956 bits (463), Expect = 3.354e-52
Identity = 103/255 (40.39%), Postives = 146/255 (57.25%), Query Frame = 1
Query:  253 RIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLN--YGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQ 1008
            RIVGG  +   +WPW VSL  +       HLCGG++I+  W++TAAHC   ++ Y     +P+ WTV+VG   ++   +P   VE  KI  H K +     NDIALMKL +P+T  E     CLPN +EN    ++C+ +GWG   +   A S +L H AVP+++N+ CN    YG +           I  +M+CAG  +GG D+CQ DSGGPL+C++   W + G  SFG GC +   PG+YTR+ SF+ WI 
Sbjct:  216 RIVGGNMSSLTQWPWQVSLQFQ-----GYHLCGGSIITPLWIVTAAHCV--YDLY-----HPKSWTVQVGLVSLMDSPVPSHLVE--KIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPNSEENFPDGKLCWTSGWGATEDGGDA-SPVLNHAAVPLISNKICNHRDVYGGI-----------ISPSMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIH 444          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P26262|KLKB1_MOUSE (Plasma kallikrein OS=Mus musculus OX=10090 GN=Klkb1 PE=1 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 3.863e-52
Identity = 104/277 (37.55%), Postives = 151/277 (54.51%), Query Frame = 1
Query:  211 KYLKNINKPN---KMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFE--PHEKYPTLSTNPEIWTVRVGEHDM--LKQDIPHVDVEVQKIYIHYKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITK 1020
            +  K ++ P+   K+  RIVGG     GEWPW VSL V+L    + HLCGG++I RQWVLTAAHCF+  P+         P++W +  G   +  + ++ P   ++   I+  YK ++ N  DIAL+KL+ P+  TE+    CLP+  +   I   C+  GWG+  E       ILQ   +P+V N +C   Y              I   M+CAG  EGG DAC+ DSGGPL+CK + +W + GI S+G GC +   PG+YT+V  ++ WI   T+
Sbjct:  373 RLCKLVDSPDCTTKINARIVGGTNASLGEWPWQVSLQVKLVS--QTHLCGGSIIGRQWVLTAAHCFDGIPY---------PDVWRIYGGILSLSEITKETPSSRIKELIIHQEYKVSEGN-YDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKEQGET-QNILQKATIPLVPNEECQKKYRDYV----------INKQMICAGYKEGGTDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKDQPGVYTKVSEYMDWILEKTQ 626          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P14272|KLKB1_RAT (Plasma kallikrein OS=Rattus norvegicus OX=10116 GN=Klkb1 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 6.921e-52
Identity = 102/279 (36.56%), Postives = 151/279 (54.12%), Query Frame = 1
Query:  181 GRNRFDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFE--PHEKYPTLSTNPEIWTVRVGEHDM--LKQDIPHVDVEVQKIYIHYKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWI 1005
            G + +     K +++ +   K+  RIVGG  +  GEWPW VSL V+L    + H+CGG++I RQW+LTAAHCF+  P+         P++W +  G  ++  +    P   ++   I+  YK ++  S DIAL+KL+ P+  TE+    CLP+  +   I   C+  GWG+  E       ILQ   +P+V N +C   Y              I   M+CAG  EGG DAC+ DSGGPL+CK + +W + GI S+G GC +   PG+YT+V  +I WI
Sbjct:  366 GSSGYSLRLCKVVESSDCTTKINARIVGGTNSSLGEWPWQVSLQVKLVS--QNHMCGGSIIGRQWILTAAHCFDGIPY---------PDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSE-GSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGET-QNILQKATIPLVPNEECQKKYRDYV----------ITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWI 621          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A095ALK4 (Serine protease 30 OS=Schistosoma haematobium OX=6185 GN=MS3_03243 PE=3 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 2.400e-97
Identity = 156/343 (45.48%), Postives = 197/343 (57.43%), Query Frame = 1
Query:  163 EVKTHCGRNRFDEIWAKYL-KNINKPNKMQKRIVGGVTTKQGEWPWLVSLMV-------------------------------------RLKP-------------GLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF*F 1032
            ++  HCGRN FD  W KY  K INK      RIVGG  T  GEWPWL SLM                                       + P             G + HLCGGTLI  QW++TAAHCF P+  YP LS++P  W VR+GEHDML + + H D+ V  +Y+H  Y+   ++  DIAL+KL  P+ L+ Y N ACLP+  E  K  ++C + GWGH+ +    ISTIL+HV VPIV N  C +NY  LR    P   + IE  ++CAG  EGG+DACQFDSGGPLMC+ N QW+VSGIISFG+GCGKA YPG+YTRV  ++ WI+ I + F F
Sbjct:   38 KIPEHCGRNAFDYEWRKYFGKAINK------RIVGGSATAYGEWPWLASLMFYQTAEQVKIQKELQTKADEEELEFLDEISKNNEIILDEIDPFIPPSLVYNYPDGGRRFHLCGGTLIHPQWIMTAAHCFFPNPFYPHLSSDPSSWIVRIGEHDMLNESMEHYDMSVAHVYVHPQYQSASSSGYDIALVKLTKPVKLSRYVNIACLPSAGEEVKPGQVCISVGWGHEIDGAKNISTILKHVGVPIVPNDQCTMNYATLRNGPNP-IDVTIESNVICAGHAEGGRDACQFDSGGPLMCQINKQWIVSGIISFGYGCGKAGYPGVYTRVSDYVPWIKGIAEVFTF 373          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: C1LGJ8 (Serine protease 30 OS=Schistosoma japonicum OX=6182 GN=EWB00_007298 PE=2 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 5.241e-97
Identity = 155/338 (45.86%), Postives = 194/338 (57.40%), Query Frame = 1
Query:  175 HCGRNRFDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMV----------------------------------------RLKP----------GLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF*F 1032
            HCGRN FD+ W KY         + KRIVGG+ T  GEWPWL S+M                                          L P          G   HLCGGTLI  QW+LTAAHCF P+  YP LS NP  W VR+GEHDML + + H D+ V  +YIH  Y+   ++  DIAL+KL +P+ L  Y N ACLP++ E  +  + C + GWGH+ +    IST+L+HV+VPIV N  C +NY  LR    P   + IE  ++CAG  EGG+DACQFDSGGPLMCK N QW+V+GIISFG+GCGKA YPG+YTRV  +I WI+ I + F F
Sbjct:   42 HCGRNAFDDEWRKYFGK-----SISKRIVGGIATAYGEWPWLASIMFYQTSEQVKKQKELQDKSNEEDLEFLDELNKTLEIILEENDSLIPPSIVYNYPDGGRHFHLCGGTLIHPQWILTAAHCFFPNAFYPHLSANPSSWIVRIGEHDMLNESVEHYDMTVLHVYIHPKYESASSSGYDIALIKLTEPVKLGRYVNIACLPSIGEEVQPGKECISVGWGHEVDGAKNISTVLKHVSVPIVPNDQCTMNYATLRNGPNPIDVI-IERNVICAGYAEGGRDACQFDSGGPLMCKINKQWIVTGIISFGYGCGKAGYPGVYTRVSDYIPWIKGIVEVFTF 373          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A3Q0KLE4 (Subfamily S1A unassigned peptidase (S01 family) OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.233e-95
Identity = 155/341 (45.45%), Postives = 193/341 (56.60%), Query Frame = 1
Query:  163 EVKTHCGRNRFDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVR----------------------------------------LKPGL---------KIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF*F 1032
            ++  HCGRN FD  W KY     KP  + KRIVGG  T  GEWPWL SLM                                          + P L         + HLCGGTLI  QW++TAAHCF P+  YP LS NP  W VR+GEHDML + + H D+ V  +Y+H  Y+   ++  DIAL+KL  P+ L  Y N ACLP+  E  +  + C + GWGH+ +    ISTIL+HV VPIV N  C +NY  LR    P   + IE  ++CAG  EGG+DACQFDSGGPLMC+   QW+VSGIISFG+GCGKA YPG+YTRV  +I WI+ I + F F
Sbjct:   38 KIPEHCGRNAFDNEWRKYF---GKP--INKRIVGGSATAYGEWPWLTSLMFYQTAEQVKKQKELQIKSDEEELEFLDEINKNEEILEEIDSFIPPSLVYNYPDGSRRFHLCGGTLIHPQWIMTAAHCFFPNPFYPHLSANPSSWIVRIGEHDMLNESMEHYDMSVAHVYVHPQYQSASSSGYDIALVKLTKPVKLGRYVNIACLPSAGEEIQPGQECISVGWGHEIDGAKNISTILKHVGVPIVPNDQCTMNYATLRNGPNP-IDVTIESNVICAGHAEGGRDACQFDSGGPLMCQIKKQWIVSGIISFGYGCGKAGYPGVYTRVSDYIPWIKGIAEVFTF 372          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: V5UNI9 (Serine protease 4 OS=Schistosoma mansoni OX=6183 GN=SP4 PE=2 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 1.707e-95
Identity = 155/341 (45.45%), Postives = 193/341 (56.60%), Query Frame = 1
Query:  163 EVKTHCGRNRFDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVR----------------------------------------LKPGL---------KIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF*F 1032
            ++  HCGRN FD  W KY     KP  + KRIVGG  T  GEWPWL SLM                                          + P L         + HLCGGTLI  QW++TAAHCF P+  YP LS NP  W VR+GEHDML + + H D+ V  +Y+H  Y+   ++  DIAL+KL  P+ L  Y N ACLP+  E  +  + C + GWGH+ +    ISTIL+HV VPIV N  C +NY  LR    P   + IE  ++CAG  EGG+DACQFDSGGPLMC+   QW+VSGIISFG+GCGKA YPG+YTRV  +I WI+ I + F F
Sbjct:   38 KIPEHCGRNAFDNEWRKYF---GKP--INKRIVGGSATAYGEWPWLTSLMSYQTAEQVKKQKELQIKSDEEELEFLDEINKNEEILEEIDSFIPPSLVYNYPDGSRRFHLCGGTLIHPQWIMTAAHCFFPNPFYPHLSANPSSWIVRIGEHDMLNESMEHYDMSVAHVYVHPQYQSASSSGYDIALVKLTKPVKLGRYVNIACLPSAGEEIQPGQECISVGWGHEIDGAKNISTILKHVGVPIVPNDQCTMNYATLRNGPNP-IDVTIESNVICAGHAEGGRDACQFDSGGPLMCQIKKQWIVSGIISFGYGCGKAGYPGVYTRVSDYIPWIKGIAEVFTF 372          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A4E0RKM0 (Transmembrane serine protease 8 OS=Fasciola hepatica OX=6192 GN=D915_000197 PE=3 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 2.198e-89
Identity = 150/343 (43.73%), Postives = 197/343 (57.43%), Query Frame = 1
Query:  142 LKKSYDSEVKTHCGRNRFDEIWAKYLKNINKPNKM---QKRIVGGVTTKQGEWPWLVSL-----------------------------------------MVRLKP--GLKIHLCGGTLISRQWVLTAAHCF-EPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF 1026
            L+ S D+ +  HCGRN FD+ W    +    P  +    KRIVGG  +K GEWPWL S                                          +V  +P  G K H+CGGTLI  +WVL+AAHCF   H+ YP L+  PE WTVRVGEHDML + +PH D+EV++I ++ +   +T S DIAL+KL  P+  T + N ACLP   E  +   +CF+AGWGH+ E+   IST+L+HVA+PIV+N  C  +YG L   L       I D+M+CAG   GGKD+CQFDSGGPLMC   +QW V G++SFGF CG    PG+YTRV S++ WI+ +T  F
Sbjct:   30 LEYSSDT-IPVHCGRNSFDDPWVSLFRPDRPPYSVLGVTKRIVGGTISKLGEWPWLASFIFYQNAVQVRRQQERERLAWQSRHGLSASEEFKGTYFEPPTLVFPQPDGGRKFHMCGGTLIHPRWVLSAAHCFVTAHKDYPDLAPIPERWTVRVGEHDMLDETVPHYDMEVEQIIVNAEYNPNTQSGDIALVKLTRPVPKTRHVNIACLPAEHEEVEPESLCFSAGWGHQEESAKTISTVLRHVALPIVSNEQCRESYGNLNETL----PYTIVDSMICAGDVRGGKDSCQFDSGGPLMCLHGSQWRVEGVVSFGFSCGTQ-IPGVYTRVSSYVKWIKEVTNIF 366          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048530.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:20283923:20290642:1 gene:ENSAMXG00000040955.1 transcript:ENSAMXT00000048530.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.481 bits (441), Expect = 6.029e-52
Identity = 94/258 (36.43%), Postives = 140/258 (54.26%), Query Frame = 1
Query:  253 RIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTNSN-DIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDT--AISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKK-NNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNI 1014
            R+VGG    +GEWPW  SL V  +     H+CGG LI+ QWV++AAHCF     Y     +P +WTV +G+  +         + +  I+IH    D N + D+AL++L  P++    A  ACLP+     +   +C+  GWG   E       S +LQ V V +V+   C  +YG +           I   M+CAG   GGKDACQ DSGGPL+C++ + +W ++G++S+G GCG+  Y G+YTR+     WI+ +
Sbjct:   28 RVVGGADAVEGEWPWQASLQVSGR-----HICGGALIASQWVVSAAHCFYDDRLY-----SPSVWTVYLGKLRLRGTSQTEEALRLSHIHIHQYYDDENHDYDLALLRLDRPVSAGTLAQPACLPSHTHQLEPGLLCWVTGWGAMKEGGEKRGPSNVLQKVDVRLVSEEACVRSYGYI-----------ITPRMLCAGYRSGGKDACQGDSGGPLVCQEPSGRWFLAGVVSWGRGCGRPDYYGVYTRITRLSDWIKQV 264          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: tmprss9 (transmembrane serine protease 9 [Source:ZFIN;Acc:ZDB-GENE-050208-573])

HSP 1 Score: 180.259 bits (456), Expect = 1.669e-50
Identity = 101/283 (35.69%), Postives = 149/283 (52.65%), Query Frame = 1
Query:  166 VKTHCGRNRFDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTNSN-DIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKK-NNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQ 1008
            + +HCGR               +P   ++RIVGGVT ++GEWPW+ SL  +     + H CG TLI  +W+LTAAHCFEP         NP  WTV +G   +L+  +  + + VQ+  IH   T +  + D+AL++L  P   +      CLP+   +      C+  GWG   E+   ++T+LQ   V I+   DC            P Y+  +   MVCAG  EGGKD C  DSGGPL C++ + +W ++G+ S+G GCG++ +PG+Y RV +   WI 
Sbjct:  455 IMSHCGR---------------RPAVGRQRIVGGVTARRGEWPWVASLQFQ-----RSHRCGATLIHCKWILTAAHCFEP---------NPSGWTVSLG--SVLRSGVSALVIPVQRFIIHPNFTSSTMDFDVALVELSIPAPSSYTIQTLCLPSPSHSFFNSSECYIMGWGAIREDK--LTTLLQKAKVSIIDQSDCL-----------PSYSGRLTANMVCAGSMEGGKDTCLGDSGGPLACRQPHGRWFLAGVTSWGHGCGRSSFPGVYMRVTAVREWIS 693          

HSP 2 Score: 145.976 bits (367), Expect = 3.726e-38
Identity = 80/259 (30.89%), Postives = 137/259 (52.90%), Query Frame = 1
Query:  244 MQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKN-NQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQN 1011
            M  R+VGG   + GE+PW VSL +R +     H CG ++IS +W+++AAHCFE        + NP+ W   VG   +   +     + ++ + +   Y    T+S D+ +++L+ P+T + Y    C+P+        + C  +GWG  ++ D+ +   LQ   V ++ +  CN +           Y   I + M+CAG  +G  D+CQ DSGGPL+C+    ++ ++GI+S+G GC +   PG+Y+RV    +WI +
Sbjct:  223 MGSRVVGGQNARHGEFPWQVSLKLRGR-----HTCGASIISSRWIVSAAHCFE--------NKNPKDWRALVGSSLVSGAENGATTINIKSLIVSPDYNPMTTDS-DVTVLELEKPLTFSAYIQPVCIPSFSHTFIPGQNCIVSGWGALSQ-DSEVPPTLQKAVVKVIDSDVCNSSV---------VYRGAITNNMMCAGFLQGRVDSCQGDSGGPLVCEGAPGRFFLAGIVSWGVGCAQVNKPGVYSRVTKLRNWIMS 457          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: tmprss5 (transmembrane serine protease 5 [Source:ZFIN;Acc:ZDB-GENE-131121-184])

HSP 1 Score: 169.859 bits (429), Expect = 7.058e-50
Identity = 98/271 (36.16%), Postives = 146/271 (53.87%), Query Frame = 1
Query:  253 RIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIP-HVDVEVQKIYIHYKRTDTNS--NDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF*FHSNSIDDL 1056
            RIVGGV    G WPW VSL    +     H CGG++I+ QW++TAAHC     + P +S+    W V  G        +  +    V+KI I+ K  +  S  NDIALMKL+ P+  ++    ACLP  D +      C+ +GWG+   +D  I   L+   VP+++ + CN +           Y  +I   M+CAG  EG  DACQ DSGGPL+C+ +N W + G++S+G GC +  +PG+YT+V  F+ WI  + +    HS+ + D+
Sbjct:   30 RIVGGVEATPGRWPWQVSLYYSNR-----HTCGGSIITSQWIVTAAHCVY---RLPQVSS----WVVYAGIVTRNTAKLAQYTGYAVEKI-IYNKNYNHRSHDNDIALMKLRTPLNFSDTIRPACLPQYDHDLPGGTQCWISGWGYTQPDDVHIPDTLKEAPVPLISTKKCNSSC---------MYNGEITSRMLCAGYTEGKVDACQGDSGGPLVCQDDNVWRLVGVVSWGTGCAEPNHPGVYTKVAEFLGWIYEMIEV--GHSHVLSDV 276          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: TMPRSS13 (transmembrane protease serine 13-like [Source:NCBI gene;Acc:103021803])

HSP 1 Score: 172.555 bits (436), Expect = 9.371e-49
Identity = 100/269 (37.17%), Postives = 143/269 (53.16%), Query Frame = 1
Query:  223 NINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQ-WLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKK 1023
            +  K      RI+GG   + G WPW VSL          H+CGGTLIS+ +V+TAAHCF        +  + ++W V  G     K   PH    ++KI +H +   DTN  DIAL+KL  P  L+   N ACLP  D+N      C+ +G+G   E     S  L  V V I+  R CN +           Y   I   M+CAG  +GG+D+CQ DSGGPL+C+ ++Q W ++G+ S+G GCG+   PG+Y++V + + WI +I +K
Sbjct:  253 DCGKQKTTTSRIIGGSVAQLGLWPWQVSLHFN-----GAHICGGTLISQDFVVTAAHCFSDSNP---IYMDAKLWRVYTGVSSQDKLREPHY---IKKILLHDQYNKDTNDYDIALLKLSSPAELSSTVNPACLPAFDKNFPFGTECWTSGFGATVEGSDTGSLDLMGVEVSIIDGRVCNGS---------DVYKGRISMNMMCAGDLQGGRDSCQGDSGGPLVCQDSDQRWYLTGVTSWGIGCGQRQRPGVYSKVSTLLPWIYSIMQK 501          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: zgc:92313 (serine protease 33-like [Source:NCBI gene;Acc:111192381])

HSP 1 Score: 166.392 bits (420), Expect = 2.137e-48
Identity = 98/272 (36.03%), Postives = 143/272 (52.57%), Query Frame = 1
Query:  244 MQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCF-EPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTN-SNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDT--AISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMC-KKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF*FHSNS 1044
            +Q RIVGG    +G WPW V +  + +     H+CGGTLIS  WVL+AAHCF  P +  P        + V  G   +   +   ++ ++++I + +  TD     DIAL+ L  P+T +E     CLP+ D        C   GWG   +  +   + T LQ V VPI+    C   +       G ++   I   M+CAG  EGGKD+CQ DSGGPL+C  ++ +W+ +GI+SFG GC +   PG+Y RV +F S+IQN  K    +S +
Sbjct:   33 VQSRIVGGTDASEGHWPWQVDIQKKSE-----HICGGTLISENWVLSAAHCFPNPSDVSP--------YNVYAGRLQLHGWNPHEMERQIKQIVVPFGYTDAELGEDIALVMLSSPVTWSEVIQPICLPDSDMQFAEGTQCTITGWGDIRDGVSLQGVGT-LQQVQVPIIGQSACQEMF------TGEKFG--IRHDMICAGYKEGGKDSCQGDSGGPLVCLSESGKWVQAGIVSFGLGCAQPNRPGVYARVSAFSSFIQNNVKGLRLYSAA 282          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: tmprss3a (transmembrane serine protease 3a [Source:ZFIN;Acc:ZDB-GENE-070912-70])

HSP 1 Score: 174.866 bits (442), Expect = 2.164e-51
Identity = 96/263 (36.50%), Postives = 135/263 (51.33%), Query Frame = 1
Query:  241 KMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTNSND--IALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKK 1023
            K   RIVGG   + G WPW VSL    +     H CGGTL++  WVL+AAHCF+ +         P++W V     D+      ++   + KI  + +  D  +ND  IAL+KL  P++++     ACLPN   + ++   C+  GWG    +    ST LQ V VPI++   CN             Y   I   MVCAG  +GG+DACQ DSGGPL+C+    W V G  SFG GC    +PG+Y+RV +++ WI    + 
Sbjct:  118 KSTSRIVGGQDAQLGSWPWQVSLQFNGQ-----HTCGGTLLTPTWVLSAAHCFQGY-------LGPDMWNVT----DLTS----NLAGSISKIITNSQYVDNTNNDYDIALVKLSKPLSMSNTIGPACLPNYQTDFQVGMNCWITGWGATKVSAGPASTTLQEVMVPILSTETCNA---------ANSYNGQITSRMVCAGFMQGGQDACQGDSGGPLVCQTGTTWFVVGATSFGEGCALTNFPGVYSRVTAYLDWIHGTMQA 351          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001315.1 (pep scaffold:Pmarinus_7.0:GL479305:249343:254401:-1 gene:ENSPMAG00000001180.1 transcript:ENSPMAT00000001315.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.162 bits (422), Expect = 3.872e-49
Identity = 94/263 (35.74%), Postives = 143/263 (54.37%), Query Frame = 1
Query:  244 MQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHC-FEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDT-NSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQ-FDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKK 1023
            ++ RIVGG +   G WPW  SL   L    K H CGG+LI  +WVLTAAHC +  + +   LS     WT+  G+  + K+        +++I +H +   + N  DIAL++L  P+ LTE     C+P         ++C+ +GWG    N+ ++S  +Q V +P+++  DC  +Y     +            M+CAG  +GGKDACQ  DSGGPL+C+    W ++G++S+G GCG    PG+YTRV +F  WI +I  +
Sbjct:   85 VKSRIVGGESALAGAWPWQASLWSGLT---KNHHCGGSLIHPKWVLTAAHCVYGKNCRVEALSD----WTLFFGKLLLDKEGPMEQHRSIRQIVVHRQYVSSENDYDIALLELDSPVNLTEQVQTVCMPAASHAFLPGQMCWVSGWGTVIGNEFSLSNNMQEVQLPLISQSDCIGSYDHATPR------------MLCAGYPDGGKDACQQGDSGGPLVCEDRGSWFLAGLVSWGVGCGLVNKPGVYTRVTAFTKWINSIIAQ 328          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007992.1 (pep scaffold:Pmarinus_7.0:GL479522:6599:9454:1 gene:ENSPMAG00000007230.1 transcript:ENSPMAT00000007992.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.673 bits (374), Expect = 4.393e-43
Identity = 90/261 (34.48%), Postives = 133/261 (50.96%), Query Frame = 1
Query:  232 KPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTD-TNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAIST--ILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWI 1005
             P   +  IVGG        PW VSL       +  H CGG+LI+ QWV++AAHC++   +           +VR+GEH++   +     ++  K   H +    T  NDI L+KL  P TL +YA A  LP+   N  +  +C  +GWG   E  T++ +  +L  V  P++++  C              Y  DI + M+C G  EGGKD+CQ DSGGP++C    Q    GI+S+G GC    YPG+YT+V ++ +WI
Sbjct:    3 APYMYEDHIVGGSECAAHSQPWQVSL------NIGYHFCGGSLINSQWVVSAAHCYQTASRI----------SVRIGEHNIFVNEGTEQQIQASKAIQHPQYNSWTIDNDIMLIKLSSPATLNQYAQAIALPSSCVNTGV--MCTISGWG---ETQTSVGSPDVLMCVQAPVLSDTSCR-----------NSYPGDITNNMICLGYLEGGKDSCQGDSGGPVVCNGELQ----GIVSWGRGCALPNYPGVYTKVCNYNAWI 227          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004281.1 (pep scaffold:Pmarinus_7.0:GL479205:9482:14995:-1 gene:ENSPMAG00000003912.1 transcript:ENSPMAT00000004281.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.288 bits (373), Expect = 7.515e-43
Identity = 90/260 (34.62%), Postives = 133/260 (51.15%), Query Frame = 1
Query:  235 PNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTD-TNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAIST--ILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWI 1005
            P   +  IVGG        PW VSL       +  H CGG+LI+ QWV++AAHC++   +           +VR+GEH++   +     ++  K   H +    T  NDI L+KL  P TL +YA A  LP+   N  +  +C  +GWG   E  T++ +  +L  V  P++++  C              Y  DI + M+C G  EGGKD+CQ DSGGP++C    Q    GI+S+G GC    YPG+YT+V ++ +WI
Sbjct:   17 PYMYEDHIVGGSECAAHSQPWQVSL------NIGYHFCGGSLINSQWVVSAAHCYQTASRI----------SVRIGEHNIFVNEGTEQQIQASKAIQHPQYNSWTIDNDIMLIKLSSPATLNQYAQAIALPSSCVNTGV--MCTISGWG---ETQTSVGSPDVLMCVQAPVLSDTSCR-----------NSYPGDITNNMICLGYLEGGKDSCQGDSGGPVVCNGELQ----GIVSWGRGCALPNYPGVYTKVCNYNAWI 240          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010026.1 (pep scaffold:Pmarinus_7.0:GL476399:2596494:2601138:1 gene:ENSPMAG00000009070.1 transcript:ENSPMAT00000010026.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.288 bits (373), Expect = 7.515e-43
Identity = 90/260 (34.62%), Postives = 133/260 (51.15%), Query Frame = 1
Query:  235 PNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTD-TNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAIST--ILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWI 1005
            P   +  IVGG        PW VSL       +  H CGG+LI+ QWV++AAHC++   +           +VR+GEH++   +     ++  K   H +    T  NDI L+KL  P TL +YA A  LP+   N  +  +C  +GWG   E  T++ +  +L  V  P++++  C              Y  DI + M+C G  EGGKD+CQ DSGGP++C    Q    GI+S+G GC    YPG+YT+V ++ +WI
Sbjct:   17 PYMYEDHIVGGSECAAHSQPWQVSL------NIGYHFCGGSLINSQWVVSAAHCYQTASRI----------SVRIGEHNIFVNEGTEQQIQASKAIQHPQYNSWTIDNDIMLIKLSSPATLNQYAQAIALPSSCVNTGV--MCTISGWG---ETQTSVGSPDVLMCVQAPVLSDTSCR-----------NSYPGDITNNMICLGYLEGGKDSCQGDSGGPVVCNGELQ----GIVSWGRGCALPNYPGVYTKVCNYNAWI 240          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO47761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKX8])

HSP 1 Score: 175.637 bits (444), Expect = 3.724e-53
Identity = 96/255 (37.65%), Postives = 135/255 (52.94%), Query Frame = 1
Query:  253 RIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTD-TNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMC---KKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWI 1005
            RIVGGV  K G WPW V+L+           CGG+LI  +WVLTAAHCFE       ++ +   + +R+GEH+  + +    D  ++K YIH K  + T  ND+AL+KL  P TL +  N  CLP  D+  K    C  +GWG   E   + S +L    VP+V+   C+             Y   I + M+CAG+ +GG D+CQ DSGGP +C   +   QW + G+ S+G GC +A   GIY  V  ++ WI
Sbjct:    1 RIVGGVVAKPGAWPWQVALIWAKGHDKGAQFCGGSLIDPEWVLTAAHCFE-------ITKDKSQYMLRLGEHNFNEDEGTEQDFYIEKYYIHPKYDEKTTDNDMALIKLDRPATLNKRVNTICLPEADDEFKPGTKCTISGWGALQEGAGSTSKVLMQAKVPLVSRDQCSHQ---------QSYGDRITENMLCAGMRQGGVDSCQGDSGGPFVCTNPENPRQWTLVGVTSWGKGCARALKYGIYANVRRYLHWI 239          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO31703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX50])

HSP 1 Score: 168.703 bits (426), Expect = 9.087e-50
Identity = 92/261 (35.25%), Postives = 138/261 (52.87%), Query Frame = 1
Query:  238 NKMQKRIVGGVTTKQGEWPWLVSL-MVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTNSND--IALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQN 1011
             K   RIVGG   K+G WPW +S+  V  K     H+CGG++++ +W++TAAHCF         S + + +T+ VGEHD+   D      +V++I +H K    N++D  +AL+KL  P+   +     CLP+L E+ +    C+ +GWGH  E       +L   AVP+V+   C   Y  L  +        +   M CAG   GG DACQ DSGGPL+CK+ + W + G IS+G GC +    G+Y  +     W+Q+
Sbjct:   42 GKGNTRIVGGTRAKKGAWPWQISMNYVHNKVTKTPHICGGSVVAPEWIVTAAHCF-------AYSKDAKDYTIAVGEHDLNATDGYEQRPDVERIILHPKYAPHNNHDYDVALIKLASPLQYNDRVRPVCLPSLKEDLEENTQCYISGWGHLQEAGHG-PWVLHQAAVPLVSRDTCQKAYNDLHYK--------VSSRMRCAGYGAGGIDACQGDSGGPLVCKEGDVWYLMGAISWGVGCARGGRYGVYADMMDLKYWVQS 286          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO37083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGX1])

HSP 1 Score: 165.622 bits (418), Expect = 1.500e-48
Identity = 96/287 (33.45%), Postives = 142/287 (49.48%), Query Frame = 1
Query:  157 DSEVKTHCGRNRFDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQN 1011
            D  +K+   R  F    A       +P+    RIVGG   KQG+WPW      +L+       CGG+LI  QWVLTA HC          S  P    +R+G H+         D++V+KI +H  Y++    ++DIAL+KL  P  L  + N  CLP+    P     C+  GWG      TA   ILQ  +VP+V+   C              Y   I D+M+CAG+D+GG D CQ DSGGP++C+   ++ + G  S+G+GC +    G+Y  V + ++W+++
Sbjct:   35 DVTIKSCATRPPFPTTQAPVASCGVRPST---RIVGGTAAKQGDWPW----QAQLRSTSGFPFCGGSLIHPQWVLTATHCVS--------SRRPTDLNIRLGAHNRRANLGMEQDIKVEKIIMHPGYRKPVGLAHDIALIKLLKPANLNRHVNLVCLPDAVPAPTDGTRCWITGWGRLASGGTA-PDILQQASVPVVSRARCE-----------KAYPGKIHDSMLCAGLDQGGIDTCQGDSGGPMVCESRGRFYIHGATSWGYGCAQPGKFGVYAHVKNLVAWVRS 294          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO39666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9G1])

HSP 1 Score: 163.31 bits (412), Expect = 2.487e-48
Identity = 97/261 (37.16%), Postives = 136/261 (52.11%), Query Frame = 1
Query:  256 IVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTNSN-----DIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMC-KKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITK 1020
            IVGG+ +  G WPW  +L +        H CGG++I  QWV+TAAHCF  H      S NP  W VR+GEH   K D     ++V +I IH +    N++     DIAL++L   + L  + +  C P+  +  K  + C  AGWG    N +A S +L+   V +     C ++           YA  I    +CAG  EGG DAC +DSGGPLMC   +N+WL++GI+S+G  C   Y  G+YT V  F+ WI+   K
Sbjct:    1 IVGGIESANGAWPWQAALFLNGTH----HRCGGSVIKSQWVVTAAHCFSKHS-----SRNPRHWQVRLGEHSFHKNDRTEKILKVAQIKIHPRYIPGNNSHPGDYDIALVRLSRSVKLGRHVSPICTPDNFKFFKPGKRCVIAGWGKTAWNGSA-SPVLREAWVDLSVFDVCFIDR---------SYAGKIGKRFICAGYREGGIDACAYDSGGPLMCPGDDNRWLLAGIVSWGEKCAMPYKYGVYTNVNEFMPWIRGSLK 242          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO42420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1T0])

HSP 1 Score: 162.155 bits (409), Expect = 8.159e-48
Identity = 95/257 (36.96%), Postives = 128/257 (49.81%), Query Frame = 1
Query:  247 QKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQN 1011
              RIVGG T +QG WPW      +L+       CGGTLI  +WVLTA HC +                +R+G H   K      D  V ++  H  Y R    +NDIAL+KL  P  L  Y N ACLP+    PK  + C+  GWG  + + +A   ILQ   VP+V    C   Y   R Q        I ++M+CAG+D GG DACQ DSGGP++C+   ++ + G  S+G GC      G+Y RV   + WI++
Sbjct:   15 HARIVGGTTAQQGGWPW----QAQLRTSTGYPYCGGTLIHPEWVLTATHCLK--------GETASRVHIRLGAHRRTKGSGNEQDFRVIRLVTHPNYHRPVGYANDIALLKLDRPAKLDRYVNFACLPDQVPEPKEGDRCYITGWGKLSSHGSA-PDILQQATVPVVGRARCMKAY---RGQ--------IHESMLCAGLDAGGVDACQGDSGGPMVCENAGRFYIQGATSWGNGCAAPGKFGVYARVKYVLDWIKS 247          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000001495.2 (pep primary_assembly:ASM223467v1:8:2656621:2661799:1 gene:ENSORLG00000001213.2 transcript:ENSORLT00000001495.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.422 bits (472), Expect = 4.901e-55
Identity = 105/258 (40.70%), Postives = 141/258 (54.65%), Query Frame = 1
Query:  241 KMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIH--YKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDT-AISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWI 1005
            ++  RIVGG     G WPW VSL    +P      CGG+LI+ QWVLTAAHC            NP   T  +G H   + +   V+  V ++ IH  YK  +TN NDIAL+KL  P+T T Y    CL     +      C+  GWG+    +       LQ V VPIV NR C  N+GQ +          I + M+CAG+ +GGKDACQ DSGGPL+ K+ ++W+ +GI+SFG GC +  +PG+YTRV  + +WI
Sbjct:  104 RLNTRIVGGEEAPPGSWPWQVSLH---RPS---QYCGGSLINDQWVLTAAHC--------APGANPAGLTAYLGRHSQQESNPNEVNRTVAEVIIHPDYK-GETNENDIALLKLSSPVTFTAYIAPVCLAASGSSFYSGVECWVTGWGNIAIGEALPYPQNLQEVKVPIVGNRQCQCNFGQNK----------ISEDMICAGLQKGGKDACQLDSGGPLVGKQGSRWIQAGIVSFGEGCAEPNFPGVYTRVSQYQTWI 336          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000001444.2 (pep primary_assembly:ASM223467v1:8:2587487:2598822:1 gene:ENSORLG00000001175.2 transcript:ENSORLT00000001444.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.185 bits (461), Expect = 1.546e-54
Identity = 110/283 (38.87%), Postives = 143/283 (50.53%), Query Frame = 1
Query:  241 KMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNEN-DTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQN-ITKK----F*FHSNSID-DLRVN 1065
             +  RIVGG     G WPW VSL          H CGG+LI+ QWVLTAAHCF         S +    TV +G   +   +   V   +  + IH    ++T+ NDIAL++L  P+T   Y    CL   +         +  GWG+            LQ V VPIV NR C  +YG          A  I D MVCAG+ EGGKD+CQ DSGGPL+ K+NN+W+ +G++SFG GC    +PG+YTRV  + +WI   IT        F SN  D DL V+
Sbjct:   29 NLNNRIVGGQNAPAGFWPWQVSLQT------SSHFCGGSLINNQWVLTAAHCFP--------SGSASGVTVVLGLQSLQGSNPNRVSRTITTLIIHPNYNSETSDNDIALLQLSSPVTFNNYITPVCLSATNSTFYSGVNTWVTGWGNIGSGVSLPAPQTLQEVQVPIVGNRRCKCSYG----------ASSITDNMVCAGLLEGGKDSCQGDSGGPLVIKQNNRWIQAGVVSFGIGCALPNFPGVYTRVSQYQTWINTQITSNQPGFIAFTSNGTDSDLSVS 287          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000029727.1 (pep primary_assembly:ASM223467v1:8:2577028:2586581:1 gene:ENSORLG00000025385.1 transcript:ENSORLT00000029727.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.8 bits (460), Expect = 2.303e-54
Identity = 110/283 (38.87%), Postives = 143/283 (50.53%), Query Frame = 1
Query:  241 KMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNEN-DTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQN-ITKK----F*FHSNSID-DLRVN 1065
             +  RIVGG     G WPW VSL          H CGG+LI+ QWVLTAAHCF         S +    TV +G   +   +   V   +  + IH    ++T+ NDIAL++L  P+T   Y    CL   +         +  GWG+            LQ V VPIV NR C  +YG          A  I D MVCAG+ EGGKD+CQ DSGGPL+ K+NN+W+ +G++SFG GC    +PG+YTRV  + +WI   IT        F SN  D DL V+
Sbjct:   33 NLNNRIVGGQNAPAGFWPWQVSLQT------SSHFCGGSLINNQWVLTAAHCFP--------SGSASGVTVVLGLQSLQGSNPNRVSRTITTLIIHPNYNSETSDNDIALLQLSSPVTFNNYITPVCLSATNSTFYSGVNTWVTGWGNIGSGVSLPAPQTLQEVQVPIVGNRRCKCSYG----------ASSITDNMVCAGLLEGGKDSCQGDSGGPLVIKQNNRWIQAGVVSFGIGCALPNFPGVYTRVSQYQTWINTQITSNQPGFIAFTSNGTDSDLSVS 291          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000043330.1 (pep primary_assembly:ASM223467v1:8:2448988:2451077:1 gene:ENSORLG00000025659.1 transcript:ENSORLT00000043330.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.03 bits (458), Expect = 3.346e-54
Identity = 99/260 (38.08%), Postives = 137/260 (52.69%), Query Frame = 1
Query:  232 KPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGH-KNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWI 1005
            KP   ++RIVGG     G WPW VSL          H CGG+LI+ QWVLTAAHCF      P+ S    +    +G   +   +   V   ++ + +H    + T +NDIAL++L  P+T   Y    CLP+           +  GWG   N         LQ + +PIV NR C  +YG          A  I D M+CAG+  GGKD+CQ DSGGPL+ K+NN+W+ +G++SFG GC +  +PG+YTRV  + +WI
Sbjct:   14 KPKSRKERIVGGQNALPGSWPWQVSLQS------SYHFCGGSLINNQWVLTAAHCF------PSASGVNAV----LGLQSLQGSNPNRVSRTIKTVIVHPNYNSGTQNNDIALLQLSSPVTFNNYITPVCLPSTGSTFYSGVKTWVTGWGDIGNGVSLPAPETLQEIQIPIVGNRRCKCSYG----------ASSITDNMMCAGLLAGGKDSCQGDSGGPLVIKQNNRWIQAGVVSFGNGCAEPDFPGVYTRVSRYQTWI 247          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000046629.1 (pep primary_assembly:ASM223467v1:8:2446843:2451077:1 gene:ENSORLG00000025659.1 transcript:ENSORLT00000046629.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.8 bits (460), Expect = 4.127e-54
Identity = 99/257 (38.52%), Postives = 135/257 (52.53%), Query Frame = 1
Query:  241 KMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGH-KNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWI 1005
             +  RIVGG     G WPW VSL          H CGG+LI+ QWVLTAAHCF P    P       +++  V  H  L  +   V   ++ + +H    + T +NDIAL++L  P+T   Y    CLP+           +  GWG   N         LQ + +PIV NR C  +YG          A  I D M+CAG+  GGKD+CQ DSGGPL+ K+NN+W+ +G++SFG GC +  +PG+YTRV  + +WI
Sbjct:   41 NLNSRIVGGQNALPGSWPWQVSLQS------SYHFCGGSLINNQWVLTAAHCF-PRTMSPIKPPKTFLFSFSVAVH--LGSNPNRVSRTIKTVIVHPNYNSGTQNNDIALLQLSSPVTFNNYITPVCLPSTGSTFYSGVKTWVTGWGDIGNGVSLPAPETLQEIQIPIVGNRRCKCSYG----------ASSITDNMMCAGLLAGGKDSCQGDSGGPLVIKQNNRWIQAGVVSFGNGCAEPDFPGVYTRVSRYQTWI 278          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000055023.1 (SMESG000055023.1)

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 309/311 (99.36%), Postives = 311/311 (100.00%), Query Frame = 1
Query:   94 MDPDAEAIDFIVKRNFLKKSYDSEVKTHCGRNRFDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF 1026
            MDPDAEAIDFIVKRNFLKKSYDSE+KTHCGRNRFDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTNSNDIALMKLK+PITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF
Sbjct:    1 MDPDAEAIDFIVKRNFLKKSYDSEIKTHCGRNRFDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDTNSNDIALMKLKNPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF 311          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000022862.1 (SMESG000022862.1)

HSP 1 Score: 237.269 bits (604), Expect = 1.030e-75
Identity = 129/294 (43.88%), Postives = 180/294 (61.22%), Query Frame = 1
Query:  166 VKTHCGRNRFDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSL------MVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDT---NSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCK--KNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNI 1014
            ++ HCG+N ++              KM KRI+GG  +++ EWPWLVSL      +   KP    H+CGGTLISR W+LTAAHCFE   +  +L+ +P  WT R+GEH+++K +   +D  ++ I+IH  R  T    ++DIAL+KL+ P   T +   ACLPN DE      IC   GWG  + N + I+ I +HV + +V+++ C L Y  LR  L   +  DI  +M+CAG    GKDACQFDSGGPL+CK   +N W+V+GI+SFGF CG+  +PGIYTRV S++ WI  I
Sbjct:   39 IRGHCGKNNYEN------------KKMDKRIMGGKESREAEWPWLVSLSLWKSDVTGKKPEKSEHMCGGTLISRSWILTAAHCFEKKWE-NSLTNDPSKWTARLGEHNLIKTEDHQMDHSIKAIFIHESRHLTRLETNDDIALVKLESPAQFTRFIKPACLPNPDEKFHENTICTTIGWGFTSFNGS-IAEISRHVNLELVSHQYCKLLYDNLRIILDDPF-YDILPSMLCAGRG-NGKDACQFDSGGPLLCKSESDNIWIVAGIVSFGFKCGE-IFPGIYTRVSSYLDWISKI 315          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000002831.1 (SMESG000002831.1)

HSP 1 Score: 160.999 bits (406), Expect = 2.681e-45
Identity = 90/263 (34.22%), Postives = 138/263 (52.47%), Query Frame = 1
Query:  235 PNKMQKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITK 1020
            PN  + RIVGG+  ++G WPW VSL  R   G+   LCGG++++ +W++TAAHC E         ++P+ WTV  G   +   D       V+K+  +   R++ N NDIA+MKL   + L +Y    C+      P+    C+  GWG  +   T     L+   VPI+    C   YG             + D M+CAG + GG D+CQ DSGGPL+C+ N+++ + GI S+G GC +   PG+YT    ++ W+ N+ +
Sbjct:  190 PN-TEMRIVGGIVAREGSWPWQVSL--RNSDGV---LCGGSIVNSKWIVTAAHCVEGR-------SSPQTWTVHAGRFTLNGNDRNLQVNRVEKVIKNENYRSENNENDIAMMKLSGILRLNDYVEPVCIGT--SVPRDNAECYITGWGVTH--GTGGDGYLKQAKVPIIDQNTCQSWYGN-----------SLSDGMICAGYENGGTDSCQGDSGGPLVCRINSKFQLIGITSWGMGCAEPRQPGVYTAASKYLQWMINVLR 424          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000004375.1 (SMESG000004375.1)

HSP 1 Score: 164.466 bits (415), Expect = 1.685e-44
Identity = 92/257 (35.80%), Postives = 137/257 (53.31%), Query Frame = 1
Query:  247 QKRIVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYK-RTDTNSNDIALMKLKDPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNI 1014
              +IVGG     G WPW++SL  +  P   +H+CGG+LI+  +VLTAAHCF        + +NP+ + + +G + + K  + ++ VE  KI++H   + +T   D+A++KLK    LT      C+P  D+ P   + C   GWG  +   T    +L+   VPIV    CN  YG +           I + M+CAG   GG D+C  DSGGPL+CK   ++ + GI+SFG GC     PG+YT +  F+ WI  I
Sbjct:  270 HSQIVGGSEANPGSWPWMISL--KYGP---LHMCGGSLIAEDFVLTAAHCF-------IMDSNPDYYNIDLGRYFLYKGLVENIAVE--KIFLHPSYKIETQDFDLAIVKLKRKAKLTASIQTVCIPR-DKEPIAGKKCVILGWG--STQGTGGEGVLKQAVVPIVERNVCNELYGNI-----------ITNQMLCAGYKTGGIDSCSGDSGGPLVCKTEKKFEIYGIVSFGQGCALPNRPGVYTNIVRFVDWIDKI 498          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000044335.1 (SMESG000044335.1)

HSP 1 Score: 141.739 bits (356), Expect = 1.898e-38
Identity = 92/283 (32.51%), Postives = 141/283 (49.82%), Query Frame = 1
Query:  220 KNINKPNKMQKR-------------IVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRT-DTNSNDIALMKLKDPITLT-EYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNN-----QWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQ 1008
            K +NK  K QKR             + GG  +  GEWPW V +          H CGG LI   WV+TAAHC    +  P      E W +R G+      +    +V V+K+  H   T  T  +DIAL++L+DP+    ++ +  CLPN  E+     +C  +G+G    +    ST L  V +PI++   C   +    +         I +  +CAG  EG +DAC  DSGGP++C+K +     Q++++G++S+G GCG    PG+YTR+ S++ WI+
Sbjct:   71 KPLNKNEKPQKRNNKCGISNGSKYKVFGGWRSMPGEWPWQVQIERE-----GAHHCGGALIHPNWVVTAAHCTFFFQDLPI-----EKWRIRAGKTQTNMTEPHEQNVRVKKLIDHPGFTLFTKYHDIALIQLEDPMYFDYKFVSPICLPNPQESFD-DHVCTLSGYGKTESSGEGASTYLLEVNLPIISADTCQEKHCNSNS---------IYEENLCAGFKEGKRDACTGDSGGPIVCEKLSVNGFKQFVLAGVVSYGSGCGGKDTPGVYTRISSYLDWIE 333          
The following BLAST results are available for this feature:
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KLKB12.882e-5540.38kallikrein B1 [Source:HGNC Symbol;Acc:HGNC:6371][more]
KLKB17.946e-5540.53kallikrein B1 [Source:HGNC Symbol;Acc:HGNC:6371][more]
TMPRSS37.099e-5238.93transmembrane serine protease 3 [Source:HGNC Symbo... [more]
PRSS277.103e-5237.50serine protease 27 [Source:HGNC Symbol;Acc:HGNC:15... [more]
TMPRSS32.134e-5139.31transmembrane serine protease 3 [Source:HGNC Symbo... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
try-14.033e-4231.82TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
svh-12.093e-3533.20HGF/MSP/plasminogen-like protein [Source:UniProtK... [more]
try-37.742e-1527.68TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
try-32.228e-1327.39TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
try-53.112e-1128.35TRYpsin-like protease; Trypsin-like serine proteas... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG106637.854e-4333.59gene:FBgn0036287 transcript:FBtr0346570[more]
CG106637.854e-4333.59gene:FBgn0036287 transcript:FBtr0113167[more]
CG187352.177e-4236.67gene:FBgn0042098 transcript:FBtr0071744[more]
tpr3.153e-4235.36gene:FBgn0034661 transcript:FBtr0071743[more]
Corin6.350e-4234.14gene:FBgn0033192 transcript:FBtr0088909[more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1120381.136e-5137.85zgc:112038 [Source:ZFIN;Acc:ZDB-GENE-050522-271][more]
si:dkey-16l2.171.267e-5138.19si:dkey-16l2.17 [Source:ZFIN;Acc:ZDB-GENE-141212-2... [more]
si:dkey-16l2.173.617e-5138.19si:dkey-16l2.17 [Source:ZFIN;Acc:ZDB-GENE-141212-2... [more]
zgc:1539683.031e-5038.17zgc:153968 [Source:ZFIN;Acc:ZDB-GENE-061027-211][more]
zgc:1232958.447e-5036.15zgc:123295 [Source:ZFIN;Acc:ZDB-GENE-051127-11][more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F111.733e-5433.33kallikrein B1 [Source:NCBI gene;Acc:100486524][more]
ptrh15.323e-5338.52peptidyl-tRNA hydrolase 1 homolog [Source:Xenbase;... [more]
ptrh15.323e-5338.52peptidyl-tRNA hydrolase 1 homolog [Source:Xenbase;... [more]
ptrh15.852e-5338.52peptidyl-tRNA hydrolase 1 homolog [Source:Xenbase;... [more]
gdap21.047e-5135.14ganglioside induced differentiation associated pro... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prss301.491e-5637.10protease, serine 30 [Source:MGI Symbol;Acc:MGI:135... [more]
Prss301.491e-5637.10protease, serine 30 [Source:MGI Symbol;Acc:MGI:135... [more]
Tmprss34.643e-5340.23transmembrane protease, serine 3 [Source:MGI Symbo... [more]
Tmprss34.795e-5340.39transmembrane protease, serine 3 [Source:MGI Symbo... [more]
Tmprss34.795e-5340.39transmembrane protease, serine 3 [Source:MGI Symbo... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QYZ9|PRS30_MOUSE1.043e-5537.10Serine protease 30 OS=Mus musculus OX=10090 GN=Prs... [more]
sp|P03952|KLKB1_HUMAN1.472e-5440.53Plasma kallikrein OS=Homo sapiens OX=9606 GN=KLKB1... [more]
sp|Q8K1T0|TMPS3_MOUSE3.354e-5240.39Transmembrane protease serine 3 OS=Mus musculus OX... [more]
sp|P26262|KLKB1_MOUSE3.863e-5237.55Plasma kallikrein OS=Mus musculus OX=10090 GN=Klkb... [more]
sp|P14272|KLKB1_RAT6.921e-5236.56Plasma kallikrein OS=Rattus norvegicus OX=10116 GN... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095ALK42.400e-9745.48Serine protease 30 OS=Schistosoma haematobium OX=6... [more]
C1LGJ85.241e-9745.86Serine protease 30 OS=Schistosoma japonicum OX=618... [more]
A0A3Q0KLE41.233e-9545.45Subfamily S1A unassigned peptidase (S01 family) OS... [more]
V5UNI91.707e-9545.45Serine protease 4 OS=Schistosoma mansoni OX=6183 G... [more]
A0A4E0RKM02.198e-8943.73Transmembrane serine protease 8 OS=Fasciola hepati... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048530.16.029e-5236.43pep primary_assembly:Astyanax_mexicanus-2.0:13:202... [more]
tmprss91.669e-5035.69transmembrane serine protease 9 [Source:ZFIN;Acc:Z... [more]
tmprss57.058e-5036.16transmembrane serine protease 5 [Source:ZFIN;Acc:Z... [more]
TMPRSS139.371e-4937.17transmembrane protease serine 13-like [Source:NCBI... [more]
zgc:923132.137e-4836.03serine protease 33-like [Source:NCBI gene;Acc:1111... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmprss3a2.164e-5136.50transmembrane serine protease 3a [Source:ZFIN;Acc:... [more]
ENSPMAT00000001315.13.872e-4935.74pep scaffold:Pmarinus_7.0:GL479305:249343:254401:-... [more]
ENSPMAT00000007992.14.393e-4334.48pep scaffold:Pmarinus_7.0:GL479522:6599:9454:1 gen... [more]
ENSPMAT00000004281.17.515e-4334.62pep scaffold:Pmarinus_7.0:GL479205:9482:14995:-1 g... [more]
ENSPMAT00000010026.17.515e-4334.62pep scaffold:Pmarinus_7.0:GL476399:2596494:2601138... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO477613.724e-5337.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317039.087e-5035.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370831.500e-4833.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396662.487e-4837.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424208.159e-4836.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001495.24.901e-5540.70pep primary_assembly:ASM223467v1:8:2656621:2661799... [more]
ENSORLT00000001444.21.546e-5438.87pep primary_assembly:ASM223467v1:8:2587487:2598822... [more]
ENSORLT00000029727.12.303e-5438.87pep primary_assembly:ASM223467v1:8:2577028:2586581... [more]
ENSORLT00000043330.13.346e-5438.08pep primary_assembly:ASM223467v1:8:2448988:2451077... [more]
ENSORLT00000046629.14.127e-5438.52pep primary_assembly:ASM223467v1:8:2446843:2451077... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055023.10.000e+099.36SMESG000055023.1[more]
SMESG000022862.11.030e-7543.88SMESG000022862.1[more]
SMESG000002831.12.681e-4534.22SMESG000002831.1[more]
SMESG000004375.11.685e-4435.80SMESG000004375.1[more]
SMESG000044335.11.898e-3832.51SMESG000044335.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007408 ID=SMED30007408|Name=Peptidase S1 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1116bp
TGACACTAGCTATTGATGATTCGGGAAACTATTTTTTTAGGTCTTGTTGT
GATTTTGACTTCAGTCAGTACTGACAAGGAGAGTCAACTTGTCATGGACC
CCGATGCAGAGGCAATAGATTTTATTGTCAAAAGAAATTTTTTGAAAAAA
AGTTATGATTCTGAGGTCAAAACGCATTGCGGAAGGAACAGGTTTGATGA
GATATGGGCTAAATATTTAAAGAACATTAACAAACCAAACAAAATGCAGA
AACGAATCGTTGGTGGGGTTACAACGAAGCAAGGAGAATGGCCATGGCTG
GTTTCGCTGATGGTTCGTCTGAAGCCCGGACTTAAAATACATTTATGTGG
CGGTACCTTGATAAGCCGTCAGTGGGTTTTAACCGCGGCTCATTGTTTTG
AACCTCATGAAAAATATCCAACTTTGAGTACAAATCCAGAGATTTGGACT
GTACGTGTTGGTGAGCATGATATGCTTAAGCAGGATATACCGCACGTAGA
CGTCGAGGTCCAGAAGATCTACATTCACTACAAAAGAACGGACACTAACA
GTAATGACATTGCGTTAATGAAGCTGAAGGACCCAATTACGCTAACGGAA
TACGCAAACGCAGCTTGTTTACCAAATTTAGATGAAAATCCAAAAATACG
TGAAATATGTTTTGCTGCCGGTTGGGGACACAAAAATGAAAATGATACGG
CGATATCCACGATTTTGCAACATGTCGCCGTACCGATAGTGGCTAATAGA
GATTGTAACTTAAATTACGGTCAGCTACGAACTCAATTAGGTCCACAATA
CGCGTTGGACATTGAAGATACGATGGTTTGCGCAGGTGTCGACGAAGGAG
GAAAAGATGCTTGCCAGTTTGATTCTGGGGGTCCATTAATGTGCAAGAAG
AACAATCAGTGGCTGGTCTCTGGAATAATATCGTTCGGATTCGGCTGTGG
CAAGGCTTATTATCCCGGGATTTACACCCGGGTTCCTAGTTTCATTTCGT
GGATACAAAATATTACGAAAAAGTTCTAATTTCACTCCAATTCGATTGAT
GATTTGAGAGTGAATGAATTTAAACAAACAATAAATTGTTAGCATTGAGA
AAAAAAACTCTGCGTT
back to top

protein sequence of SMED30007408-orf-1

>SMED30007408-orf-1 ID=SMED30007408-orf-1|Name=SMED30007408-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=338bp
MIRETIFLGLVVILTSVSTDKESQLVMDPDAEAIDFIVKRNFLKKSYDSE
VKTHCGRNRFDEIWAKYLKNINKPNKMQKRIVGGVTTKQGEWPWLVSLMV
RLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGE
HDMLKQDIPHVDVEVQKIYIHYKRTDTNSNDIALMKLKDPITLTEYANAA
CLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLN
YGQLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMCKKNNQWL
VSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001314Peptidase_S1A
IPR001254Trypsin_dom
IPR018114TRYPSIN_HIS
IPR009003Peptidase_S1_PA
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001314Peptidase S1A, chymotrypsin familyPRINTSPR00722CHYMOTRYPSINcoord: 113..128
score: 65.64
coord: 281..293
score: 63.71
coord: 178..192
score: 41.1
IPR001254Serine proteases, trypsin domainSMARTSM00020trypsin_2coord: 81..331
e-value: 3.5E-87
score: 305.6
IPR001254Serine proteases, trypsin domainPFAMPF00089Trypsincoord: 82..331
e-value: 1.0E-61
score: 208.6
IPR001254Serine proteases, trypsin domainPROSITEPS50240TRYPSIN_DOMcoord: 82..336
score: 36.126
IPR001254Serine proteases, trypsin domainCDDcd00190Tryp_SPccoord: 82..334
e-value: 1.16826E-99
score: 291.873
NoneNo IPR availableGENE3DG3DSA:2.40.10.10coord: 74..337
e-value: 1.3E-81
score: 275.6
NoneNo IPR availablePANTHERPTHR24253FAMILY NOT NAMEDcoord: 60..336
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.646
IPR018114Serine proteases, trypsin family, histidine active sitePROSITEPS00134TRYPSIN_HIScoord: 123..128
IPR009003Peptidase S1, PA clanSUPERFAMILYSSF50494Trypsin-like serine proteasescoord: 75..336