SMEDWI-1

Overview
NameSMEDWI-1 (Q2Q5Y9)
Smed IDSMED30007406
Uniprot Best hitPiwi-like protein 1 OS=Schmidtea mediterranea GN=wi-1 PE=2 SV=1 (E=0)
Length (bp)2730
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMEDWI-1 (SMED30007406) t-SNE clustered cells

Violin plots show distribution of expression levels for SMEDWI-1 (SMED30007406) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMEDWI-1 (SMED30007406) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMEDWI-1 (SMED30007406) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

SMEDWI-1 ( piwi-1 ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the blastomere, neoblast compartment and blastomere compartment

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

piwi-1 is expressed in all undifferentiated blastomeres of S3 embryos.  piwi-1 is expressed in all undifferentiated blastomeres of S3 embryos. 

 SPIM reconstructed S3 embryo costained with piwi-1 (red) and EF1a-like-1 (green). piwi-1 is expressed in all undifferentiated blastomeres in the embryonic wall (piwi-1+, EF1a-like-1+ cells).  piwi-1 is not expressed in differentiated tissues marked by EF1a-like-1 alone, including the primitive ectoderm and temporary embryonic pharynx (green). Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

 

Cell cycle activity is restricted to piwi-1 blastomere

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and PCNA (green). PCNA expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express PCNA.

 

Cell cycle activity is restricted to piwi-1 blastomere

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and RNR M2-2 (green). RNR M2-2 expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express RNR M2-2. Several fluorescent beads used for 3-dimensional reconstruction are visible (red). 

 

Mitotic activity is restricted to piwi-1+ blastomere

Mitotic activity is restricted to piwi-1+ blastomeres, which cycle asynchronously.

SPIM reconstructed S4 embryo costained with piwi-1 and LYAG-like (both in green) and H3S10p antibodies (red). LYAG-like marks the temporary embryonic pharynx and is not expressed in piwi-1+ blastomeres. Several examples of piwi-1+, H3S10p+ cells are evident.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-2.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and piwi-2 (green). piwi-1+ blastomeres co-express the nuage factor piwi-2, and virtually all piwi-2+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (green). 

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-3.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and piwi-3 (green). piwi-1+ blastomeres co-express the nuage factor piwi-3, and virtually all piwi-3+ cells co-express piwi-1.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene tud-1.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and tud-1 (green). piwi-1+ blastomeres co-express the nuage factor tud-1, and virtually all tud-1+ cells co-express piwi-1.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene bruli-1.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and bruli-1(green). piwi-1+ blastomeres co-express the stem cell maintenance gene bruli-1, and virtually all bruli-1+ cells co-express piwi-1. Several fluorescent beads used 3-dimensional reconstruction are visible (red).

 

piwi-1+ blastomeres possess chromatoid bodies.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and Y12 antibodies (green). Y12 antibody staining was restricted to, and present throughout, the piwi-1+ blastomere population.

 

Definitive epidermal progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 (red) and p53 (green). Definitive epidermal progenitors, coexpressing piwi-1 and p53, are dispersed in the embryonic wall.  As definitive epidermal progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of p53.

 

Definitive gut progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and gata456a (green). Definitive gut progenitors, coexpressing piwi-1 and gata456a, are dispersed in the embryonic wall. As definitive gut progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of gata456a. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

 

Muscle progenitors arise in the piwi-1+ blastomere population during S5. 

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and myoD (green). Muscle progenitors, coexpressing piwi-1 and myoD, are dispersed in the embryonic wall. As muscle progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of myoD. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

 

Neural progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and pax6a (green). Neural progenitors, coexpressing piwi-1 and pax6a, are dispersed in the embryonic wall. As neural progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of pax6a. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

 

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S3 embryo costained with piwi-1 (red) and PCNA (green). PCNA expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express PCNA.

 

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S5 embryo costained with piwi-1 (red) and PCNA (green). PCNA expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express PCNA.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-2.

SPIM reconstructed S3 embryo costained with piwi-1 (green) and piwi-2 (red). piwi-1+ blastomeres co-express the nuage factor piwi-2, and virtually all piwi-2+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (green).

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-2.

SPIM reconstructed S5 embryo costained with piwi-1 (green) and piwi-2 (red). piwi-1+ blastomeres co-express the nuage factor piwi-2, and virtually all piwi-2+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (green).

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-3.

SPIM reconstructed S3 embryo costained with piwi-1 (green) and piwi-3 (red). piwi-1+ blastomeres co-express the nuage factor piwi-3, and virtually all piwi-3+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-3.

SPIM reconstructed S5 embryo costained with piwi-1 (green) and piwi-3 (red). piwi-1+ blastomeres co-express the nuage factor piwi-3, and virtually all piwi-3+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene tud-1.

SPIM reconstructed S5 embryo costained with piwi-1 (red) and tud-1 (green). piwi-1+ blastomeres co-express the nuage factor tud-1, and virtually all tud-1+ cells co-express piwi-1.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene tud-1.

SPIM reconstructed S3 embryo costained with piwi-1 (red) and tud-1 (green). piwi-1+ blastomeres co-express the nuage factor tud-1, and virtually all tud-1+ cells co-express piwi-1.

Homology
BLAST of SMEDWI-1 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 200.29 bits (508), Expect = 2.148e-67
Identity = 143/507 (28.21%), Postives = 237/507 (46.75%), Query Frame = -2
Query:   54 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSN--EVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMD-SISSCRSNEVEDALTDFIRV------SKVHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1517
            ++ IP ELCYL G +D  R++ N+ K+L    +  P +R  ++     +     + +  ++ WG+  +   ++  GR L    I         N +  D  K       +       + ++   RN    N+ I+++       ++   M   +      EV+D    ++RV      +   + +  +     DK  A  K         +QCV  R    +  +    +A K  +QM  K+G + W +++ +   MIVG+D +H  T G+RS+   V SI+   +++ S         E  + L      AL  + +    MP R+I+YRDGVGD QL     +E    +  ++ I      P++  +VVKKR++ +FF        NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ D           S + P  +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ IHR       N  +  RL+YL
Sbjct:  380 AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNL------FKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHR-----EPNLSLSNRLYYL 861          

HSP 2 Score: 77.7962 bits (190), Expect = 2.148e-67
Identity = 72/286 (25.17%), Postives = 126/286 (44.06%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSD-----EDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV------------YRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEV---QLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            K G  G +V L +N+     + +   Y Y +    +ME + +R+ L     + +    G+   FDG  LF   +           T N   +DV I+I L       S    Q  NI+F  +   M  ++IGR ++  ++         P         I  G++T+I +  N     S +L  +  ++VL    V+              ++     +LIG  ++TKYNNKTYR+ DI + D N +    +    ++S+L Y++++YN  + + KQP ++S+ KR
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSAL----LFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNG--EDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR 368          
BLAST of SMEDWI-1 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 200.29 bits (508), Expect = 2.148e-67
Identity = 143/507 (28.21%), Postives = 237/507 (46.75%), Query Frame = -2
Query:   54 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSN--EVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMD-SISSCRSNEVEDALTDFIRV------SKVHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1517
            ++ IP ELCYL G +D  R++ N+ K+L    +  P +R  ++     +     + +  ++ WG+  +   ++  GR L    I         N +  D  K       +       + ++   RN    N+ I+++       ++   M   +      EV+D    ++RV      +   + +  +     DK  A  K         +QCV  R    +  +    +A K  +QM  K+G + W +++ +   MIVG+D +H  T G+RS+   V SI+   +++ S         E  + L      AL  + +    MP R+I+YRDGVGD QL     +E    +  ++ I      P++  +VVKKR++ +FF        NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ D           S + P  +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ IHR       N  +  RL+YL
Sbjct:  380 AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNL------FKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHR-----EPNLSLSNRLYYL 861          

HSP 2 Score: 77.7962 bits (190), Expect = 2.148e-67
Identity = 72/286 (25.17%), Postives = 126/286 (44.06%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSD-----EDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV------------YRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEV---QLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            K G  G +V L +N+     + +   Y Y +    +ME + +R+ L     + +    G+   FDG  LF   +           T N   +DV I+I L       S    Q  NI+F  +   M  ++IGR ++  ++         P         I  G++T+I +  N     S +L  +  ++VL    V+              ++     +LIG  ++TKYNNKTYR+ DI + D N +    +    ++S+L Y++++YN  + + KQP ++S+ KR
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSAL----LFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNG--EDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR 368          
BLAST of SMEDWI-1 vs. Ensembl Human
Match: PIWIL3 (piwi like RNA-mediated gene silencing 3 [Source:HGNC Symbol;Acc:HGNC:18443])

HSP 1 Score: 195.667 bits (496), Expect = 2.389e-62
Identity = 152/528 (28.79%), Postives = 249/528 (47.16%), Query Frame = -2
Query:   54 SSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA---HRFGVLVV---DRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDD--KVYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF-KDGAN---PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1589
            S  RW      T+ EP         L IP +LC++ G +D    + ++ K L    +  PR R + +++F       K  ++ ++ W +  +   +++ GR L   +I      +      DW   EI+ ++P   A   H + +L      R        ++ V   +G       M  +    +N   D L  + R + + M +  +P+D  + Y  +K +  +   + +QCV ++       R   T+  K   QM  K+G   W +   +  TM VG+D FH    + +S+   V S +A+ +++ S     K   E  + L      AL  +    ++MP  +I+YRDGVGD QL      E   +   ++ I  N     + ++VVKKRI+ +FF K G+N   P PGTV+D ++ +  +Y+F++VSQ    GT +PT+YNV+ DT            +SP  +Q++TY L H+Y+N  G IRVP P HYAH+LA LVG+ IH+       N  +  RLFYL
Sbjct:  270 SQGRWKKGLTGTQREP--------ILLIP-QLCHMTGLTDEICKDYSIVKELAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQGRRMVKANSQGDWS-REIR-ELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDG-DANSYIDTLRKYTRPT-LQMVICILPNDDKRRYDSIKRYLCTKCPIPSQCVVKKTLEKVQAR---TIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIVNRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVIVYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNF--TLAFIVVKKRINTRFFLKHGSNFQNPPPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDT----------IGLSPDTVQRLTYCLCHMYYNLPGIIRVPAPCHYAHKLAYLVGQSIHQ-----EPNRSLSTRLFYL 764          

HSP 2 Score: 65.4698 bits (158), Expect = 2.389e-62
Identity = 74/280 (26.43%), Postives = 128/280 (45.71%), Query Frame = -1
Query: 1591 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVV----MENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTS-------KWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNE----NGTASTLLYLER----INRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISR 2367
            K G +G VV L +N+     + +   Y Y+V     +E+ ++RT    +L   + +  G+   FDG  L  +        +W S    +N+V   VE S  L  T    S +  +  NI+F      +  E++GR ++          R G S       +I  GY T++ +  N        +  LL +E     I R   +    ++ R +  ++LIG  ++TKYNNKTYR+ DI  + +  D     D  KI+Y++Y++Q++   +   KQP ++S+
Sbjct:    8 KTGSEGTVVQLLANHFRVISRPQWVAYKYNVDYKPDIEDGNLRT----ILLDQHRRKFGERHIFDGNSLLLSRPLKERRVEWLSTTKDKNIVKITVEFSKELTPT----SPDCLRYYNILFRRTFKLLDFEQVGRNYYTKKKAIQL-YRHGTSL------EIWLGYVTSVLQYENSITLCADVSHKLLRIETAYDFIKRTSAQAQTGNI-REEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKITYIDYYRQQHKEIVTVKKQPLLVSQ 271          
BLAST of SMEDWI-1 vs. Ensembl Human
Match: PIWIL3 (piwi like RNA-mediated gene silencing 3 [Source:HGNC Symbol;Acc:HGNC:18443])

HSP 1 Score: 195.667 bits (496), Expect = 2.389e-62
Identity = 152/528 (28.79%), Postives = 249/528 (47.16%), Query Frame = -2
Query:   54 SSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA---HRFGVLVV---DRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDD--KVYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF-KDGAN---PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1589
            S  RW      T+ EP         L IP +LC++ G +D    + ++ K L    +  PR R + +++F       K  ++ ++ W +  +   +++ GR L   +I      +      DW   EI+ ++P   A   H + +L      R        ++ V   +G       M  +    +N   D L  + R + + M +  +P+D  + Y  +K +  +   + +QCV ++       R   T+  K   QM  K+G   W +   +  TM VG+D FH    + +S+   V S +A+ +++ S     K   E  + L      AL  +    ++MP  +I+YRDGVGD QL      E   +   ++ I  N     + ++VVKKRI+ +FF K G+N   P PGTV+D ++ +  +Y+F++VSQ    GT +PT+YNV+ DT            +SP  +Q++TY L H+Y+N  G IRVP P HYAH+LA LVG+ IH+       N  +  RLFYL
Sbjct:  270 SQGRWKKGLTGTQREP--------ILLIP-QLCHMTGLTDEICKDYSIVKELAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQGRRMVKANSQGDWS-REIR-ELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDG-DANSYIDTLRKYTRPT-LQMVICILPNDDKRRYDSIKRYLCTKCPIPSQCVVKKTLEKVQAR---TIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIVNRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVIVYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNF--TLAFIVVKKRINTRFFLKHGSNFQNPPPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDT----------IGLSPDTVQRLTYCLCHMYYNLPGIIRVPAPCHYAHKLAYLVGQSIHQ-----EPNRSLSTRLFYL 764          

HSP 2 Score: 65.4698 bits (158), Expect = 2.389e-62
Identity = 74/280 (26.43%), Postives = 128/280 (45.71%), Query Frame = -1
Query: 1591 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVV----MENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTS-------KWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNE----NGTASTLLYLER----INRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISR 2367
            K G +G VV L +N+     + +   Y Y+V     +E+ ++RT    +L   + +  G+   FDG  L  +        +W S    +N+V   VE S  L  T    S +  +  NI+F      +  E++GR ++          R G S       +I  GY T++ +  N        +  LL +E     I R   +    ++ R +  ++LIG  ++TKYNNKTYR+ DI  + +  D     D  KI+Y++Y++Q++   +   KQP ++S+
Sbjct:    8 KTGSEGTVVQLLANHFRVISRPQWVAYKYNVDYKPDIEDGNLRT----ILLDQHRRKFGERHIFDGNSLLLSRPLKERRVEWLSTTKDKNIVKITVEFSKELTPT----SPDCLRYYNILFRRTFKLLDFEQVGRNYYTKKKAIQL-YRHGTSL------EIWLGYVTSVLQYENSITLCADVSHKLLRIETAYDFIKRTSAQAQTGNI-REEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKITYIDYYRQQHKEIVTVKKQPLLVSQ 271          
BLAST of SMEDWI-1 vs. Ensembl Human
Match: PIWIL3 (piwi like RNA-mediated gene silencing 3 [Source:HGNC Symbol;Acc:HGNC:18443])

HSP 1 Score: 190.274 bits (482), Expect = 1.507e-60
Identity = 154/536 (28.73%), Postives = 250/536 (46.64%), Query Frame = -2
Query:   54 SSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA---HRFGVLVV---DRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVS---KVHMALVF-----IPDD--KVYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF-KDGAN---PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1589
            S  RW      T+ EP         L IP +LC++ G +D    + ++ K L    +  PR R + +++F       K  ++ ++ W +  +   +++ GR L   +I      +      DW   EI+ ++P   A   H + +L      R        ++ V   +G       M  +    +N   D L  + R +    +   LVF     +P+D  + Y  +K +  +   + +QCV ++       R   T+  K   QM  K+G   W +   +  TM VG+D FH    + +S+   V S +A+ +++ S     K   E  + L      AL  +    ++MP  +I+YRDGVGD QL      E   +   ++ I  N     + ++VVKKRI+ +FF K G+N   P PGTV+D ++ +  +Y+F++VSQ    GT +PT+YNV+ DT            +SP  +Q++TY L H+Y+N  G IRVP P HYAH+LA LVG+ IH+       N  +  RLFYL
Sbjct:  379 SQGRWKKGLTGTQREP--------ILLIP-QLCHMTGLTDEICKDYSIVKELAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQGRRMVKANSQGDWS-REIR-ELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDG-DANSYIDTLRKYTRPTLQMGMSCLLVFKVICILPNDDKRRYDSIKRYLCTKCPIPSQCVVKKTLEKVQAR---TIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIVNRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVIVYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNF--TLAFIVVKKRINTRFFLKHGSNFQNPPPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDT----------IGLSPDTVQRLTYCLCHMYYNLPGIIRVPAPCHYAHKLAYLVGQSIHQ-----EPNRSLSTRLFYL 882          

HSP 2 Score: 65.0846 bits (157), Expect = 1.507e-60
Identity = 74/280 (26.43%), Postives = 128/280 (45.71%), Query Frame = -1
Query: 1591 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVV----MENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTS-------KWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNE----NGTASTLLYLER----INRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISR 2367
            K G +G VV L +N+     + +   Y Y+V     +E+ ++RT    +L   + +  G+   FDG  L  +        +W S    +N+V   VE S  L  T    S +  +  NI+F      +  E++GR ++          R G S       +I  GY T++ +  N        +  LL +E     I R   +    ++ R +  ++LIG  ++TKYNNKTYR+ DI  + +  D     D  KI+Y++Y++Q++   +   KQP ++S+
Sbjct:  117 KTGSEGTVVQLLANHFRVISRPQWVAYKYNVDYKPDIEDGNLRT----ILLDQHRRKFGERHIFDGNSLLLSRPLKERRVEWLSTTKDKNIVKITVEFSKELTPT----SPDCLRYYNILFRRTFKLLDFEQVGRNYYTKKKAIQL-YRHGTSL------EIWLGYVTSVLQYENSITLCADVSHKLLRIETAYDFIKRTSAQAQTGNI-REEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKITYIDYYRQQHKEIVTVKKQPLLVSQ 380          
BLAST of SMEDWI-1 vs. Ensembl Celegans
Match: prg-1 (Piwi-like protein [Source:RefSeq peptide;Acc:NP_492121])

HSP 1 Score: 199.519 bits (506), Expect = 7.109e-59
Identity = 151/542 (27.86%), Postives = 253/542 (46.68%), Query Frame = -2
Query:   54 TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDF-CKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNN------FIEDVKR--EIGRLRINYTMD-SISSCRSNEVEDALTDFIRV---SKVHMALVFIPDDKV--YAKVKNF-TMSTGLLTQCVTQRN--GSNRDDRRRKTVAD---KSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFN-TMPLRLIIYRDGVGDSQLAFTKKFE-----------TDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA------NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1556
            +E +P+ P E  Q   I  ELC+  G +D  R +  + K +    +  P++RL + R      +   K  +  K WG+ + +    ++ R L    +   +     +   +W  G  +  + +G+     +++    P   N+      FIE+ +R  +I ++++   M   I     N+  + +   I+      +HM +V + DD    Y  +K F  +   +  QCV  R   G ++D    K +     K V+QM  K G   W +N+ +  TMIVG D +H  T K ++V A V + S  F+Q+ S     +   +   NL      AL  + +  + T+P RLI+YRDG GD Q+ + K  E           TD   ++  K+ E   L    +++V KR++++  K G+      NP PGTVVD  + +P   +FYLV Q   +GT +P +YN++ D           + + P   QQ+ + L HLY+NW GT+RVP P  YAH+LA L  + +H        N  +R++LF+L
Sbjct:  306 SEGKPKQPGEPPQVSYIVPELCFPTGLTDEMRKDFKMMKEIAKHTRMSPQQRLVESRKLIVDLSKNEKVMECFKYWGISLGQDLANVQARVLKSEPLQGKKTYEGKQA--EWARGVKECGIYRGSNMTNWIVI---GPGSGNSGLLSQKFIEEARRLGKILQVQLGEPMCVPIRGISPNDYLEGVKGAIKQVDGEDIHMLVVMLADDNKTRYDSLKKFLCVECPIPNQCVNLRTLAGKSKDGGENKNLGSIVLKIVLQMICKTGGALWKVNIPLKNTMIVGYDLYHDSTLKGKTVGACVSTTSNDFTQFYSQTRPHENPTQLGNNLTHFVRKALKQYYDSNDQTLPSRLILYRDGAGDGQIPYIKNTEVKLVRDACDAVTDKAAELSNKVQEKIKLA---FIIVTKRVNMRILKQGSSLDNAINPQPGTVVDTTVTRPERMDFYLVPQFVNQGTVTPVSYNIIHDD----------TDLGPDKHQQLAFKLCHLYYNWQGTVRVPAPCQYAHKLAFLTAQSLHDDA-----NGCLRDKLFFL 824          

HSP 2 Score: 48.521 bits (114), Expect = 7.109e-59
Identity = 80/303 (26.40%), Postives = 133/303 (43.89%), Query Frame = -1
Query: 1585 ALQPDTVTDKIG--KDGRVVSLKSNYANFNIKVEG-----PFYMYDVVMENKSIRTKL--ELLLAYANSKNN-GQPFCFDGRRLFTTSKWHSDEDTE-NLVIKDVEISIRLLTT--FLKNSEEYYQMINIV----FNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRD-------------QIDQLIG-RDIITKYNNKTYRIS--DIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVK 2394
             +QPD    + G  K G     +  +ANF I +E        Y Y V  E  ++ +K   E +L   N  +  G  F FDG  L+   +W  ++  E    I    I IR   T  FL +  +   + N +    F+ +Q+     ++GR +F       G  R  P +    N  IL GY T I R   EN     +L +E   +++ E ++  ++ ++             +++++ G   IIT+YNNK +R +  D     +++ V+ G + I+   YFK +Y I +  D QP +IS  K
Sbjct:   28 TIQPDLFIRQQGQSKTGSSGQPQKCFANF-IPIEMTQSDYSIYQYHVEFE-PTVDSKANREKMLRDNNVTDEIGHHFVFDGMILYLKEEWEQNQMIEVQHPIDRSLICIRFKQTNRFLVDDPQTINIFNTIIRRSFDALQL----TQLGRNYF-----NWGDSRAVPDY----NMSILPGYETAI-RMYEEN----FMLCVENRFKMVREESMYILFHKELRSCQNNPQRVQEKMNEMYGGTTIITRYNNKLHRYTRLDYSISPLSEFVKDG-QSITLKEYFKNQYGIEITVDDQPIIISEGK 309          
BLAST of SMEDWI-1 vs. Ensembl Celegans
Match: prg-2 (Piwi-like protein [Source:RefSeq peptide;Acc:NP_500994])

HSP 1 Score: 197.978 bits (502), Expect = 4.834e-53
Identity = 151/543 (27.81%), Postives = 254/543 (46.78%), Query Frame = -2
Query:   54 TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDF-CKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNN------FIEDVKREIGR---LRINYTMD-SISSCRSNEVEDALTDFIRV---SKVHMALVFIPDDKV--YAKVKNF-TMSTGLLTQCVTQRN--GSNRDDRRRKTVAD---KSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTF-QNKFNTMPLRLIIYRDGVGDSQLAFTKKFE-----------TDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA------NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1556
            +E +P+ P E  Q   I  ELC+  G +D  R +  + K +    +  P++RL++ R    K +      +  + WG+ + +    ++ R L   +    + +   K   +W  G  +  + +G+     +++    P   N+      FI +  R +GR   +++   M   I+    N+  + L   I+     ++HM +V + DD    Y  +K +  +   +  QCV  R   G ++D    K +     K V+QM  K G   W +N+ +  TMIVG D +H  T K ++V A V + S  F+Q+ S     +   +   NL      +L  +  N   T+P RLI+YRDG GD Q+ + K  E           TD   ++  K+ E   L    +++V KR++++  K G+      NP PGTVVD  + +P   +FYLV Q   +GT +P +YN++ D           + + P   QQ+ + L HLY+NW GT+RVP P  YAH+LA L  + +H        N  +R++LF+L
Sbjct:  204 SEGKPKQPGEPPQVNYIVPELCFPTGLTDEMRKDFKMMKEIAKHTRMSPQQRLDETRKLITKLSQNQTMMECFQYWGISLGQDLANVQARVLKS-EPLQGKRQYEGK-QAEWARGVKECGIYRGSNMTNWIVI---GPGSGNSGLLAQKFIAEA-RNLGRTLQVQLGEPMCVKINGISPNDYLEGLKAAIKSVDGEEIHMLVVMLADDNKTRYDSLKKYLCVECPIPNQCVNLRTLAGKSKDGGENKNLGSIVLKIVLQMICKTGGALWKVNIPLKSTMIVGYDLYHDSTLKGKTVGACVSTTSNDFTQFYSQTRPHENPTQLGNNLTHFVRKSLKQYYDNNDKTLPSRLILYRDGAGDGQIPYIKNTEVKLVRDACDAVTDKAAELSNKVQEKIKLA---FIIVTKRVNMRILKQGSSSKSAINPQPGTVVDTTVTRPERMDFYLVPQFVNQGTVTPVSYNIIHDD----------TGLGPDKHQQLAFKLCHLYYNWQGTVRVPAPCQYAHKLAFLTAQSLHDDA-----NGYLRDKLFFL 722          
BLAST of SMEDWI-1 vs. Ensembl Celegans
Match: alg-2 (pep:known chromosome:WBcel235:II:874160:878954:1 gene:WBGene00000106 transcript:T07D3.7b gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 124.02 bits (310), Expect = 1.029e-28
Identity = 127/499 (25.45%), Postives = 212/499 (42.48%), Query Frame = -2
Query:  132 IPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGK--SKDYMKSWGMCIEEQPITIRGREL-APVDIFSNEVKINTKIPDD--WKFGEIKFDVPKGTAHRFGVLVVDRNPSHF-NNFIEDVKREIGRLRINYTMDSISS---CR-SNEVEDALTDFIRV----SKVHMALVFIPDD-KVYAKVKNFTMST-GLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKM----------APTMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMK---MIEKIYENQTLPQIIYVVVKKRISVKFF-KDGA-------NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLA 1508
            +PG+ C L   +D + S         T++K   R      R+ CK     +  +  +   +G+ I      ++GR L AP  ++    +  T +P+   W     +F    G   R   +      SH   N +     ++ R+  +  M  I +   C+ ++ VE     F  +    S + + +V +P    +YA+VK    +  G+ TQCV  +N      R          ++M  KLG    G+N  +           P + +G D  H   G   K S+ A V S+ A  S+Y + V   + + E   +L       L  F       P R+++YRDGV + QL    ++E  A+ +   M+E  Y+    P I ++ V+KR   + F  D A       N  PGT VD  I  P  ++F+L S    +GT+ P++Y+VL D        N+++      LQQ+TY + H Y     ++ +P P +YAH +A
Sbjct:  376 VPGQRC-LKKLTDVQTS---------TMIKATARSAPEREREICKLVSKAELSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWDMRGKQFHT--GMEVRTWAIACFAQQSHVKENDLRMFTTQLQRISTDAGMPIIGTPMFCKYASGVEQVEPMFKYLKQTYSAIQLIVVVLPGKTPIYAEVKRVGDTVLGIATQCVQAKNAI----RTTPQTLSNLCLKMNVKLG----GVNSILLPNVRPRIFNEPVIFLGCDITHPAAGDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIITDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQ----PGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWD-------DNDLTA---DELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVA 840          
BLAST of SMEDWI-1 vs. Ensembl Celegans
Match: alg-2 (pep:known chromosome:WBcel235:II:873176:878954:1 gene:WBGene00000106 transcript:T07D3.7a gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 123.635 bits (309), Expect = 1.549e-28
Identity = 127/499 (25.45%), Postives = 212/499 (42.48%), Query Frame = -2
Query:  132 IPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGK--SKDYMKSWGMCIEEQPITIRGREL-APVDIFSNEVKINTKIPDD--WKFGEIKFDVPKGTAHRFGVLVVDRNPSHF-NNFIEDVKREIGRLRINYTMDSISS---CR-SNEVEDALTDFIRV----SKVHMALVFIPDD-KVYAKVKNFTMST-GLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKM----------APTMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMK---MIEKIYENQTLPQIIYVVVKKRISVKFF-KDGA-------NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLA 1508
            +PG+ C L   +D + S         T++K   R      R+ CK     +  +  +   +G+ I      ++GR L AP  ++    +  T +P+   W     +F    G   R   +      SH   N +     ++ R+  +  M  I +   C+ ++ VE     F  +    S + + +V +P    +YA+VK    +  G+ TQCV  +N      R          ++M  KLG    G+N  +           P + +G D  H   G   K S+ A V S+ A  S+Y + V   + + E   +L       L  F       P R+++YRDGV + QL    ++E  A+ +   M+E  Y+    P I ++ V+KR   + F  D A       N  PGT VD  I  P  ++F+L S    +GT+ P++Y+VL D        N+++      LQQ+TY + H Y     ++ +P P +YAH +A
Sbjct:  395 VPGQRC-LKKLTDVQTS---------TMIKATARSAPEREREICKLVSKAELSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWDMRGKQFHT--GMEVRTWAIACFAQQSHVKENDLRMFTTQLQRISTDAGMPIIGTPMFCKYASGVEQVEPMFKYLKQTYSAIQLIVVVLPGKTPIYAEVKRVGDTVLGIATQCVQAKNAI----RTTPQTLSNLCLKMNVKLG----GVNSILLPNVRPRIFNEPVIFLGCDITHPAAGDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIITDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQ----PGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWD-------DNDLTA---DELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVA 859          
BLAST of SMEDWI-1 vs. Ensembl Celegans
Match: alg-1 (pep:known chromosome:WBcel235:X:13951262:13956256:1 gene:WBGene00000105 transcript:F48F7.1a gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-1)

HSP 1 Score: 119.398 bits (298), Expect = 3.667e-27
Identity = 94/320 (29.38%), Postives = 144/320 (45.00%), Query Frame = -2
Query:  132 SKVHMALVFIPDD-KVYAKVKNFTMST-GLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKM----------APTMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMK---MIEKIYENQTLPQIIYVVVKKRISVKFF----KD----GANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLA 1013
            S + + +V +P    VYA+VK    +  G+ TQCV  +N      R          ++M  KLG    G+N  +           P +  G D  H   G   K S+ A V S+ A  S+Y + V   + + E   +L       L  F       P R+++YRDGV + Q     ++E  A+ +   M+E+ Y+    P I ++ V+KR   + F    KD      N  PGT VD  I  P  ++FYL S    +GT+ P++Y+VL D    N   +E        LQQ+TY + H Y     ++ +P P +YAH +A
Sbjct:  656 SGIQLVVVVLPGKTPVYAEVKRVGDTVLGIATQCVQAKNAI----RTTPQTLSNLCLKMNVKLG----GVNSILLPNVRPRIFNEPVIFFGCDITHPPAGDSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIISDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQFFNVLQYELRAIREACMMLERGYQ----PGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDN--NLTADE--------LQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVA 953          
BLAST of SMEDWI-1 vs. Ensembl Fly
Match: piwi (piwi [Source:FlyBase gene name;Acc:FBgn0004872])

HSP 1 Score: 211.075 bits (536), Expect = 5.146e-70
Identity = 144/477 (30.19%), Postives = 233/477 (48.85%), Query Frame = -2
Query:  120 IPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDF-CKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWK--FGEIK-FDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGR--LRINYTMD-SISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSIS-AKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTL--PQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVG 1508
            IP ELC + G +   RSN  L + + +  +  P++R + +R F  +     +S   ++ W M +++    ++GR +   +I  +  K+      DW+  F + +    P     R+ V+   RN       ++ + R      LRI    +  I   R+     A+ D +R S   + L  +P+D    Y+ +K    +   + TQ VT +   NR      ++A K  +Q+  KLGY PW I L ++  M +G D   S +  KR+  A + S+   + S Y S V      +     L      AL  +Q++   +P R++ YRDGV    L    +FE   +++ ++  Y    L  PQ+ Y+VV + ++ +FF +G NP PGT+VD+ I  P  Y+FYLVSQ+  +GT SPT+YNVL  +            +SP  +Q++TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:  364 IP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVR-SDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRS---LMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMG----------LSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          

HSP 2 Score: 75.0998 bits (183), Expect = 5.146e-70
Identity = 75/283 (26.50%), Postives = 130/283 (45.94%), Query Frame = -1
Query: 1591 QPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMEN--KSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIK-DVE--ISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFF-LGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRD----------IITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISR 2388
            +P  +  K G DG  V L++N+     K E     Y V  E   ++ R ++ +L  +AN   +G  + FDG +LFTT K+  +    +   K D+E  ISI+ +         + Q++N++       +  E +GR  F   +  E   IRE    FKM+   +  GY T+I +   +      LL  E  ++V+    +  + RR   +    +D          ++T YNN+TYRI+D+              + IS++ Y+  +YNI +++  QP +IS+
Sbjct:   82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRAKIE---IRE----FKME---LWPGYETSIRQHEKD-----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK 347          
BLAST of SMEDWI-1 vs. Ensembl Fly
Match: piwi (piwi [Source:FlyBase gene name;Acc:FBgn0004872])

HSP 1 Score: 211.075 bits (536), Expect = 5.146e-70
Identity = 144/477 (30.19%), Postives = 233/477 (48.85%), Query Frame = -2
Query:  120 IPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDF-CKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWK--FGEIK-FDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGR--LRINYTMD-SISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSIS-AKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTL--PQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVG 1508
            IP ELC + G +   RSN  L + + +  +  P++R + +R F  +     +S   ++ W M +++    ++GR +   +I  +  K+      DW+  F + +    P     R+ V+   RN       ++ + R      LRI    +  I   R+     A+ D +R S   + L  +P+D    Y+ +K    +   + TQ VT +   NR      ++A K  +Q+  KLGY PW I L ++  M +G D   S +  KR+  A + S+   + S Y S V      +     L      AL  +Q++   +P R++ YRDGV    L    +FE   +++ ++  Y    L  PQ+ Y+VV + ++ +FF +G NP PGT+VD+ I  P  Y+FYLVSQ+  +GT SPT+YNVL  +            +SP  +Q++TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:  364 IP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVR-SDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRS---LMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMG----------LSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          

HSP 2 Score: 75.0998 bits (183), Expect = 5.146e-70
Identity = 75/283 (26.50%), Postives = 130/283 (45.94%), Query Frame = -1
Query: 1591 QPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMEN--KSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIK-DVE--ISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFF-LGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRD----------IITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISR 2388
            +P  +  K G DG  V L++N+     K E     Y V  E   ++ R ++ +L  +AN   +G  + FDG +LFTT K+  +    +   K D+E  ISI+ +         + Q++N++       +  E +GR  F   +  E   IRE    FKM+   +  GY T+I +   +      LL  E  ++V+    +  + RR   +    +D          ++T YNN+TYRI+D+              + IS++ Y+  +YNI +++  QP +IS+
Sbjct:   82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRAKIE---IRE----FKME---LWPGYETSIRQHEKD-----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK 347          
BLAST of SMEDWI-1 vs. Ensembl Fly
Match: aub (aubergine [Source:FlyBase gene name;Acc:FBgn0000146])

HSP 1 Score: 196.438 bits (498), Expect = 9.070e-67
Identity = 145/485 (29.90%), Postives = 239/485 (49.28%), Query Frame = -2
Query:  117 DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGK-SKDYMKSWGMCIEEQPITIRGRELAPVDI-FSNEVKINTKIPDDWKFGEIKFDVPKGTAH--RFGVLVVDRNPSHFNNFIEDVKREIGRLRINYT---MDSISSCRSNEVEDALTDFIRVS-KVHMALVFIPDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRR--KTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSISAKFS-QYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYEN---QTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK 1523
            DQ++ I  EL    G +D+ R++    + +    +  P  R+  +R F K   + K S + +KSW + ++   + I  R L P  I F N+         DW   E +        H  R+ V+   RN      F++   R    +++N      + I   R+     A+ +      ++ M ++  P+++ Y+ +K  T +   + +Q VT +  + R  +     ++A K V+QM +KL   PW + + +   M VG D  HS K   +S  A V ++  K S +Y S VN      E  E +  N   AL ++Q +  ++P R++ +RDGVGD QL      E + +   +++IY++   Q   ++ +++V KRI+ ++F    NP PGTVVD+ I  P  Y+F+LVSQ    GT SPT+YNV+ D    N             LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +
Sbjct:  305 DQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWT-NEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADK----------LQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 778          

HSP 2 Score: 78.9518 bits (193), Expect = 9.070e-67
Identity = 74/296 (25.00%), Postives = 139/296 (46.96%), Query Frame = -1
Query: 1555 QPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTE---NLVIK-----DVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFK--ILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQID-------QLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKN 2388
            +P  +T K G  G  +++++NY     +     Y Y V        T+L     Y +    G  + FDG  +F  +++ + +D+     LV K     ++EI I+ + +      E +Q++N++       +  + + R ++           +  +   ++NF+  +  GY T+I +  N+    S + +  ++ R     N++S   RD  D        ++G  I+T YNNKTYRI D+  +     + +  D +ISY++Y+K+RYNI +++ KQP V+S       RP +KN
Sbjct:   25 RPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILGG-YIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-----------DPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH--KVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMS-------RPTDKN 299          
BLAST of SMEDWI-1 vs. Ensembl Fly
Match: aub (aubergine [Source:FlyBase gene name;Acc:FBgn0000146])

HSP 1 Score: 196.438 bits (498), Expect = 1.018e-66
Identity = 145/485 (29.90%), Postives = 239/485 (49.28%), Query Frame = -2
Query:  117 DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGK-SKDYMKSWGMCIEEQPITIRGRELAPVDI-FSNEVKINTKIPDDWKFGEIKFDVPKGTAH--RFGVLVVDRNPSHFNNFIEDVKREIGRLRINYT---MDSISSCRSNEVEDALTDFIRVS-KVHMALVFIPDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRK--TVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFS-QYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYEN---QTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK 1523
            DQ++ I  EL    G +D+ R++    + +    +  P  R+  +R F K   + K S + +KSW + ++   + I  R L P  I F N+         DW   E +        H  R+ V+   RN      F++   R    +++N      + I   R+     A+ +      ++ M ++  P+++ Y+ +K  T +   + +Q VT +  + R  +     ++A K V+QM +KL   PW + + +   M VG D  HS   K +S  A V ++  K S +Y S VN      E  E +  N   AL ++Q +  ++P R++ +RDGVGD QL      E + +   +++IY++   Q   ++ +++V KRI+ ++F    NP PGTVVD+ I  P  Y+F+LVSQ    GT SPT+YNV+ D    N             LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +
Sbjct:  376 DQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWT-NEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADK----------LQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 849          

HSP 2 Score: 78.5666 bits (192), Expect = 1.018e-66
Identity = 74/296 (25.00%), Postives = 139/296 (46.96%), Query Frame = -1
Query: 1555 QPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTE---NLVIK-----DVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFK--ILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQID-------QLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKN 2388
            +P  +T K G  G  +++++NY     +     Y Y V        T+L     Y +    G  + FDG  +F  +++ + +D+     LV K     ++EI I+ + +      E +Q++N++       +  + + R ++           +  +   ++NF+  +  GY T+I +  N+    S + +  ++ R     N++S   RD  D        ++G  I+T YNNKTYRI D+  +     + +  D +ISY++Y+K+RYNI +++ KQP V+S       RP +KN
Sbjct:   96 RPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILGG-YIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-----------DPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH--KVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMS-------RPTDKN 370          
BLAST of SMEDWI-1 vs. Ensembl Fly
Match: AGO3 (Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250816])

HSP 1 Score: 205.682 bits (522), Expect = 6.042e-55
Identity = 151/516 (29.26%), Postives = 254/516 (49.22%), Query Frame = -2
Query:   54 KKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCK-WTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHF-NNFIEDVKREIGRLRINY---TMDSISSCRSNEVEDALTDFIRV-SKVHMALVFIPDDKVYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1562
            KK+   P    E  Q   IP ELCYL G  D  RS+  L + + T  +  P +R   +  F +  +    +++ + SWG+ +      I GR++    I+ +++ ++     ++    +  ++ K       +++  RN      + ++++K+    L +N    TM S+   R +    AL   I + +++ + +     D  YA +K    S   + +Q +  +   N  D + ++V  K V+QM  KLG   W + +     MI G+D++H  + +  SV A V SI++ +SQ+ S       + E    L  +F  AL  ++ +   +P  +IIYRDG+GD QL     +E    +   E +  N+   +I Y+VV+KRI+ + F        NP PGTVVD+ I K N Y+F+LVSQ   +GT +PT+Y VL D               P ++Q+++Y L  LY+NW GT+R+P    YAH+LA L+G+ I R V      + + E+LFYL
Sbjct:  377 KKSRGIP-AERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQN--DLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNRI--KISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD----------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVA-----EALSEKLFYL 867          

HSP 2 Score: 65.4698 bits (158), Expect = 1.879e-10
Identity = 54/201 (26.87%), Postives = 93/201 (46.27%), Query Frame = -1
Query: 1558 KDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKK--ISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK 2121
            +DVE+ IR+L    +      Q+ NI+F+ +   +   K  R+ F  S          P    +   ++  GY T +     +      +L  +  +R+L +  V+ +           Y+      L+G  ++T+YNN+TY+I+DI   D N   Q   K    SY+ Y+KQ +NIN+K+  QP + S +K+S   P E+
Sbjct:  202 EDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDIC-FDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKSRGIPAER 386          
BLAST of SMEDWI-1 vs. Ensembl Zebrafish
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:ZFIN;Acc:ZDB-GENE-030813-2])

HSP 1 Score: 215.312 bits (547), Expect = 1.496e-75
Identity = 152/502 (30.28%), Postives = 244/502 (48.61%), Query Frame = -2
Query:   54 ELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDI-RDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKIN-TKIPDDWKFGEIKFDVPKGTAHRFG---VLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV------SKVHMALVFIP---DDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFK--DG--ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1499
            E CYL G +D  R++ N+ K+L +  +  P +R   I R        G  ++ + +WG+  E + +++ GR L    I              DW   E++  +P  +        +    RN     + ++ + +  G + I      +      E ED     +R        +  M +V +P    DK     K   +     +QCV  R  S    +   TVA K  +QM  K+G + W + + +   MIVG+D +H +  GKRS+ A V S++   S++ S         E  + L  +   AL  +    N++P R+I+YRDGVGD  L     +E   +M+ I+ + ++   P++  VVVKKRIS +FF   DG  ANP PGTV+D ++ +P +Y+F++VSQ    G  +PT+YNV+ D           S + P  +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ IH+    P +N  + + L+YL
Sbjct:  382 EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWS-KEMR-GLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIR-----MQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISK--PQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN----------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHK---EPNMN--LDDFLYYL 858          

HSP 2 Score: 89.3521 bits (220), Expect = 1.496e-75
Identity = 84/307 (27.36%), Postives = 136/307 (44.30%), Query Frame = -1
Query: 1582 RGGLQRRF---AIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED---TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVY---RRDQIDQ---------LIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2433
            RGG +R F    +    L       K G  G  + L++N+     +     Y Y V     ME++ +R+ L     + + +  G+   FDG  LF  +K  + E    +E    + VEI++ L      +S    Q  NI+F  I   +  ++IGR ++   +         P         I  G+ TTI +       +S +L  +  ++VL    V+      R+   DQ         L+G  I+TKYNNKTYRI DI  +   N+  + GD +IS+ NYFK +Y +++ +  Q  ++S VKR
Sbjct:   77 RGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLLSRPMWALYQYHVDYKPPMESRRLRSAL----LFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDD---------PFNIPQHRLTIWPGFMTTILQYE-----SSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKR 365          
BLAST of SMEDWI-1 vs. Ensembl Zebrafish
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:ZFIN;Acc:ZDB-GENE-030813-2])

HSP 1 Score: 215.312 bits (547), Expect = 1.496e-75
Identity = 152/502 (30.28%), Postives = 244/502 (48.61%), Query Frame = -2
Query:   54 ELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDI-RDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKIN-TKIPDDWKFGEIKFDVPKGTAHRFG---VLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV------SKVHMALVFIP---DDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFK--DG--ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1499
            E CYL G +D  R++ N+ K+L +  +  P +R   I R        G  ++ + +WG+  E + +++ GR L    I              DW   E++  +P  +        +    RN     + ++ + +  G + I      +      E ED     +R        +  M +V +P    DK     K   +     +QCV  R  S    +   TVA K  +QM  K+G + W + + +   MIVG+D +H +  GKRS+ A V S++   S++ S         E  + L  +   AL  +    N++P R+I+YRDGVGD  L     +E   +M+ I+ + ++   P++  VVVKKRIS +FF   DG  ANP PGTV+D ++ +P +Y+F++VSQ    G  +PT+YNV+ D           S + P  +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ IH+    P +N  + + L+YL
Sbjct:  382 EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWS-KEMR-GLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIR-----MQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISK--PQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN----------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHK---EPNMN--LDDFLYYL 858          

HSP 2 Score: 89.3521 bits (220), Expect = 1.496e-75
Identity = 84/307 (27.36%), Postives = 136/307 (44.30%), Query Frame = -1
Query: 1582 RGGLQRRF---AIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED---TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVY---RRDQIDQ---------LIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2433
            RGG +R F    +    L       K G  G  + L++N+     +     Y Y V     ME++ +R+ L     + + +  G+   FDG  LF  +K  + E    +E    + VEI++ L      +S    Q  NI+F  I   +  ++IGR ++   +         P         I  G+ TTI +       +S +L  +  ++VL    V+      R+   DQ         L+G  I+TKYNNKTYRI DI  +   N+  + GD +IS+ NYFK +Y +++ +  Q  ++S VKR
Sbjct:   77 RGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLLSRPMWALYQYHVDYKPPMESRRLRSAL----LFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDD---------PFNIPQHRLTIWPGFMTTILQYE-----SSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKR 365          
BLAST of SMEDWI-1 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:ZFIN;Acc:ZDB-GENE-060526-345])

HSP 1 Score: 174.096 bits (440), Expect = 4.760e-44
Identity = 139/538 (25.84%), Postives = 244/538 (45.35%), Query Frame = -2
Query:   54 NNHLLYRESSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA--HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVE-------DALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKI--YENQTLPQIIYVVVKKRISVKFFKDGAN----PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1613
            N  +  +E        + K  + P G   T + L +P EL ++ G  +  R +    K+L   +    ++    ++       +  ++   +  WG+ I ++ +  +GR L    I  +     T    DW   E+  D    T   + + V    R        +    R  G + +          R +  E         LT   RV  V   +    DD   A  K   + + + +Q +  R  S    ++ ++VA K ++Q+  KLG + W +N+ +   M++G+D  H  + K RSV   V S+++  +++ S V       E         L AL  +    +  P +++IYRDGV D QL   + +E   ++K  E I  YE    P++ ++VV+KRIS   +  G++    P+PGTV+D  +   ++ +FYL++    +G   PT+Y  + +T          + ++P  LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +H   + PAI  ++ E+LF+L
Sbjct:  532 NYGITIKELDQPLLIHRPKERSRPGGKVITGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICLHSASFVTSPAVDWSR-ELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFVKSIHSQLTSEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQ--PQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETIPNYE----PKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNT----------ANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLH---SEPAI--QLSEKLFFL 1046          

HSP 2 Score: 69.3218 bits (168), Expect = 1.550e-11
Identity = 61/280 (21.79%), Postives = 118/280 (42.14%), Query Frame = -1
Query: 1585 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDG------RRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKI-SYLNYFKQRYNINLKNDKQPFVISRVK 2367
            KIG  G  + + SNY     K +   + Y V          +   +   +    G+   FDG      +RL       ++  T+N   ++++I I+L      +S+      N+V   +   +G + +GR  +  +                   ++  GYST+I     ++      L ++  ++VL  ++V+ V           ++ +   + +G  +IT+YNN+TYRI DI+      D   L D  + ++++Y+++ Y I +K   QP +I R K
Sbjct:  289 KIGTKGSPIPIGSNYIPICCKNDA-VFQYHVTFTPNVESLSMRFGMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAERKTDN---QEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPNAV---------VILGKHRLQVWPGYSTSI-----KHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQGSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLIHRPK 550          
BLAST of SMEDWI-1 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:ZFIN;Acc:ZDB-GENE-060526-345])

HSP 1 Score: 174.096 bits (440), Expect = 4.760e-44
Identity = 139/538 (25.84%), Postives = 244/538 (45.35%), Query Frame = -2
Query:   54 NNHLLYRESSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA--HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVE-------DALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKI--YENQTLPQIIYVVVKKRISVKFFKDGAN----PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1613
            N  +  +E        + K  + P G   T + L +P EL ++ G  +  R +    K+L   +    ++    ++       +  ++   +  WG+ I ++ +  +GR L    I  +     T    DW   E+  D    T   + + V    R        +    R  G + +          R +  E         LT   RV  V   +    DD   A  K   + + + +Q +  R  S    ++ ++VA K ++Q+  KLG + W +N+ +   M++G+D  H  + K RSV   V S+++  +++ S V       E         L AL  +    +  P +++IYRDGV D QL   + +E   ++K  E I  YE    P++ ++VV+KRIS   +  G++    P+PGTV+D  +   ++ +FYL++    +G   PT+Y  + +T          + ++P  LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +H   + PAI  ++ E+LF+L
Sbjct:  532 NYGITIKELDQPLLIHRPKERSRPGGKVITGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICLHSASFVTSPAVDWSR-ELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFVKSIHSQLTSEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQ--PQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETIPNYE----PKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNT----------ANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLH---SEPAI--QLSEKLFFL 1046          

HSP 2 Score: 69.3218 bits (168), Expect = 1.550e-11
Identity = 61/280 (21.79%), Postives = 118/280 (42.14%), Query Frame = -1
Query: 1585 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDG------RRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKI-SYLNYFKQRYNINLKNDKQPFVISRVK 2367
            KIG  G  + + SNY     K +   + Y V          +   +   +    G+   FDG      +RL       ++  T+N   ++++I I+L      +S+      N+V   +   +G + +GR  +  +                   ++  GYST+I     ++      L ++  ++VL  ++V+ V           ++ +   + +G  +IT+YNN+TYRI DI+      D   L D  + ++++Y+++ Y I +K   QP +I R K
Sbjct:  289 KIGTKGSPIPIGSNYIPICCKNDA-VFQYHVTFTPNVESLSMRFGMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAERKTDN---QEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPNAV---------VILGKHRLQVWPGYSTSI-----KHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQGSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLIHRPK 550          
BLAST of SMEDWI-1 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:ZFIN;Acc:ZDB-GENE-060526-345])

HSP 1 Score: 162.155 bits (409), Expect = 2.360e-43
Identity = 94/285 (32.98%), Postives = 160/285 (56.14%), Query Frame = -2
Query:   54 RRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKI--YENQTLPQIIYVVVKKRISVKFFKDGAN----PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 884
            ++ ++VA K ++Q+  KLG + W +N+ +   M++G+D  H  + K RSV   V S+++  +++ S V       E         L AL  +    +  P +++IYRDGV D QL   + +E   ++K  E I  YE    P++ ++VV+KRIS   +  G++    P+PGTV+D  +   ++ +FYL++    +G   PT+Y  + +T          + ++P  LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +H   + PAI  ++ E+LF+L
Sbjct:   29 QKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETIPNYE----PKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNT----------ANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLH---SEPAI--QLSEKLFFL 294          
BLAST of SMEDWI-1 vs. Ensembl Xenopus
Match: piwil3 (piwi-like RNA-mediated gene silencing 3 [Source:Xenbase;Acc:XB-GENE-6469412])

HSP 1 Score: 171.785 bits (434), Expect = 8.099e-44
Identity = 136/496 (27.42%), Postives = 230/496 (46.37%), Query Frame = -2
Query:   54 GFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPD--DWKFGEIKFDVPKGTAH--RFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1481
            G +D  RS+ N+ K+L    +  P +R   +  F K      S +  ++ WG+  + + +   GR +AP +      K     P   DW   E++        H   + +L   RN    N   +++ +  G++ I      ++     EV+D    +++V +      V M +  +     DK  A  K   +   + +QCV  +  +    +   +VA K  +QM  K+G + W + + +   MIVG+D +H + +GKRS+ A V S++   +++ S       K E  + L          F N       +  I        Q+     F    +++    + E+   P++  +VVKKR+S +FF        NP PGT+VD +I +P +Y+F+++SQ    G+ SPT+YNV+ D+            + P  +Q++TY L HLY+NW G IRVP P  YAH+LA LVG+ IHR    P +   + +RL+YL
Sbjct:  395 GLTDRMRSDFNVMKDLAIHTRLAPEQREIQVGKFLKNIHKDDSVQKELQDWGLNFDSKLLPFAGR-VAPAEKILQAGKTADYNPQFADWS-RELRGPTLIRVKHLDNWVLLYTRRNYDAANTLTQNLFKVSGQMGIK-----MNRAVMVEVDDTTDAYVKVLQQKVTPDVQMVVCLLSSNRKDKYDAIKKYLCIDCPVPSQCVLAKTLNK--PQTVVSVATKIALQMNCKMGGELWTVEIPLKELMIVGIDCYHDTLSGKRSIGAFVASLNPSMTRWFSRCVLQAQKQEIVDGLKVCMHEGKRCFLNSCQVCLYKSKIQGTVFLQGQVHLAVHFRLSVLIQSRLALQEDYN-PKLTVIVVKKRVSARFFAHVGGRLQNPPPGTIVDVEITRPEWYDFFIISQSVRVGSVSPTHYNVVYDS----------GALKPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHR---EPHLT--LSDRLYYL 865          

HSP 2 Score: 57.7658 bits (138), Expect = 2.561e-8
Identity = 64/269 (23.79%), Postives = 115/269 (42.75%), Query Frame = -1
Query: 1624 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVI------KDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSN---CESGGIREGPSFFKM-----DNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGD---KKISYLNYFKQRYNINL 2367
            K G  G ++ L +N+     + +   + Y +     ME++ +R  L     + + +  G+   FDG  LF   +     D  N V       + V+I+I L       S   +Q  NI+F  +   M  ++IGR ++  ++     S G+   P F        +N  +    S  + R      + + L Y+  +N+ +  +    +  +D    LIG+ ++TKYNNKTYRI DI   D   E         +IS+++Y++  +   L
Sbjct:  101 KTGSSGSIIQLSTNHIKLISRPQWVLFQYHIDYAPQMESRGLRCAL----LFQHEELIGKARAFDGTMLFLPKRL----DKVNEVFSQTRNGETVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYYNPNDQIEISSHGLTIYPGFSTSILQYENNIMLSIDVSHKVLR------SETVLDYMYNVNQKVESHKFHDICSKD----LIGQIVLTKYNNKTYRIDDI-NWDFTPESTFKKSDGSEISFVDYYRTEFEHPL 350          
BLAST of SMEDWI-1 vs. Ensembl Xenopus
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:Xenbase;Acc:XB-GENE-982236])

HSP 1 Score: 165.622 bits (418), Expect = 1.019e-41
Identity = 136/550 (24.73%), Postives = 261/550 (47.45%), Query Frame = -2
Query:   54 GITLI*KMTNNHLLYRESSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCK-WTGAGKSKDYMKSWGMCIEEQPITIRGRELA--PVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHR-FGVLVVDRNPS----HFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV----SKVHMALVFIPD--DKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGAN----PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1640
            GIT+  K  +  LL    S+R           P+G    D  L +P EL ++ G  +  R +    K+L   +   P++    +    K    +  +K+ ++ WG+ ++       GR L    +++ +N       +  +W   E+  +  + + H  +  ++  +  S      ++ +E +   IG +R+N+   +    R + VE        +     KV + +  I    D +Y  +K    +   + +Q +  R  S    ++ +++A K ++Q+  KLG + WG+++ +   M++G+D +H  + G RSV   V SI++  + + S V       E  ++L    + AL  F    +++P ++++YRDGV D QL   + +E   +    +  ++N   P+++ +VV+KR+S   +         P PGTV+D  +    + +F+L+S    +G   PT+Y  +M+T          + + P  LQ++T+ L H+Y+NW GTIRVP P  YAH+LA L G+ +H     P+I  ++ ++LF+L
Sbjct:  438 GITV--KELDQPLLLHRPSER---------KAPKG-KALDIVLLLP-ELAFMTGIPEKMRKDFRAMKDLTQQIHLSPKQHHISLGKLLKRIESSADAKNELQRWGLFLDTDIHMTTGRILPIEKINLRNNSFPAGEDL--NWN-REVTREACRSSVHLLYWAMIYPKRASAQAQELSSMLERIGGPIG-IRVNHP--NCVELRDDRVETYARSIKSLLEGEGKVQLLVCLISGTRDDLYGAIKKLCCVQNPVPSQVINTRTISQ--PQKLRSIAQKILLQINCKLGGELWGVDIPLKSVMVIGMDVYHDPSRGMRSVLGFVASINSCLTAWYSRVVFQLPNQEIMDSLKLCLVAALQKFFEVNHSLPEKIVVYRDGVSDGQLNTVENYEIPQLQTCFQT-FDNYN-PRMVVIVVQKRVSTNLYSTATGQFLTPQPGTVIDHTVTNRKWIDFFLMSHHVRQGCGIPTHYICVMNT----------ANLGPDHLQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQFLHHE---PSI--KLCDKLFFL 949          

HSP 2 Score: 61.6178 bits (148), Expect = 2.109e-9
Identity = 62/279 (22.22%), Postives = 121/279 (43.37%), Query Frame = -1
Query: 1591 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKD---VEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISR 2367
            K G  G    L  N    N + E   Y Y V    ++E +S+R      +   +    G    FDG  L+   K     + E+    D   ++I+I++      +S+      N+V   +   +  + +GR F+  ++          +  +    ++  GY+  I R T+        L ++  ++++  ++V+ +           ++ +   QL+G  +IT+YNN+TYRI DI+  M   D   + D  K+S+++Y+ + Y I +K   QP ++ R
Sbjct:  193 KKGSKGSPCQLGLNLIKINFQNEA-VYQYHVTFTPIVECRSMR----FGMMKDHRSVTGPVTAFDGSILYLPVKLAQTVELESERRTDGQKIKITIQMTKILDPSSDLCLPFYNVVMRRVFKILDLKLVGRNFYDPASS---------TVLQQYRLQVWPGYAANI-RKTD----GGLFLLVDITHKIIRSDSVLDIMNILYQQSPENFQDEVTKQLVGSIVITRYNNRTYRIDDIEWNMSPKDSFSMSDGSKVSFIDYYSKNYGITVKELDQPLLLHR 452          
BLAST of SMEDWI-1 vs. Ensembl Xenopus
Match: piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:Xenbase;Acc:XB-GENE-993661])

HSP 1 Score: 157.918 bits (398), Expect = 1.461e-39
Identity = 123/450 (27.33%), Postives = 213/450 (47.33%), Query Frame = -2
Query:   54 MKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDV-PKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMAL-VFIPDDKVYAKVKNFTMSTG--LLTQCV---TQRNGSNRDDRRRK----TVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVF-SISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQT--LPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1343
            ++ WG+ +++Q I + GR   P  IF  +       P DW        V        + +L   RN     N ++ + +    +  +  M  I      +VED    F+R  + ++   + +P   V + V+ F  S+   ++ +C         + R   +R      V  +   +++  LG   + I +     ++  +    S+T G+  ++AS+  S+S  F+ + S     K  ++F + L      A+  +Q   N +P R+++YRDGVGD QL     +E   + +++    E +T   P++  +VV+K+   +F+        NP  GT+VD +  +P +Y+FYL+SQ   +GT +PT YNVL+D           + + P  +Q++TY L HLY+NW G IRVP P  YAH+L  LVG+ IHR  +P      +  +LFYL
Sbjct:  372 LEKWGLRMDKQ-IPVTGRIAPPERIFMRDNVCTPGSPADWARDTRNEKVICVAPLQNWLMLFSYRNADVAENLLQCLMKVASGMGFHMDMPRIV-----QVEDNPVSFLRTLQKNVTPDLQLPVCLVSSPVRKFHKSSEARIIAKCCYPPAPLCVALRSVEKRAIDLLCVGTELHTEVYCSLGSQQFCIAMPHKYRIMENISNLWSRTTGRVQIRASIIASVSPSFTLWHSRCIIQKTTSDFADCLKMCMKGAIQNWQRCNNDLPNRIVVYRDGVGDGQLKMVVDYE---IPQLLSSFRETKTSYCPRLSVIVVRKKCISRFYTQTGRGIQNPVLGTIVDSEATRPEWYDFYLISQNARQGTVNPTYYNVLLDE----------NGLKPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLTFLVGQSIHREPSP-----ELSHKLFYL 797          

HSP 2 Score: 63.929 bits (154), Expect = 3.008e-10
Identity = 60/277 (21.66%), Postives = 118/277 (42.60%), Query Frame = -1
Query: 1585 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIK--DVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVV----SVYRRDQID--------QLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISRVK 2367
            K G  G  V L +N     +  +   Y Y V    +    KL+  L Y++ +  G+   F G  LF +         E+   K   V+I+I L      +S    +  ++ F  +   +   ++GR ++  ++         P         +  G+  +I +  ++    + + +     +VL    V+    ++Y +   +        +L+G  ++T+YNNKTYR+ DI       D     D  +I+Y +Y+ Q+Y+IN+ + +QP ++S +K
Sbjct:   39 KTGTSGAPVKLMTNLFGLTLPTQWKLYQYRVDFSPEFASRKLKTALLYSHGETLGRARAFHGEILFLSRNIGKLNHLESTTRKGETVKITITLTNQLPADSPVCLEFCHVYFLRVFKSLNMYQVGRNYYNPAD---------PVIIPQHRLMLWPGFVLSIMKLESQLALCADVSH-----KVLRNETVLDSMKALYSKVPKERFTDICEKELLGLVVLTRYNNKTYRVDDIDWSTKPTDSFPRKDGSEITYTDYYSQQYSINISDLQQPMLVSALK 301          
BLAST of SMEDWI-1 vs. Ensembl Xenopus
Match: ago2 (argonaute RISC catalytic component 2 [Source:Xenbase;Acc:XB-GENE-1001916])

HSP 1 Score: 115.546 bits (288), Expect = 4.146e-26
Identity = 105/379 (27.70%), Postives = 162/379 (42.74%), Query Frame = -2
Query:  111 HFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK-----VHMALVFIPDD-KVYAKVKNFTMST-GLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN----------LKMAPTMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF---------KDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLM-DTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLA-----ELVGKIH 1142
            H   F E + R+I R            C+  +  D++    R  K     + + +V +P    VYA+VK    +  G+ TQCV  +N      R          +++  KLG    G+N          +   P + +G D  H   G   K S+ A V S+ A  ++Y + V   + + E  ++L       L  F       P R+I YRDGV + Q       E  A+ +   K+ E    P I ++VV+KR   + F         K G  P  GT VD KI  P+ ++FYL S    +GT+ P++Y+VL  D +F++ +           LQ +TY L H Y     ++ +P P +YAH +A      LV K H
Sbjct:  481 HLKTFTEQL-RKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYTGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKN----VQRTTPQTLSNLCLKINVKLG----GVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLSAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKL-EKDYQPGITFIVVQKRHHTRLFCTDRNERVGKSGNIPA-GTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDE-----------LQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEH 837          
BLAST of SMEDWI-1 vs. Ensembl Xenopus
Match: ago1 (argonaute RISC catalytic component 1 [Source:Xenbase;Acc:XB-GENE-5933499])

HSP 1 Score: 112.849 bits (281), Expect = 2.876e-25
Identity = 103/351 (29.34%), Postives = 153/351 (43.59%), Query Frame = -2
Query:  111 CRSNEVEDALTDFIR-----VSKVHMALVFIPDD-KVYAKVKNFTMST-GLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN----------LKMAPTMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFET----DAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF---------KDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLM-DTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIH 1061
            C+  +  D++    R      S + + +V +P    VYA+VK    +  G+ TQCV  +N      +    +     +++  KLG    GIN          +   P + +G D  H   G   K S+ A V S+ A  S+Y + V   + + E  E+L       L  F       P R+I YRDGV + QL     +E     DA +K+ EK Y+    P I Y+VV+KR   + F         K G  P  GT VD  I  P  ++FYL S    +GT+ P++Y VL  D +FT  +           LQ +TY L H Y     ++ +P P +YA RL     + H
Sbjct:  492 CKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLC----LKINVKLG----GINNILVPHQRSAVFQQPVIFLGADVTHPPAGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKL-EKDYQ----PGITYIVVQKRHHTRLFCADRSERIGKSGNIPA-GTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADE-----------LQILTYQLCHTYVRCTRSVSIPAPAYYA-RLVAFRARYH 816          
BLAST of SMEDWI-1 vs. Ensembl Mouse
Match: Piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:MGI Symbol;Acc:MGI:1928897])

HSP 1 Score: 201.06 bits (510), Expect = 4.020e-67
Identity = 142/506 (28.06%), Postives = 236/506 (46.64%), Query Frame = -2
Query:   54 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSN--EVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV------SKVHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1517
            ++ IP ELCYL G +D  R++ N+ K+L    +  P +R  ++     +     + +  ++ WG+  +   ++  GR L    I         N +  D  K       +       + ++   RN    N+ I+++ +    + I      +      EV+D    ++R       S   + +  +     DK  A  K         +QCV  R    +  +    +A K  +QM  K+G + W +++ +   MIVG+D +H  T G+RS+   V SI+   +++ S         E  + L      AL  +      MP R+I+YRDGVGD QL     +E    +  ++ +      P++  +VVKKR++ +FF        NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ D+          S + P  +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ IHR       N  +  RL+YL
Sbjct:  381 AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQ-----MKKAIMIEVDDRTEAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYN-PRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDS----------SGLKPDHIQRLTYKLCHVYYNWPGVIRVPAPCQYAHKLAFLVGQSIHR-----EPNLSLSNRLYYL 862          

HSP 2 Score: 75.485 bits (184), Expect = 4.020e-67
Identity = 73/286 (25.52%), Postives = 131/286 (45.80%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSD-----EDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVV----SVYRR-------DQID-QLIGRDIITKYNNKTYRISDIKEMDVNDEV---QLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            K G  G +V L +N+     + +   Y Y +    +ME + +R+ L     + +    G+   FDG  LF   +           T N   + V I+I L       S    Q  NI+F  +   M  ++IGR ++  S+         P         I  G++T+I +  N     + +L  +  ++VL    V+    ++Y++       +Q+  +LIG  ++TKYNNKTYR+ DI + D N +    +    ++S+L Y++++YN  + + KQP ++S+ KR
Sbjct:  105 KTGSSGIIVKLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSAL----LFQHEDLIGRCHAFDGTILFLPKRLQHKVTEVFSQTRNG--EHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSD---------PIDIPNHRLVIWPGFTTSILQYEN-----NIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVSKELIGLIVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR 369          
BLAST of SMEDWI-1 vs. Ensembl Mouse
Match: Piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:MGI Symbol;Acc:MGI:3041167])

HSP 1 Score: 181.8 bits (460), Expect = 2.778e-63
Identity = 135/522 (25.86%), Postives = 241/522 (46.17%), Query Frame = -2
Query:   54 KKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREP---RERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA-HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVH------MALVFIPDDK--VYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQAS-VFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDG----ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1562
            K+  N+   P    Q + +  ELC+L G S    S+  L K +    +  P   +++L  + D  +     + +  +++WG+    Q +++ GR +    I   +         DW        V      +R+ ++  +R       F+  ++R  G +  N     I      +V++    F+R  +VH      + +  +P ++   Y  +K +  S   + +QCV  R  + +      +VA K  MQM  KLG + W + + +   M+VG+D       K  V    V SI+++ +++ S     +   +  + L      AL  +    + +P R+++YRDGVG+ QL    ++E   ++K + +   +    ++  VVV+KR  ++ F        NP  GTVVD +  +P +Y+FYL+SQ   +GT SPT+YNV+ D           + + P  +Q++T+ L HLY+NW G I VP P  YAH+L  LV + +H+    P++   +   LFYL
Sbjct:  356 KRKRNDNSEP----QMVHLMPELCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRNPVARFE--LETWGLHFGSQ-LSLTGRVVPSEKILLQDHTCQPAFAADWSKDMRSCKVLSSQPLNRWLIVCCNRAEHLIEAFLSCLRRVGGSMGFNVGYPKII-----KVDETPAAFLRAIQVHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTML--SVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTECGSDARSCRLSVVVVRKRCLLRLFASTDHTVQNPPLGTVVDSEATRPEWYDFYLISQTANRGTVSPTHYNVIYDD----------NALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHK---EPSLE--LANNLFYL 848          

HSP 2 Score: 82.0333 bits (201), Expect = 2.778e-63
Identity = 72/280 (25.71%), Postives = 124/280 (44.29%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWH---SDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERIN-RVLNENNVV------------SVYRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            K G  G  V L +N  N ++  +   Y Y V         +L + L Y +S  + +   FDG  LF + K     ++  +E    + ++I++ L +    NS    Q  N++F  I   +   +IGR F+  S          P         +  G++ +++         S LL+   +N +VL    V+            S +      QL+G  ++T+YNNKTYRI DI   +      Q  D  +++Y++Y+KQ+Y+I L +  QP ++S +KR
Sbjct:   93 KTGSSGIPVRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYNHSILSDKAKAFDGASLFLSEKLDQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFYKPSE---------PVEIPQYKLSLWPGFAISVSH------FESKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTRYNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKR 357          
BLAST of SMEDWI-1 vs. Ensembl Mouse
Match: Piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:MGI Symbol;Acc:MGI:1928897])

HSP 1 Score: 166.392 bits (420), Expect = 1.131e-56
Identity = 120/462 (25.97%), Postives = 210/462 (45.45%), Query Frame = -2
Query:  183 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSN--EVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV------SKVHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNW 1517
            ++ IP ELCYL G +D  R++ N+ K+L    +  P +R  ++     +     + +  ++ WG+  +   ++  GR L    I         N +  D  K       +       + ++   RN    N+ I+++ +    + I      +      EV+D    ++R       S   + +  +     DK  A  K         +QCV  R    +  +    +A K  +QM  K+G + W +++ +   MIVG+D +H  T G+RS+   V SI+   +++ S         E  + L      AL  +      MP R+I+YRDGVGD QL     +E    +  ++ +      P++  +VVKKR++ +FF        NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ D+          S + P  +Q++TY L H+Y+NW
Sbjct:  381 AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQ-----MKKAIMIEVDDRTEAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYN-PRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDS----------SGLKPDHIQRLTYKLCHVYYNW 823          

HSP 2 Score: 75.0998 bits (183), Expect = 1.131e-56
Identity = 73/286 (25.52%), Postives = 131/286 (45.80%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSD-----EDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVV----SVYRR-------DQID-QLIGRDIITKYNNKTYRISDIKEMDVNDEV---QLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            K G  G +V L +N+     + +   Y Y +    +ME + +R+ L     + +    G+   FDG  LF   +           T N   + V I+I L       S    Q  NI+F  +   M  ++IGR ++  S+         P         I  G++T+I +  N     + +L  +  ++VL    V+    ++Y++       +Q+  +LIG  ++TKYNNKTYR+ DI + D N +    +    ++S+L Y++++YN  + + KQP ++S+ KR
Sbjct:  105 KTGSSGIIVKLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSAL----LFQHEDLIGRCHAFDGTILFLPKRLQHKVTEVFSQTRNG--EHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSD---------PIDIPNHRLVIWPGFTTSILQYEN-----NIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVSKELIGLIVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR 369          
BLAST of SMEDWI-1 vs. Ensembl Mouse
Match: Piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:MGI Symbol;Acc:MGI:1930036])

HSP 1 Score: 161.384 bits (407), Expect = 4.587e-52
Identity = 116/477 (24.32%), Postives = 220/477 (46.12%), Query Frame = -2
Query:  114 ELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGK-SKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGT--AHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV----SKVHMALVFI--PDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGAN----PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKI 1499
            EL ++ G  +  + +    K+L   +   P++    +    +     + + + +  WG+ + +    I GR L    I        T    +W   E+  D    T   H + +    R        +  +++  G + +  +  +    + + +E  +     +     K+ M +  I    D +Y  +K    + + + +Q +  R        R ++VA K ++QM  KLG + WG+++ +   M++G+D +H  + G RSV   V SI+   +++ S V       E  ++L    + +L  +    + +P ++++YRDGV D QL     +E   + K  E  ++N   P+++  VV+K+IS   +    +    P+PGTVVD  I    + +FYL++    +G   PT+Y  +++T          + +SP  +Q++T+ L H+Y+NW GTIRVP P  YAH+LA L G+I
Sbjct:  494 ELSFMTGIPEKMKKDFRAMKDLTQQINLSPKQHHGALECLLQRISQNETASNELTRWGLSLHKDVHKIEGRLLPMERINLRNTSFVTSEDLNW-VKEVTRDASILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRISPPAWVELKDDRIETYIRTIQSLLGVEGKIQMVVCIIMGTRDDLYGAIKKLCCVQSPVPSQVINVRTIGQ--PTRLRSVAQKILLQMNCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKYYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEA-FDNYH-PKMVVFVVQKKISTNLYLAAPDHFVTPSPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYICVLNT----------ANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQI 955          

HSP 2 Score: 65.0846 bits (157), Expect = 4.587e-52
Identity = 53/192 (27.60%), Postives = 92/192 (47.92%), Query Frame = -1
Query: 1591 DVEISIRL-LTTFLKN-SEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERI-NRVLNENNVVSVYR----------RDQIDQL-IGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISR 2118
            D EISI++ LT  L+  S+      N+VF  +   +  + +GR F+  ++             +    +I  GY+ +I R      T   L  L  + ++V+  ++V+ V            +D+  +L +G  +IT+YNN+TYRI D+       D   + D K+I++L Y+ + Y I +K D QP +I R
Sbjct:  297 DAEISIKIQLTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSA---------MVLQQHRLQIWPGYAASIRR------TDGGLFLLADVSHKVIRNDSVLDVMHAIYQQNKEHFQDECSKLLVGSIVITRYNNRTYRIDDVDWNKTPKDSFVMSDGKEITFLEYYSKNYGITVKEDDQPLLIHR 473          
BLAST of SMEDWI-1 vs. Ensembl Mouse
Match: Piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:MGI Symbol;Acc:MGI:3041167])

HSP 1 Score: 173.326 bits (438), Expect = 9.966e-46
Identity = 119/446 (26.68%), Postives = 210/446 (47.09%), Query Frame = -2
Query:   54 MKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA-HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVH------MALVFIPDDK--VYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQAS-VFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDG----ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1343
            +++WG+    Q +++ GR +    I   +         DW        V      +R+ ++  +R       F+  ++R  G +  N     I      +V++    F+R  +VH      + +  +P ++   Y  +K +  S   + +QCV  R  + +      +VA K  MQM  KLG + W + + +   M+VG+D       K  V    V SI+++ +++ S     +   +  + L      AL  +    + +P R+++YRDGVG+ QL    ++E   ++K + +   +    ++  VVV+KR  ++ F        NP  GTVVD +  +P +Y+FYL+SQ   +GT SPT+YNV+ D           + + P  +Q++T+ L HLY+NW G I VP P  YAH+L  LV + +H+    P++   +   LFYL
Sbjct:   36 LETWGLHFGSQ-LSLTGRVVPSEKILLQDHTCQPAFAADWSKDMRSCKVLSSQPLNRWLIVCCNRAEHLIEAFLSCLRRVGGSMGFNVGYPKII-----KVDETPAAFLRAIQVHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTML--SVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTECGSDARSCRLSVVVVRKRCLLRLFASTDHTVQNPPLGTVVDSEATRPEWYDFYLISQTANRGTVSPTHYNVIYDD----------NALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHK---EPSLE--LANNLFYL 458          
BLAST of SMEDWI-1 vs. UniProt
Match: sp|Q2Q5Y9|PIWI1_SCHMD (Piwi-like protein 1 OS=Schmidtea mediterranea GN=wi-1 PE=2 SV=1)

HSP 1 Score: 1049.27 bits (2712), Expect = 0.000e+0
Identity = 503/504 (99.80%), Postives = 504/504 (100.00%), Query Frame = -2
Query:   54 KKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1565
            K+KTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL
Sbjct:  305 KEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          

HSP 2 Score: 627.091 bits (1616), Expect = 0.000e+0
Identity = 306/307 (99.67%), Postives = 307/307 (100.00%), Query Frame = -1
Query: 1558 MDSTNVTSDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK 2478
            MDSTNVT+DPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
Sbjct:    1 MDSTNVTTDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK 307          
BLAST of SMEDWI-1 vs. UniProt
Match: sp|Q2PC95|PIWIL_DUGJA (Piwi-like protein OS=Dugesia japonica GN=iwi PE=2 SV=1)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 298/509 (58.55%), Postives = 386/509 (75.83%), Query Frame = -2
Query:   54 KKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKS-WGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1565
            K+K  NE E P + D +L+I GELC+LCGFSD E+SNI+LQKNLG VLKR PRERL+DI  FC W     +   M + WG+ I+  P+ I GREL   D+ S   +IN KI DDWKFG+++F+V KG  H   V++VDRN S + NF+ DV+ EI +LR +  +  +  C +N+VE +L D +R       +ALVF+PDD+VYAKVK+FT+STGLLTQCVT RNG+NR+D+RR+ V+ K+VMQ+FSK GYDPW I++KM PTMIVG+DTFH+K  K+S+ ASVFSI++ FSQY+SF NS KGK EFH+ L  NF  ALT F+  +  +P+R+++YRDGVGDSQL FTK+FE DA+  ++E IY+     +PQIIYV+VKKRI  K F  G N NPGT+VD++IVKPNF+EF+LVSQ+ T+GTASPTNYNVL DT++ N K   +  ++P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAH+LAEL+GK+H+G TP  IN+RIR RLFYL
Sbjct:  311 KRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQN-KAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          

HSP 2 Score: 317.005 bits (811), Expect = 0.000e+0
Identity = 153/297 (51.52%), Postives = 211/297 (71.04%), Query Frame = -1
Query: 1558 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSI--RTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIRE--GPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK 2436
            RRGGLQ+RF I+EP LQP+   DKIG  G+VV L+SN+  F++     + MYD       +  + KL++L+      N    FC+DGRRLFT+  W    D +   I + ++S+RL++TFL ++EEYYQMIN++ NN+QI MGQEKIG+ +FLGSN     + +  GP+FF+ +NFK+LGG+ TT+ RGT  NG  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDI+TKYNNKTYRIS+IKEM++N+  ++  + +SY  YFK+RYNINL  ++QPFV++RVK+   R K K
Sbjct:   17 RRGGLQKRFRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRK 313          
BLAST of SMEDWI-1 vs. UniProt
Match: sp|Q2Q5Y8|PIWI2_SCHMD (Piwi-like protein 2 OS=Schmidtea mediterranea GN=wi-2 PE=2 SV=1)

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 294/496 (59.27%), Postives = 381/496 (76.81%), Query Frame = -2
Query:   54 DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYM-KSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISF-VNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQT--LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1523
            D +L+IPGELC+LCGFSD E+SN++LQKNLG VLKREPRERL+DI  +C W     +   M   W + I+ +P+ I GREL P D+ S   KIN K+ DDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SF VNS KG+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY+     +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P AIN+RIR RLFYL
Sbjct:  339 DMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          

HSP 2 Score: 300.442 bits (768), Expect = 0.000e+0
Identity = 144/292 (49.32%), Postives = 201/292 (68.84%), Query Frame = -1
Query: 1570 RGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVR 2433
            RGGL+  F I+EP LQP  +T+K G  GR V L+SN+  F++     F MYD V     +  K++L       + N  P  FCFDGRRLFT+ KWH + D +     + ++++RL++T L  +EEYYQMIN++ NN+Q+ +GQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK+RYNI L    QPFV++RVK+ M R
Sbjct:   25 RGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRR 316          
BLAST of SMEDWI-1 vs. UniProt
Match: sp|Q8UVX0|PIWL1_DANRE (Piwi-like protein 1 OS=Danio rerio GN=piwil1 PE=1 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.070e-74
Identity = 152/502 (30.28%), Postives = 244/502 (48.61%), Query Frame = -2
Query:   54 ELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDI-RDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKIN-TKIPDDWKFGEIKFDVPKGTAHRFG---VLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV------SKVHMALVFIP---DDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFK--DG--ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1499
            E CYL G +D  R++ N+ K+L +  +  P +R   I R        G  ++ + +WG+  E + +++ GR L    I              DW   E++  +P  +        +    RN     + ++ + +  G + I      +      E ED     +R        +  M +V +P    DK     K   +     +QCV  R  S    +   TVA K  +QM  K+G + W + + +   MIVG+D +H +  GKRS+ A V S++   S++ S         E  + L  +   AL  +    N++P R+I+YRDGVGD  L     +E   +M+ I+ + ++   P++  VVVKKRIS +FF   DG  ANP PGTV+D ++ +P +Y+F++VSQ    G  +PT+YNV+ D           S + P  +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ IH+    P +N  + + L+YL
Sbjct:  382 EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWS-KEMR-GLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIR-----MQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISK--PQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN----------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHK---EPNMN--LDDFLYYL 858          

HSP 2 Score: 89.3521 bits (220), Expect = 1.070e-74
Identity = 84/307 (27.36%), Postives = 136/307 (44.30%), Query Frame = -1
Query: 1582 RGGLQRRF---AIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED---TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVY---RRDQIDQ---------LIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2433
            RGG +R F    +    L       K G  G  + L++N+     +     Y Y V     ME++ +R+ L     + + +  G+   FDG  LF  +K  + E    +E    + VEI++ L      +S    Q  NI+F  I   +  ++IGR ++   +         P         I  G+ TTI +       +S +L  +  ++VL    V+      R+   DQ         L+G  I+TKYNNKTYRI DI  +   N+  + GD +IS+ NYFK +Y +++ +  Q  ++S VKR
Sbjct:   77 RGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLLSRPMWALYQYHVDYKPPMESRRLRSAL----LFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDD---------PFNIPQHRLTIWPGFMTTILQYE-----SSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKR 365          
BLAST of SMEDWI-1 vs. UniProt
Match: sp|Q9VKM1|PIWI_DROME (Protein piwi OS=Drosophila melanogaster GN=piwi PE=1 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 3.890e-69
Identity = 144/477 (30.19%), Postives = 233/477 (48.85%), Query Frame = -2
Query:  120 IPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDF-CKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWK--FGEIK-FDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGR--LRINYTMD-SISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSIS-AKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTL--PQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVG 1508
            IP ELC + G +   RSN  L + + +  +  P++R + +R F  +     +S   ++ W M +++    ++GR +   +I  +  K+      DW+  F + +    P     R+ V+   RN       ++ + R      LRI    +  I   R+     A+ D +R S   + L  +P+D    Y+ +K    +   + TQ VT +   NR      ++A K  +Q+  KLGY PW I L ++  M +G D   S +  KR+  A + S+   + S Y S V      +     L      AL  +Q++   +P R++ YRDGV    L    +FE   +++ ++  Y    L  PQ+ Y+VV + ++ +FF +G NP PGT+VD+ I  P  Y+FYLVSQ+  +GT SPT+YNVL  +            +SP  +Q++TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:  364 IP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVR-SDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRS---LMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMG----------LSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          

HSP 2 Score: 75.0998 bits (183), Expect = 3.890e-69
Identity = 75/283 (26.50%), Postives = 130/283 (45.94%), Query Frame = -1
Query: 1591 QPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMEN--KSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIK-DVE--ISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFF-LGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRD----------IITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISR 2388
            +P  +  K G DG  V L++N+     K E     Y V  E   ++ R ++ +L  +AN   +G  + FDG +LFTT K+  +    +   K D+E  ISI+ +         + Q++N++       +  E +GR  F   +  E   IRE    FKM+   +  GY T+I +   +      LL  E  ++V+    +  + RR   +    +D          ++T YNN+TYRI+D+              + IS++ Y+  +YNI +++  QP +IS+
Sbjct:   82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRAKIE---IRE----FKME---LWPGYETSIRQHEKD-----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK 347          
BLAST of SMEDWI-1 vs. TrEMBL
Match: tr|D2Z0D8|D2Z0D8_DUGJA (DjPiwiA OS=Dugesia japonica GN=DjpiwiA PE=2 SV=1)

HSP 1 Score: 963.37 bits (2489), Expect = 0.000e+0
Identity = 452/504 (89.68%), Postives = 483/504 (95.83%), Query Frame = -2
Query:   54 KKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1565
            K+K+ENEPEGP E DQSLSIPGELCYLCGFSDSERSN+NLQK+LG VLKREPRERLNDI+DFCKWTG GKSK++M +W M IEEQPITIRGREL PVDI SN+VKIN KIPDDWKFGE+KFDVPKG AHRFGVLVVDRNP+HFNNFI+DVKREIGRLRINYT+D+ISSCR NEVE+AL++F+RV+KVH+ALVFIPDDK+YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSIS+KFSQYISFVNSSKGKNEFHENLGKNFLTA+TTFQ KF TMP R IIYRDGVGDSQLAFTKKFET+AVMKMIEKIYENQ LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQ+TTKGTASPTNYNVLMDTK+ NKKTNE+S M+PSVLQQIT+SLTHLYFNWMGTIRVPVPTHYAHRLAELVGK+HRG TPP IN+RIRERLFYL
Sbjct:  306 KEKSENEPEGPKEMDQSLSIPGELCYLCGFSDSERSNLNLQKSLGGVLKREPRERLNDIKDFCKWTGGGKSKNFMTNWNMSIEEQPITIRGRELPPVDIASNDVKINAKIPDDWKFGEVKFDVPKGIAHRFGVLVVDRNPNHFNNFIDDVKREIGRLRINYTIDNISSCRGNEVEEALSEFVRVNKVHLALVFIPDDKIYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISSKFSQYISFVNSSKGKNEFHENLGKNFLTAITTFQQKFGTMPHRFIIYRDGVGDSQLAFTKKFETEAVMKMIEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYNNKKTNEISPMAPSVLQQITFSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGATPPTINERIRERLFYL 809          

HSP 2 Score: 534.258 bits (1375), Expect = 1.487e-172
Identity = 258/309 (83.50%), Postives = 281/309 (90.94%), Query Frame = -1
Query: 1555 MDSTNVTSDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVR-PKEKN 2478
            MD TNV  DP  RPRRGGLQRRFAIIEPALQP+T+ DK+GKDGRVV+LKSNYANF+IKVEGPFYMYDVVME KSIR+KLELLLAY  +K +GQPFCFDGRRLFTT+KW+  +D E   + +VEISIRLLTTFLKNSEEYYQMINIVFNNIQ+FMGQEKIGRQFFLGSNCESGGIREGPSFFKM+NFKILGGYSTTITRGTN++GTASTLLYLERINRVLNEN+V++VYRRDQIDQLIGRDIITKYNNKTYRISDIKEMD NDE+ L   KISY NYFKQRYNINLK DKQPFVISR+KRS    PKEK+
Sbjct:    1 MDITNVPRDPASRPRRGGLQRRFAIIEPALQPETIIDKVGKDGRVVNLKSNYANFSIKVEGPFYMYDVVMEPKSIRSKLELLLAYGKTKGDGQPFCFDGRRLFTTTKWNRTDDVEKFTVNNVEISIRLLTTFLKNSEEYYQMINIVFNNIQLFMGQEKIGRQFFLGSNCESGGIREGPSFFKMENFKILGGYSTTITRGTNDDGTASTLLYLERINRVLNENSVLAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDFNDEIDLNGSKISYSNYFKQRYNINLKTDKQPFVISRIKRSAAHNPKEKS 309          
BLAST of SMEDWI-1 vs. TrEMBL
Match: tr|T1E104|T1E104_9PLAT (PIWI-1 OS=Dendrocoelum lacteum PE=2 SV=1)

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 380/505 (75.25%), Postives = 444/505 (87.92%), Query Frame = -2
Query:   54 QKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1568
            +K+  ENEP+ P E DQSLSIPGELC+LCGFSD+ERSNINLQK+LG+VLKREPRERLNDI DFC WT  GK+  +MK WG+ IE+QPITI+GREL  VD+FSN  +INTK  DDWKFGE+KFD+P+G  HRFG+LV+DRN + FN FI+D+KRE+ RLRIN T++++SSCR+NE+EDALTDF+RV KVHMA+VFI DDKVYA+VKNFT+STGLLTQCVT RN +NRDDRRRK VADKSVMQMF+KLGYDPWG+ LKM PTM+VGLDTFHSKTGKRS+QASVFSIS KFSQY+SFVNSSKGKNE+H+NL +NF +A+ TF++KFNT+P R IIYRDGVGDSQL FTKK+ETD V+K++EK+YEN  LPQIIY++VKKRISVKFFKDG NPNPGT+VDE +VKPNFYEFYLVSQ+TTKGTA+PTNYNVLMDT+ TN    +  +  P  LQ ITY+LTHLYFNWMGTIRVPVPTHYAHRLAELVG +HRG  PP I+DRIRERLFYL
Sbjct:  298 RKENIENEPDAPKEADQSLSIPGELCFLCGFSDNERSNINLQKSLGSVLKREPRERLNDIADFCHWTKEGKADSFMKKWGVEIEDQPITIKGRELNGVDVFSNRQRINTKSSDDWKFGEVKFDIPQGAQHRFGILVIDRNANQFNQFIDDMKREMSRLRINNTIEAVSSCRANEIEDALTDFVRVQKVHMAIVFIGDDKVYARVKNFTISTGLLTQCVTIRNATNRDDRRRKVVADKSVMQMFAKLGYDPWGVELKMVPTMVVGLDTFHSKTGKRSIQASVFSISHKFSQYLSFVNSSKGKNEYHDNLVQNFTSAIKTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDEVLKLMEKLYENMRLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEMVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNNAGVKAPI-PPGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 801          

HSP 2 Score: 409.453 bits (1051), Expect = 0.000e+0
Identity = 193/293 (65.87%), Postives = 244/293 (83.28%), Query Frame = -1
Query: 1561 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVME-NKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKE 2436
            +RGGLQ+RF IIEP LQP  + +K+GK+G++VSLKSNYANF +K +GPF MYDV M   KS+R KLE+L A A  K   +P+CFDGRRLFT S+WH+ E  ++  +K+ E+S+R LT+FL+N+EEYYQM+NI+FNN+Q FMGQE+IGR FFLGSNC+    R GP+FFK DNFKILGG+STT+TRGTN +GTASTLLYLERINRVLNEN+V ++Y ++Q+D LIGRD+ITKYNNKTYRISDIKE+D+ DE++L DKKISY +YFKQRYNI L + KQPFVISR++R  ++ KE
Sbjct:    9 KRGGLQKRFYIIEPVLQPAEIVEKVGKEGKIVSLKSNYANFKLKPKGPFCMYDVKMSVGKSLRGKLEILGAVAALKEPNEPYCFDGRRLFTASEWHNSE-IQSFTVKEEEVSLRFLTSFLENTEEYYQMVNIIFNNVQSFMGQERIGRAFFLGSNCDEVTSRYGPTFFKKDNFKILGGFSTTLTRGTNNDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEIDIKDEIELNDKKISYADYFKQRYNITLNHAKQPFVISRMRRIAIQRKE 300          
BLAST of SMEDWI-1 vs. TrEMBL
Match: tr|G9B7B7|G9B7B7_9PLAT (Piwi A (Fragment) OS=Phagocata kawakatsui GN=piwiA PE=2 SV=1)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 324/465 (69.68%), Postives = 396/465 (85.16%), Query Frame = -2
Query:  171 KKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTI 1565
            K+  EN+P+ P E D SLSIPGELC+LCGFSDSERSN+NLQK+LG+VLKREPR+RL DI DFC WT  G++  ++  WG+ ++ QP+TI GREL  +D+FSN+  IN +  DDWKFGEIKFD+P G  HRF VLVV+RNP+ F  FI+D+KREIGRLR+ YT+D++ SC+SNE+ED L+DF+R+ KVHMA+VFI DDK YA+VKNFT++TGLLTQCVT RN +NRDDRRRK VADK+VMQ+F+KLGYDPW I LKM PTM+VG+DTFHSKTG+RS+QA+VFSIS++FSQY+SFVNS KG+NE+HENL +NF  A+ TF++KFNT+P R +IYRDGVGDSQL FTKK+ETDAVM+++E IYEN+ LPQI+YV+VKKRI+VKFFKDG NPNPGT+VDEKIVKPNFYEFYLVSQ+TTKGT++PTNYNVLMDT   N+ T     M+P  LQ  TY LTHLYFNWMGTI
Sbjct:   71 KENLENQPDTPREADLSLSIPGELCFLCGFSDSERSNVNLQKSLGSVLKREPRDRLRDISDFCSWTNDGRAAPFIHQWGLMLDNQPVTIIGRELKGIDVFSNKKPINGRQMDDWKFGEIKFDIPVGAQHRFAVLVVERNPAQFTQFIDDMKREIGRLRVTYTIDTVQSCKSNEIEDYLSDFVRIQKVHMAVVFIGDDKNYARVKNFTITTGLLTQCVTVRNATNRDDRRRKVVADKTVMQIFAKLGYDPWSIELKMVPTMVVGMDTFHSKTGRRSIQAAVFSISSRFSQYLSFVNSPKGRNEYHENLSQNFKAAIKTFRDKFNTLPQRFVIYRDGVGDSQLYFTKKYETDAVMRIVESIYENRMLPQIVYVIVKKRIAVKFFKDGNNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTSTPTNYNVLMDTGLPNQTTVVRVPMTPGQLQHFTYVLTHLYFNWMGTI 535          

HSP 2 Score: 81.6481 bits (200), Expect = 1.351e-12
Identity = 41/72 (56.94%), Postives = 54/72 (75.00%), Query Frame = -1
Query: 1561 LIGRDIITKYNN-KTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKE 1773
            L+GRD++T+    K   ISDIKE+DV +E+ L   KISY++YFKQRYNI L N KQPFVIS+++R M+  KE
Sbjct:    1 LLGRDVLTQIQIIKHTEISDIKEIDVTEEIDLNGTKISYMDYFKQRYNITLTNGKQPFVISKMRRVMINVKE 72          
BLAST of SMEDWI-1 vs. TrEMBL
Match: tr|G9B7C2|G9B7C2_9PLAT (Piwi B (Fragment) OS=Seidlia auriculata GN=piwiB PE=2 SV=1)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 306/493 (62.07%), Postives = 391/493 (79.31%), Query Frame = -2
Query:   54 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTG-AGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQT--LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1517
            +L+IPGELC+LCGFSD E+ NI+LQKNLG +LKREPR+RL+DI  FC W G   K   +MK WG+ +E +P+ I GREL PVD+ S   K+N +IPDDWKFG ++F      ++   +++VDRN  ++  FI+DVK E+  L +N  + S+  C  N++E+ LT  +R S+  V MA+VF+PDDKVYA+VKNFTMSTGLLTQCVT RNG+NR D+RR+ VA KSVMQ+FSK GYDPW + +K+ PTMIVGLDT+H+KTGK+S+QASV+SI++ F+QY+SFVNS  G+ EFHE LG+NF  AL  F +K+   P R++IYRDGVGDSQ+ FTK+FE DA+  ++EK+Y+++   +PQIIYVVVKKRIS KFFK+G NP PGT+VD+++VKPNFYEF+LVSQ+TTKGTASPTNYNVL DTK   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVP PTHYAHRLAEL+GKIH+G  PP INDRIR+RLFYL
Sbjct:  294 TLNIPGELCFLCGFSDQEKGNIDLQKNLGGILKREPRQRLDDIPAFCDWIGKCEKVNSFMKEWGLRVENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVRFATSSRKSYEIDIVIVDRNDFNYQKFIQDVKTELKNLNVNAKVTSVEKCGPNDIENILTSIMRQSRDAVKMAMVFVPDDKVYARVKNFTMSTGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWSVEIKLRPTMIVGLDTYHNKTGKKSIQASVYSINSTFTQYLSFVNSPHGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKK-GSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPPVINDRIRDRLFYL 785          

HSP 2 Score: 296.59 bits (758), Expect = 0.000e+0
Identity = 140/273 (51.28%), Postives = 202/273 (73.99%), Query Frame = -1
Query: 1561 IGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSI--RTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKD-VEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREG--PSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKE 2364
            +G  G+ V L SN+A F I     +YMYDVV+ +  +  + KL+++       +   PFCFDGRRLFT  KWH++ D      +D  +++IRL+T     +EEYYQM+N++FNNIQ+FMGQE+IGR +FLG+N +   I +G  P++F+++NF++LGG+STT+ RGT  +GT+STLLY+ERINRVLNEN+VV+ Y + + D L+GRD+ITKYNNKTYRISDIKEM V ++  L  +K+SY +YFK+RYNI L++  QPFV++R++R++VR K+
Sbjct:    1 MGNIGKTVKLASNFAKFQICQLETYYMYDVVLSDLGVAPKAKLKIISKVQEMNDLKGPFCFDGRRLFTGEKWHNESDIREFAAEDDKKVTIRLITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDIAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRADTLVGRDVITKYNNKTYRISDIKEMSVGEQFDLSGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTIVRKKK 273          
BLAST of SMEDWI-1 vs. TrEMBL
Match: tr|D2Z0D9|D2Z0D9_DUGJA (DjPiwiB OS=Dugesia japonica GN=DjpiwiB PE=2 SV=1)

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 296/500 (59.20%), Postives = 388/500 (77.60%), Query Frame = -2
Query:   54 GPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYM-KSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1538
             P + D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  +  + + M   W + IE +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVN  KG+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY++    +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G +P  IN+RIR RLFYL
Sbjct:  330 APQDKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIKSSDNANGMCNKWQLKIENKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMSDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNSPAVINERIRNRLFYL 828          

HSP 2 Score: 293.123 bits (749), Expect = 0.000e+0
Identity = 143/289 (49.48%), Postives = 193/289 (66.78%), Query Frame = -1
Query: 1558 FAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK 2412
            F I+EP LQP  + +K G  GR V L+SN+  F++     F MYD V     I  K++L       + N  P  FCFDGRRLFT+ KWH + D +     D ++++RL+ T L  +EEYYQMIN++ NN+QI MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM V+++ ++  + +SY  YFK RYNI L    QPFV++RVK+ M R + K
Sbjct:   24 FRIVEPNLQPAEIIEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFTQVGIPPKVKLQFIVRVCQENRLPGAFCFDGRRLFTSEKWHGESDIQEFTYDDKKMTLRLVATILPETEEYYQMINVLLNNLQIMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMSVDEKFEMSGRTLSYAEYFKDRYNIRLSQGDQPFVLTRVKKPMRRERRK 312          
The following BLAST results are available for this feature:
BLAST of SMEDWI-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
PIWIL12.148e-6728.21piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL12.148e-6728.21piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL32.389e-6228.79piwi like RNA-mediated gene silencing 3 [Source:HG... [more]
PIWIL32.389e-6228.79piwi like RNA-mediated gene silencing 3 [Source:HG... [more]
PIWIL31.507e-6028.73piwi like RNA-mediated gene silencing 3 [Source:HG... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
prg-17.109e-5927.86Piwi-like protein [Source:RefSeq peptide;Acc:NP_4... [more]
prg-24.834e-5327.81Piwi-like protein [Source:RefSeq peptide;Acc:NP_5... [more]
alg-21.029e-2825.45pep:known chromosome:WBcel235:II:874160:878954:1 g... [more]
alg-21.549e-2825.45pep:known chromosome:WBcel235:II:873176:878954:1 g... [more]
alg-13.667e-2729.38pep:known chromosome:WBcel235:X:13951262:13956256:... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
piwi5.146e-7030.19piwi [Source:FlyBase gene name;Acc:FBgn0004872][more]
piwi5.146e-7030.19piwi [Source:FlyBase gene name;Acc:FBgn0004872][more]
aub9.070e-6729.90aubergine [Source:FlyBase gene name;Acc:FBgn000014... [more]
aub1.018e-6629.90aubergine [Source:FlyBase gene name;Acc:FBgn000014... [more]
AGO36.042e-5529.26Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
piwil11.496e-7530.28piwi-like RNA-mediated gene silencing 1 [Source:ZF... [more]
piwil11.496e-7530.28piwi-like RNA-mediated gene silencing 1 [Source:ZF... [more]
piwil24.760e-4425.84piwi-like RNA-mediated gene silencing 2 [Source:ZF... [more]
piwil24.760e-4425.84piwi-like RNA-mediated gene silencing 2 [Source:ZF... [more]
piwil22.360e-4332.98piwi-like RNA-mediated gene silencing 2 [Source:ZF... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
piwil38.099e-4427.42piwi-like RNA-mediated gene silencing 3 [Source:Xe... [more]
piwil21.019e-4124.73piwi-like RNA-mediated gene silencing 2 [Source:Xe... [more]
piwil41.461e-3927.33piwi-like RNA-mediated gene silencing 4 [Source:Xe... [more]
ago24.146e-2627.70argonaute RISC catalytic component 2 [Source:Xenba... [more]
ago12.876e-2529.34argonaute RISC catalytic component 1 [Source:Xenba... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Piwil14.020e-6728.06piwi-like RNA-mediated gene silencing 1 [Source:MG... [more]
Piwil42.778e-6325.86piwi-like RNA-mediated gene silencing 4 [Source:MG... [more]
Piwil11.131e-5625.97piwi-like RNA-mediated gene silencing 1 [Source:MG... [more]
Piwil24.587e-5224.32piwi-like RNA-mediated gene silencing 2 [Source:MG... [more]
Piwil49.966e-4626.68piwi-like RNA-mediated gene silencing 4 [Source:MG... [more]
back to top
BLAST of SMEDWI-1 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2Q5Y9|PIWI1_SCHMD0.000e+099.80Piwi-like protein 1 OS=Schmidtea mediterranea GN=w... [more]
sp|Q2PC95|PIWIL_DUGJA0.000e+058.55Piwi-like protein OS=Dugesia japonica GN=iwi PE=2 ... [more]
sp|Q2Q5Y8|PIWI2_SCHMD0.000e+059.27Piwi-like protein 2 OS=Schmidtea mediterranea GN=w... [more]
sp|Q8UVX0|PIWL1_DANRE1.070e-7430.28Piwi-like protein 1 OS=Danio rerio GN=piwil1 PE=1 ... [more]
sp|Q9VKM1|PIWI_DROME3.890e-6930.19Protein piwi OS=Drosophila melanogaster GN=piwi PE... [more]
back to top
BLAST of SMEDWI-1 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|D2Z0D8|D2Z0D8_DUGJA1.487e-17289.68DjPiwiA OS=Dugesia japonica GN=DjpiwiA PE=2 SV=1[more]
tr|T1E104|T1E104_9PLAT0.000e+075.25PIWI-1 OS=Dendrocoelum lacteum PE=2 SV=1[more]
tr|G9B7B7|G9B7B7_9PLAT1.351e-1269.68Piwi A (Fragment) OS=Phagocata kawakatsui GN=piwiA... [more]
tr|G9B7C2|G9B7C2_9PLAT0.000e+062.07Piwi B (Fragment) OS=Seidlia auriculata GN=piwiB P... [more]
tr|D2Z0D9|D2Z0D9_DUGJA0.000e+059.20DjPiwiB OS=Dugesia japonica GN=DjpiwiB PE=2 SV=1[more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 15..32
NoneNo IPR availableTMHMMTMhelixcoord: 53..72
NoneNo IPR availableCOILSCoilCoilcoord: 523..523
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 111..272
e-value: 2.6E-15
score: 56.3
NoneNo IPR availableTMHMMTMhelixcoord: 15..32
NoneNo IPR availableTMHMMTMhelixcoord: 21..39
NoneNo IPR availableCOILSCoilCoilcoord: 18..38
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableGENE3DG3DSA:2.170.260.10coord: 284..348
e-value: 9.8E-7
score: 28.5
NoneNo IPR availableTMHMMTMhelixcoord: 23..45
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
IPR003165Piwi domainSMARTSM00950Piwi_a_2coord: 208..504
e-value: 1.9E-77
score: 273.3
IPR003165Piwi domainPFAMPF02171Piwicoord: 210..502
e-value: 9.5E-65
score: 218.6
IPR003165Piwi domainPROSITEPS50822PIWIcoord: 207..505
score: 32.647
IPR012337Ribonuclease H-like domainGENE3DG3DSA:3.30.420.10coord: 274..523
e-value: 5.8E-64
score: 214.8
IPR012337Ribonuclease H-like domainSUPERFAMILYSSF53098Ribonuclease H-likecoord: 200..523
coord: 22..142
IPR003100PAZ domainSMARTSM00949PAZ_2_a_3coord: 256..356
e-value: 8.9E-4
score: 11.6
IPR003100PAZ domainPFAMPF02170PAZcoord: 269..346
e-value: 2.1E-11
score: 43.7
IPR003100PAZ domainPROSITEPS50821PAZcoord: 290..345
score: 12.095
IPR003100PAZ domainSUPERFAMILYSSF101690PAZ domaincoord: 135..350

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003165Piwi
IPR012337RNaseH-like_dom
IPR003100PAZ_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000212blastomere compartment
PLANA:0004517blastomere
PLANA:0000429neoblast compartment
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000004Stage 4
PLANA:0000005Stage 5
PLANA:0000006Stage 6
PLANA:0000003Stage 3
PLANA:0000002Stage 2
PLANA:0000007Stage 7
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007406 ID=SMED30007406|Name=SMEDWI-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2730bp
AATCGAATACATAAAAATTTATTTGACACCAAATACAAAGAGACATTAAT
CTACAAGTAAAATAAGCGTTCGCGAATTCTGTCATTTATCGCTGGAGGAG
TAACACCACGATGAATCTTGCCAACGAGTTCAGCCAAACGATGGGCATAA
TGCGTTGGAACAGGAACTCGGATTGTTCCCATCCAGTTAAAATACAAATG
TGTTAACGAATAAGTTATTTGCTGCAATACACTCGGAGACATAACTGAAA
CCTCATTTGTTTTCTTGTTTGTAAACTTAGTGTCCATAAGAACATTATAA
TTCGTAGGAGATGCTGTACCTTTAGTTGTTTTCTGAGACACCAAGTAAAA
TTCATAGAAATTGGGTTTCACTATTTTCTCATCAACCACAGTACCAGGAT
TTGGATTAGCCCCATCTTTGAAAAATTTAACACTAATTCTCTTCTTAACC
ACAACATAAATAATTTGGGGCAAAGTTTGATTTTCGTAAATTTTCTCTAT
CATTTTCATAACAGCATCAGTTTCGAACTTTTTGGTAAATGCTAACTGTG
AATCTCCAACACCGTCACGATAAATAATCAAACGAAGAGGCATAGTGTTA
AATTTGTTTTGGAATGTTGTAAGGGCCGTTAGGAAGTTTTTGCCCAAATT
TTCGTGAAATTCATTTTTACCTTTAGATGAATTGACAAAACTGATATACT
GAGAAAATTTGGCACTAATTGAAAATACGGATGCTTGAACAGATCTTTTA
CCGGTTTTGCTATGAAAAGTATCCAATCCTACAATCATAGTCGGTGCCAT
TTTAAGATTAATACCCCATGGGTCGTATCCTAATTTAGAAAACATTTGCA
TAACTGATTTATCTGCAACCGTTTTACGACGTCGATCATCTCTATTACTT
CCGTTTCTCTGCGTCACACACTGAGTCAATAGACCTGTAGACATTGTAAA
ATTCTTTACTTTTGCGTAAACTTTATCATCAGGAATGAACACTAATGCCA
TATGTACCTTGCTTACACGAATAAAATCTGTTAAAGCGTCTTCAACTTCA
TTGGATCGACATGAAGATATACTGTCCATTGTGTAATTGATTCTTAATCT
TCCTATTTCTCTTTTAACATCTTCAATAAAATTGTTGAAGTGACTAGGGT
TTCGATCAACAACCAGTACACCAAAACGATGAGCTGTGCCTTTAGGAACG
TCAAATTTAATTTCCCCAAACTTCCAATCATCAGGGATTTTAGTATTAAT
TTTAACTTCGTTTGAAAATATATCAACTGGAGCCAATTCACGACCACGAA
TCGTAATCGGTTGTTCTTCAATACACATCCCCCAGCTCTTCATATAATCT
TTTGATTTCCCAGCTCCGGTCCACTTACAAAAATCTCTTATGTCATTTAA
TCGTTCTCTAGGCTCACGTTTCAATACGGTTCCTAAATTCTTTTGCAAAT
TTATATTACTTCTTTCACTATCCGAAAATCCACATAAATAGCATAATTCA
CCTGGAATTGATAAACTTTGATCTGTTTCTGTAGGTCCTTCAGGTTCATT
TTCAGTTTTTTTCTTTTGGGCGAACCATCGATCGCTTGACTCGCGATATA
ACAAATGGTTGTTTGTCATTTTTCAAATTAATGTTATACCGTTGCTTGAA
ATAATTCAAATAGGATATCTTTTTATCGCCTAGCTGAACCTCGTCATTAA
CATCCATTTCTTTAATATCTGAAATTCTATACGTCTTGTTATTATACTTG
GTAATTATGTCCCTTCCTATTAATTGATCAATTTGATCTCGTCGATACAC
TGATACTACATTGTTTTCATTTAGAACACGATTAATTCTTTCAAGATAAA
GTAAAGTCGAAGCAGTTCCATTTTCATTTGTTCCTCTTGTAATTGTAGTA
GAATACCCTCCTAATATCTTGAAATTGTCCATTTTAAAAAAGCTAGGTCC
TTCTCGAATACCACCACTTTCACAATTTGATCCCAGAAAAAATTGTCTAC
CAATTTTTTCTTGTCCCATAAATATTTGAATATTATTAAATACAATATTT
ATCATCTGATAATATTCTTCAGAATTTTTTAAAAACGTCGTCAGCAATCG
TATGGAAATTTCAACATCTTTGATAACTAAGTTTTCTGTATCTTCATCTG
AGTGCCACTTAGAAGTCGTAAATAATCTTCTGCCATCAAAACAAAATGGT
TGACCATTATTTTTGCTGTTTGCATAAGCTAATAATAACTCTAGCTTAGT
ACGGATACTTTTATTCTCCATAACTACATCATACATGTAAAATGGTCCTT
CGACTTTAATATTAAAGTTAGCGTAGTTAGACTTGAGACTAACTACTCTT
CCATCTTTCCCTATTTTGTCTGTAACTGTATCAGGCTGTAAAGCAGGTTC
AATAATTGCGAATCTTCTTTGGAGACCTCCTCTTCTTGGTCTTAAATTGG
GATCACTTGTAACATTAGTTGAATCCATTTCGTAAATTTGAGTAAAAATG
TTAAAACAAAGACTTCGGTTTAAATAAACAAAATATACTATGTAAAACGA
TAAATATAATTGCTTTAATGGTTTATGATTTGTATTATATAATAATAATA
ATTTAATTTCCCTGTGAATATTATATTAAAATATAGTAAAAATTACTCGT
AAATGTGTGTTAAAGTAATAGGATTAAATTAAAATAAACATTTTACGAAA
TAAGTTCTAGTCAATTATGAAGTCTTTTCT
back to top

protein sequence of SMED30007406-orf-1

>SMED30007406-orf-1 ID=SMED30007406-orf-1|Name=SMED30007406-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=309bp
MDSTNVTSDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKS
NYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGR
RLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNI
QIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGT
NENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTY
RISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRS
MVRPKEKN*
back to top

protein sequence of SMED30007406-orf-2

>SMED30007406-orf-2 ID=SMED30007406-orf-2|Name=SMED30007406-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=523bp
MTNNHLLYRESSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSD
SERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCI
EEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFG
VLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFI
RVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKT
VADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFS
ISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIY
RDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF
KDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFT
NKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVG
KIHRGVTPPAINDRIRERLFYL*
back to top
Aliases
The feature 'SMEDWI-1' has the following synonyms
Synonym
piwi-1
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007406
GenBankQ2Q5Y9