SMEDWI-1

Overview
NameSMEDWI-1 (Q2Q5Y9)
Smed IDSMED30007406
Uniprot Best hitPiwi-like protein 1 OS=Schmidtea mediterranea OX=79327 GN=wi-1 PE=2 SV=1 (E=0)
Length (bp)2730
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMEDWI-1 (SMED30007406) t-SNE clustered cells

Violin plots show distribution of expression levels for SMEDWI-1 (SMED30007406) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMEDWI-1 (SMED30007406) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMEDWI-1 (SMED30007406) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: yYpPzL8z

 

back to top

Expression Details

SMEDWI-1 ( piwi-1 ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the neoblast and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

piwi-1 is expressed in all undifferentiated blastomeres of S3 embryos.  piwi-1 is expressed in all undifferentiated blastomeres of S3 embryos. 

 SPIM reconstructed S3 embryo costained with piwi-1 (red) and EF1a-like-1 (green). piwi-1 is expressed in all undifferentiated blastomeres in the embryonic wall (piwi-1+, EF1a-like-1+ cells).  piwi-1 is not expressed in differentiated tissues marked by EF1a-like-1 alone, including the primitive ectoderm and temporary embryonic pharynx (green). Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

 

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and PCNA (green). PCNA expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express PCNA.

 

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and RNR M2-2 (green). RNR M2-2 expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express RNR M2-2. Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

 

Mitotic activity is restricted to piwi-1+ blastomeres, which cycle asynchronously.

SPIM reconstructed S4 embryo constained with piwi-1 and LYAG-like (both in green) and H3S10p antibodies (red). LYAG-like marks the temporary embryonic pharynx and is not expressed in piwi-1+ blastomeres. Several examples of piwi-1+, H3S10p+ cells are evident.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-2.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and piwi-2 (green). piwi-1+ blastomeres co-express the nuage factor piwi-2, and virtually all piwi-2+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (green). 

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-3.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and piwi-3 (green). piwi-1+ blastomeres co-express the nuage factor piwi-3, and virtually all piwi-3+ cells co-express piwi-1.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene tud-1.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and tud-1 (green). piwi-1+ blastomeres co-express the nuage factor tud-1, and virtually all tud-1+ cells co-express piwi-1.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene bruli-1.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and bruli-1(green). piwi-1+ blastomeres co-express the stem cell maintenance gene bruli-1, and virtually all bruli-1+ cells co-express piwi-1. Several fluorescent beads used 3-dimensional reconstruction are visible (red).

 

piwi-1+ blastomeres possess chromatoid bodies.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and Y12 antibodies (green). Y12 antibody staining was restricted to, and present throughout, the piwi-1+ blastomere population.

 

Definitive epidermal progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 (red) and p53 (green). Definitive epidermal progenitors, coexpressing piwi-1 and p53, are dispersed in the embryonic wall.  As definitive epidermal progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of p53.

 

Definitive gut progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and gata456a (green). Definitive gut progenitors, coexpressing piwi-1 and gata456a, are dispersed in the embryonic wall. As definitive gut progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of gata456a. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

 

Muscle progenitors arise in the piwi-1+ blastomere population during S5. 

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and myoD (green). Muscle progenitors, coexpressing piwi-1 and myoD, are dispersed in the embryonic wall. As muscle progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of myoD. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

 

Neural progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and pax6a (green). Neural progenitors, coexpressing piwi-1 and pax6a, are dispersed in the embryonic wall. As neural progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of pax6a. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

 

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S3 embryo costained with piwi-1 (red) and PCNA (green). PCNA expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express PCNA.

 

Cell cycle activity is restricted to piwi-1 blastomeres, and all blastomeres are cycling.

SPIM reconstructed S5 embryo costained with piwi-1 (red) and PCNA (green). PCNA expression is restricted to piwi-1+ blastomeres, and all piwi-1+ cells co-express PCNA.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-2.

SPIM reconstructed S3 embryo costained with piwi-1 (green) and piwi-2 (red). piwi-1+ blastomeres co-express the nuage factor piwi-2, and virtually all piwi-2+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (green).

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-2.

SPIM reconstructed S5 embryo costained with piwi-1 (green) and piwi-2 (red). piwi-1+ blastomeres co-express the nuage factor piwi-2, and virtually all piwi-2+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (green).

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-3.

SPIM reconstructed S3 embryo costained with piwi-1 (green) and piwi-3 (red). piwi-1+ blastomeres co-express the nuage factor piwi-3, and virtually all piwi-3+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-3.

SPIM reconstructed S5 embryo costained with piwi-1 (green) and piwi-3 (red). piwi-1+ blastomeres co-express the nuage factor piwi-3, and virtually all piwi-3+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (red).

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene tud-1.

SPIM reconstructed S5 embryo costained with piwi-1 (red) and tud-1 (green). piwi-1+ blastomeres co-express the nuage factor tud-1, and virtually all tud-1+ cells co-express piwi-1.

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene tud-1.

SPIM reconstructed S3 embryo costained with piwi-1 (red) and tud-1 (green). piwi-1+ blastomeres co-express the nuage factor tud-1, and virtually all tud-1+ cells co-express piwi-1.

Anatomical Expression

PAGE et. al., 2020




SMED30007406

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 65

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30007406SMESG000036375.1 dd_Smed_v4_659_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
zeta neoblastSMED30007406SMESG000036375.1 dd_Smed_v4_659_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
neoblastSMED30007406SMESG000036375.1 SmWIOct06_100035GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
reproductive organSMED30007406SMESG000072325.1 SMESG000051927.1 Contig5347GPL15192PMID:28434803whole organismadult hermaphroditeRNA-sequencing evidence
blastomereSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismStage 2fluorescence in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
oocyteSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismadult hermaphroditecolorimetric in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
oocyteSMED30007406SMESG000036375.1 SMED30007406smed_20140614PMID:28072387whole organismadult hermaphroditefluorescence in situ hybridization evidence
X2 cellSMED30007406SMESG000036375.1 SmedASXL_008653SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
X1 cellSMED30007406SMESG000036375.1 SmedASXL_008653SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
pigment cellSMED30007406SMESG000036375.1 SmedASXL_008653SmedAsxl_ww_GCZZ01PMID:29158443whole organismasexual adultRNA-sequencing evidence
parapharyngeal regionSMED30007406SMESG000036375.1 dd_Smed_v6_659_0_1dd_Smed_v6PMID:28171748whole organismasexual adultRNA-sequencing evidence
neoblastSMED30007406SMESG000036375.1 dd_Smed_v6_659_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
reproductive organSMED30007406SMESG000036375.1 Contig5347GPL15192PMID:28434803whole organismadult hermaphroditeRNA-sequencing evidence
neoblastSMED30007406SMESG000036375.1 SmWIOct06_100034GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 SmWIOct06_100024GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 SmWIOct06_100019GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 SMED_01384_V2_1GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 SMED_01384_V2_1GPL14150PMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 SmWIOct06_014491GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 SmWIOct06_100033GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 SmWIOct06_100023GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 SMED_01384_V2_1rGPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 SMED_01384_V2_1rGPL14150PMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 SmWIOct06_100018GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 SmWIOct06_100022GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 SmWIOct06_100020GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:23318641whole organismasexual adultfluorescence in situ hybridization evidence
parenchymaSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:23629965whole organismasexual adultcolorimetric in situ hybridization evidence
X1 cellSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:23629965FACS sorted cell populationasexual adultRNA-sequencing evidence
neoblastSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:22385657whole organismasexual adultcolorimetric in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismStage 3fluorescence in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
oocyteSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismadult hermaphroditecolorimetric in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:24415944whole organismasexual adultfluorescence in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:24523458whole organismasexual adultfluorescence in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismStage 2fluorescence in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:24704339whole organismasexual adultcolorimetric in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
oocyteSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:28072387whole organismadult hermaphroditefluorescence in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:29357350whole organismasexual adultcolorimetric in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 DQ186985.1smed_ncbi_20200123PMID:29357350whole organismasexual adultfluorescence in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 DQ186985smed_ncbi_20200123PMID:16311336whole organismasexual adultcolorimetric in situ hybridization evidence
Category 1 cellSMED30007406SMESG000036375.1 H.2.12csmed_ncbi_20200123PMID:18786419whole organismasexual adultcDNA to DNA expression microarray evidence
Category 1 cellSMED30007406SMESG000036375.1 H.2.12csmed_ncbi_20200123PMID:18786419whole organismasexual adultcolorimetric in situ hybridization evidence
neoblastSMED30007406SMESG000036375.1 DN313409ncbi_smed_estsPMID:16344473whole organismadult hermaphroditecolorimetric in situ hybridization evidence
testisSMED30007406SMESG000036375.1 DN313409ncbi_smed_estsPMID:16344473whole organismadult hermaphroditecolorimetric in situ hybridization evidence
X1 cellSMED30007406SMESG000079054.1 SMESG000036375.1 isotig03286be_Smed_v2PMID:22543868FACS sorted cell populationasexual adultRNA-sequencing evidence
Homology
BLAST of SMEDWI-1 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 200.29 bits (508), Expect = 2.349e-67
Identity = 143/507 (28.21%), Postives = 237/507 (46.75%), Query Frame = -2
Query:   54 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSN--EVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMD-SISSCRSNEVEDALTDFIRV------SKVHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1517
            ++ IP ELCYL G +D  R++ N+ K+L    +  P +R  ++     +     + +  ++ WG+  +   ++  GR L    I         N +  D  K       +       + ++   RN    N+ I+++       ++   M   +      EV+D    ++RV      +   + +  +     DK  A  K         +QCV  R    +  +    +A K  +QM  K+G + W +++ +   MIVG+D +H  T G+RS+   V SI+   +++ S         E  + L      AL  + +    MP R+I+YRDGVGD QL     +E    +  ++ I      P++  +VVKKR++ +FF        NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ D           S + P  +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ IHR       N  +  RL+YL
Sbjct:  380 AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNL------FKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHR-----EPNLSLSNRLYYL 861          

HSP 2 Score: 77.7962 bits (190), Expect = 2.349e-67
Identity = 72/286 (25.17%), Postives = 126/286 (44.06%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSD-----EDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV------------YRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEV---QLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            K G  G +V L +N+     + +   Y Y +    +ME + +R+ L     + +    G+   FDG  LF   +           T N   +DV I+I L       S    Q  NI+F  +   M  ++IGR ++  ++         P         I  G++T+I +  N     S +L  +  ++VL    V+              ++     +LIG  ++TKYNNKTYR+ DI + D N +    +    ++S+L Y++++YN  + + KQP ++S+ KR
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSAL----LFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNG--EDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR 368          
BLAST of SMEDWI-1 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 200.29 bits (508), Expect = 2.349e-67
Identity = 143/507 (28.21%), Postives = 237/507 (46.75%), Query Frame = -2
Query:   54 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSN--EVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMD-SISSCRSNEVEDALTDFIRV------SKVHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1517
            ++ IP ELCYL G +D  R++ N+ K+L    +  P +R  ++     +     + +  ++ WG+  +   ++  GR L    I         N +  D  K       +       + ++   RN    N+ I+++       ++   M   +      EV+D    ++RV      +   + +  +     DK  A  K         +QCV  R    +  +    +A K  +QM  K+G + W +++ +   MIVG+D +H  T G+RS+   V SI+   +++ S         E  + L      AL  + +    MP R+I+YRDGVGD QL     +E    +  ++ I      P++  +VVKKR++ +FF        NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ D           S + P  +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ IHR       N  +  RL+YL
Sbjct:  380 AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNL------FKVTPAMGMQMRKAIMIEVDDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN-PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN----------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHR-----EPNLSLSNRLYYL 861          

HSP 2 Score: 77.7962 bits (190), Expect = 2.349e-67
Identity = 72/286 (25.17%), Postives = 126/286 (44.06%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSD-----EDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV------------YRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEV---QLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            K G  G +V L +N+     + +   Y Y +    +ME + +R+ L     + +    G+   FDG  LF   +           T N   +DV I+I L       S    Q  NI+F  +   M  ++IGR ++  ++         P         I  G++T+I +  N     S +L  +  ++VL    V+              ++     +LIG  ++TKYNNKTYR+ DI + D N +    +    ++S+L Y++++YN  + + KQP ++S+ KR
Sbjct:  104 KTGSSGIIVRLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSAL----LFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNG--EDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPND---------PIDIPSHRLVIWPGFTTSILQYEN-----SIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR 368          
BLAST of SMEDWI-1 vs. Ensembl Human
Match: PIWIL3 (piwi like RNA-mediated gene silencing 3 [Source:HGNC Symbol;Acc:HGNC:18443])

HSP 1 Score: 195.667 bits (496), Expect = 2.614e-62
Identity = 152/528 (28.79%), Postives = 249/528 (47.16%), Query Frame = -2
Query:   54 SSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA---HRFGVLVV---DRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDD--KVYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF-KDGAN---PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1589
            S  RW      T+ EP         L IP +LC++ G +D    + ++ K L    +  PR R + +++F       K  ++ ++ W +  +   +++ GR L   +I      +      DW   EI+ ++P   A   H + +L      R        ++ V   +G       M  +    +N   D L  + R + + M +  +P+D  + Y  +K +  +   + +QCV ++       R   T+  K   QM  K+G   W +   +  TM VG+D FH    + +S+   V S +A+ +++ S     K   E  + L      AL  +    ++MP  +I+YRDGVGD QL      E   +   ++ I  N     + ++VVKKRI+ +FF K G+N   P PGTV+D ++ +  +Y+F++VSQ    GT +PT+YNV+ DT            +SP  +Q++TY L H+Y+N  G IRVP P HYAH+LA LVG+ IH+       N  +  RLFYL
Sbjct:  270 SQGRWKKGLTGTQREP--------ILLIP-QLCHMTGLTDEICKDYSIVKELAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQGRRMVKANSQGDWS-REIR-ELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDG-DANSYIDTLRKYTRPT-LQMVICILPNDDKRRYDSIKRYLCTKCPIPSQCVVKKTLEKVQAR---TIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIVNRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVIVYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNF--TLAFIVVKKRINTRFFLKHGSNFQNPPPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDT----------IGLSPDTVQRLTYCLCHMYYNLPGIIRVPAPCHYAHKLAYLVGQSIHQ-----EPNRSLSTRLFYL 764          

HSP 2 Score: 65.4698 bits (158), Expect = 2.614e-62
Identity = 74/280 (26.43%), Postives = 128/280 (45.71%), Query Frame = -1
Query: 1591 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVV----MENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTS-------KWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNE----NGTASTLLYLER----INRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISR 2367
            K G +G VV L +N+     + +   Y Y+V     +E+ ++RT    +L   + +  G+   FDG  L  +        +W S    +N+V   VE S  L  T    S +  +  NI+F      +  E++GR ++          R G S       +I  GY T++ +  N        +  LL +E     I R   +    ++ R +  ++LIG  ++TKYNNKTYR+ DI  + +  D     D  KI+Y++Y++Q++   +   KQP ++S+
Sbjct:    8 KTGSEGTVVQLLANHFRVISRPQWVAYKYNVDYKPDIEDGNLRT----ILLDQHRRKFGERHIFDGNSLLLSRPLKERRVEWLSTTKDKNIVKITVEFSKELTPT----SPDCLRYYNILFRRTFKLLDFEQVGRNYYTKKKAIQL-YRHGTSL------EIWLGYVTSVLQYENSITLCADVSHKLLRIETAYDFIKRTSAQAQTGNI-REEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKITYIDYYRQQHKEIVTVKKQPLLVSQ 271          
BLAST of SMEDWI-1 vs. Ensembl Human
Match: PIWIL3 (piwi like RNA-mediated gene silencing 3 [Source:HGNC Symbol;Acc:HGNC:18443])

HSP 1 Score: 195.667 bits (496), Expect = 2.614e-62
Identity = 152/528 (28.79%), Postives = 249/528 (47.16%), Query Frame = -2
Query:   54 SSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA---HRFGVLVV---DRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDD--KVYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF-KDGAN---PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1589
            S  RW      T+ EP         L IP +LC++ G +D    + ++ K L    +  PR R + +++F       K  ++ ++ W +  +   +++ GR L   +I      +      DW   EI+ ++P   A   H + +L      R        ++ V   +G       M  +    +N   D L  + R + + M +  +P+D  + Y  +K +  +   + +QCV ++       R   T+  K   QM  K+G   W +   +  TM VG+D FH    + +S+   V S +A+ +++ S     K   E  + L      AL  +    ++MP  +I+YRDGVGD QL      E   +   ++ I  N     + ++VVKKRI+ +FF K G+N   P PGTV+D ++ +  +Y+F++VSQ    GT +PT+YNV+ DT            +SP  +Q++TY L H+Y+N  G IRVP P HYAH+LA LVG+ IH+       N  +  RLFYL
Sbjct:  270 SQGRWKKGLTGTQREP--------ILLIP-QLCHMTGLTDEICKDYSIVKELAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQGRRMVKANSQGDWS-REIR-ELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDG-DANSYIDTLRKYTRPT-LQMVICILPNDDKRRYDSIKRYLCTKCPIPSQCVVKKTLEKVQAR---TIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIVNRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVIVYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNF--TLAFIVVKKRINTRFFLKHGSNFQNPPPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDT----------IGLSPDTVQRLTYCLCHMYYNLPGIIRVPAPCHYAHKLAYLVGQSIHQ-----EPNRSLSTRLFYL 764          

HSP 2 Score: 65.4698 bits (158), Expect = 2.614e-62
Identity = 74/280 (26.43%), Postives = 128/280 (45.71%), Query Frame = -1
Query: 1591 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVV----MENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTS-------KWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNE----NGTASTLLYLER----INRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISR 2367
            K G +G VV L +N+     + +   Y Y+V     +E+ ++RT    +L   + +  G+   FDG  L  +        +W S    +N+V   VE S  L  T    S +  +  NI+F      +  E++GR ++          R G S       +I  GY T++ +  N        +  LL +E     I R   +    ++ R +  ++LIG  ++TKYNNKTYR+ DI  + +  D     D  KI+Y++Y++Q++   +   KQP ++S+
Sbjct:    8 KTGSEGTVVQLLANHFRVISRPQWVAYKYNVDYKPDIEDGNLRT----ILLDQHRRKFGERHIFDGNSLLLSRPLKERRVEWLSTTKDKNIVKITVEFSKELTPT----SPDCLRYYNILFRRTFKLLDFEQVGRNYYTKKKAIQL-YRHGTSL------EIWLGYVTSVLQYENSITLCADVSHKLLRIETAYDFIKRTSAQAQTGNI-REEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKITYIDYYRQQHKEIVTVKKQPLLVSQ 271          
BLAST of SMEDWI-1 vs. Ensembl Human
Match: PIWIL3 (piwi like RNA-mediated gene silencing 3 [Source:HGNC Symbol;Acc:HGNC:18443])

HSP 1 Score: 190.274 bits (482), Expect = 1.648e-60
Identity = 154/536 (28.73%), Postives = 250/536 (46.64%), Query Frame = -2
Query:   54 SSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA---HRFGVLVV---DRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVS---KVHMALVF-----IPDD--KVYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF-KDGAN---PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1589
            S  RW      T+ EP         L IP +LC++ G +D    + ++ K L    +  PR R + +++F       K  ++ ++ W +  +   +++ GR L   +I      +      DW   EI+ ++P   A   H + +L      R        ++ V   +G       M  +    +N   D L  + R +    +   LVF     +P+D  + Y  +K +  +   + +QCV ++       R   T+  K   QM  K+G   W +   +  TM VG+D FH    + +S+   V S +A+ +++ S     K   E  + L      AL  +    ++MP  +I+YRDGVGD QL      E   +   ++ I  N     + ++VVKKRI+ +FF K G+N   P PGTV+D ++ +  +Y+F++VSQ    GT +PT+YNV+ DT            +SP  +Q++TY L H+Y+N  G IRVP P HYAH+LA LVG+ IH+       N  +  RLFYL
Sbjct:  379 SQGRWKKGLTGTQREP--------ILLIP-QLCHMTGLTDEICKDYSIVKELAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQGRRMVKANSQGDWS-REIR-ELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDG-DANSYIDTLRKYTRPTLQMGMSCLLVFKVICILPNDDKRRYDSIKRYLCTKCPIPSQCVVKKTLEKVQAR---TIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIVNRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVIVYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNF--TLAFIVVKKRINTRFFLKHGSNFQNPPPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDT----------IGLSPDTVQRLTYCLCHMYYNLPGIIRVPAPCHYAHKLAYLVGQSIHQ-----EPNRSLSTRLFYL 882          

HSP 2 Score: 65.0846 bits (157), Expect = 1.648e-60
Identity = 74/280 (26.43%), Postives = 128/280 (45.71%), Query Frame = -1
Query: 1591 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVV----MENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTS-------KWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNE----NGTASTLLYLER----INRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISR 2367
            K G +G VV L +N+     + +   Y Y+V     +E+ ++RT    +L   + +  G+   FDG  L  +        +W S    +N+V   VE S  L  T    S +  +  NI+F      +  E++GR ++          R G S       +I  GY T++ +  N        +  LL +E     I R   +    ++ R +  ++LIG  ++TKYNNKTYR+ DI  + +  D     D  KI+Y++Y++Q++   +   KQP ++S+
Sbjct:  117 KTGSEGTVVQLLANHFRVISRPQWVAYKYNVDYKPDIEDGNLRT----ILLDQHRRKFGERHIFDGNSLLLSRPLKERRVEWLSTTKDKNIVKITVEFSKELTPT----SPDCLRYYNILFRRTFKLLDFEQVGRNYYTKKKAIQL-YRHGTSL------EIWLGYVTSVLQYENSITLCADVSHKLLRIETAYDFIKRTSAQAQTGNI-REEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKITYIDYYRQQHKEIVTVKKQPLLVSQ 380          
BLAST of SMEDWI-1 vs. Ensembl Celegans
Match: prg-1 (Piwi-like protein [Source:UniProtKB/TrEMBL;Acc:P90786])

HSP 1 Score: 199.519 bits (506), Expect = 7.860e-59
Identity = 151/542 (27.86%), Postives = 253/542 (46.68%), Query Frame = -2
Query:   54 TENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDF-CKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNN------FIEDVKR--EIGRLRINYTMD-SISSCRSNEVEDALTDFIRV---SKVHMALVFIPDDKV--YAKVKNF-TMSTGLLTQCVTQRN--GSNRDDRRRKTVAD---KSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFN-TMPLRLIIYRDGVGDSQLAFTKKFE-----------TDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA------NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1556
            +E +P+ P E  Q   I  ELC+  G +D  R +  + K +    +  P++RL + R      +   K  +  K WG+ + +    ++ R L    +   +     +   +W  G  +  + +G+     +++    P   N+      FIE+ +R  +I ++++   M   I     N+  + +   I+      +HM +V + DD    Y  +K F  +   +  QCV  R   G ++D    K +     K V+QM  K G   W +N+ +  TMIVG D +H  T K ++V A V + S  F+Q+ S     +   +   NL      AL  + +  + T+P RLI+YRDG GD Q+ + K  E           TD   ++  K+ E   L    +++V KR++++  K G+      NP PGTVVD  + +P   +FYLV Q   +GT +P +YN++ D           + + P   QQ+ + L HLY+NW GT+RVP P  YAH+LA L  + +H        N  +R++LF+L
Sbjct:  306 SEGKPKQPGEPPQVSYIVPELCFPTGLTDEMRKDFKMMKEIAKHTRMSPQQRLVESRKLIVDLSKNEKVMECFKYWGISLGQDLANVQARVLKSEPLQGKKTYEGKQA--EWARGVKECGIYRGSNMTNWIVI---GPGSGNSGLLSQKFIEEARRLGKILQVQLGEPMCVPIRGISPNDYLEGVKGAIKQVDGEDIHMLVVMLADDNKTRYDSLKKFLCVECPIPNQCVNLRTLAGKSKDGGENKNLGSIVLKIVLQMICKTGGALWKVNIPLKNTMIVGYDLYHDSTLKGKTVGACVSTTSNDFTQFYSQTRPHENPTQLGNNLTHFVRKALKQYYDSNDQTLPSRLILYRDGAGDGQIPYIKNTEVKLVRDACDAVTDKAAELSNKVQEKIKLA---FIIVTKRVNMRILKQGSSLDNAINPQPGTVVDTTVTRPERMDFYLVPQFVNQGTVTPVSYNIIHDD----------TDLGPDKHQQLAFKLCHLYYNWQGTVRVPAPCQYAHKLAFLTAQSLHDDA-----NGCLRDKLFFL 824          

HSP 2 Score: 48.521 bits (114), Expect = 7.860e-59
Identity = 80/303 (26.40%), Postives = 133/303 (43.89%), Query Frame = -1
Query: 1585 ALQPDTVTDKIG--KDGRVVSLKSNYANFNIKVEG-----PFYMYDVVMENKSIRTKL--ELLLAYANSKNN-GQPFCFDGRRLFTTSKWHSDEDTE-NLVIKDVEISIRLLTT--FLKNSEEYYQMINIV----FNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRD-------------QIDQLIG-RDIITKYNNKTYRIS--DIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVK 2394
             +QPD    + G  K G     +  +ANF I +E        Y Y V  E  ++ +K   E +L   N  +  G  F FDG  L+   +W  ++  E    I    I IR   T  FL +  +   + N +    F+ +Q+     ++GR +F       G  R  P +    N  IL GY T I R   EN     +L +E   +++ E ++  ++ ++             +++++ G   IIT+YNNK +R +  D     +++ V+ G + I+   YFK +Y I +  D QP +IS  K
Sbjct:   28 TIQPDLFIRQQGQSKTGSSGQPQKCFANF-IPIEMTQSDYSIYQYHVEFE-PTVDSKANREKMLRDNNVTDEIGHHFVFDGMILYLKEEWEQNQMIEVQHPIDRSLICIRFKQTNRFLVDDPQTINIFNTIIRRSFDALQL----TQLGRNYF-----NWGDSRAVPDY----NMSILPGYETAI-RMYEEN----FMLCVENRFKMVREESMYILFHKELRSCQNNPQRVQEKMNEMYGGTTIITRYNNKLHRYTRLDYSISPLSEFVKDG-QSITLKEYFKNQYGIEITVDDQPIIISEGK 309          
BLAST of SMEDWI-1 vs. Ensembl Celegans
Match: alg-2 (pep chromosome:WBcel235:II:874160:879001:1 gene:WBGene00000106.1 transcript:T07D3.7b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 124.02 bits (310), Expect = 1.124e-28
Identity = 127/499 (25.45%), Postives = 212/499 (42.48%), Query Frame = -2
Query:  132 IPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGK--SKDYMKSWGMCIEEQPITIRGREL-APVDIFSNEVKINTKIPDD--WKFGEIKFDVPKGTAHRFGVLVVDRNPSHF-NNFIEDVKREIGRLRINYTMDSISS---CR-SNEVEDALTDFIRV----SKVHMALVFIPDD-KVYAKVKNFTMST-GLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKM----------APTMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMK---MIEKIYENQTLPQIIYVVVKKRISVKFF-KDGA-------NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLA 1508
            +PG+ C L   +D + S         T++K   R      R+ CK     +  +  +   +G+ I      ++GR L AP  ++    +  T +P+   W     +F    G   R   +      SH   N +     ++ R+  +  M  I +   C+ ++ VE     F  +    S + + +V +P    +YA+VK    +  G+ TQCV  +N      R          ++M  KLG    G+N  +           P + +G D  H   G   K S+ A V S+ A  S+Y + V   + + E   +L       L  F       P R+++YRDGV + QL    ++E  A+ +   M+E  Y+    P I ++ V+KR   + F  D A       N  PGT VD  I  P  ++F+L S    +GT+ P++Y+VL D        N+++      LQQ+TY + H Y     ++ +P P +YAH +A
Sbjct:  376 VPGQRC-LKKLTDVQTS---------TMIKATARSAPEREREICKLVSKAELSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWDMRGKQFHT--GMEVRTWAIACFAQQSHVKENDLRMFTTQLQRISTDAGMPIIGTPMFCKYASGVEQVEPMFKYLKQTYSAIQLIVVVLPGKTPIYAEVKRVGDTVLGIATQCVQAKNAI----RTTPQTLSNLCLKMNVKLG----GVNSILLPNVRPRIFNEPVIFLGCDITHPAAGDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIITDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQ----PGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWD-------DNDLTA---DELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVA 840          
BLAST of SMEDWI-1 vs. Ensembl Celegans
Match: alg-2 (pep chromosome:WBcel235:II:873176:878945:1 gene:WBGene00000106.1 transcript:T07D3.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 123.635 bits (309), Expect = 1.693e-28
Identity = 127/499 (25.45%), Postives = 212/499 (42.48%), Query Frame = -2
Query:  132 IPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGK--SKDYMKSWGMCIEEQPITIRGREL-APVDIFSNEVKINTKIPDD--WKFGEIKFDVPKGTAHRFGVLVVDRNPSHF-NNFIEDVKREIGRLRINYTMDSISS---CR-SNEVEDALTDFIRV----SKVHMALVFIPDD-KVYAKVKNFTMST-GLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKM----------APTMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMK---MIEKIYENQTLPQIIYVVVKKRISVKFF-KDGA-------NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLA 1508
            +PG+ C L   +D + S         T++K   R      R+ CK     +  +  +   +G+ I      ++GR L AP  ++    +  T +P+   W     +F    G   R   +      SH   N +     ++ R+  +  M  I +   C+ ++ VE     F  +    S + + +V +P    +YA+VK    +  G+ TQCV  +N      R          ++M  KLG    G+N  +           P + +G D  H   G   K S+ A V S+ A  S+Y + V   + + E   +L       L  F       P R+++YRDGV + QL    ++E  A+ +   M+E  Y+    P I ++ V+KR   + F  D A       N  PGT VD  I  P  ++F+L S    +GT+ P++Y+VL D        N+++      LQQ+TY + H Y     ++ +P P +YAH +A
Sbjct:  395 VPGQRC-LKKLTDVQTS---------TMIKATARSAPEREREICKLVSKAELSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWDMRGKQFHT--GMEVRTWAIACFAQQSHVKENDLRMFTTQLQRISTDAGMPIIGTPMFCKYASGVEQVEPMFKYLKQTYSAIQLIVVVLPGKTPIYAEVKRVGDTVLGIATQCVQAKNAI----RTTPQTLSNLCLKMNVKLG----GVNSILLPNVRPRIFNEPVIFLGCDITHPAAGDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIITDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQ----PGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWD-------DNDLTA---DELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVA 859          
BLAST of SMEDWI-1 vs. Ensembl Celegans
Match: alg-1 (pep chromosome:WBcel235:X:13951262:13956261:1 gene:WBGene00000105.1 transcript:F48F7.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-1)

HSP 1 Score: 119.398 bits (298), Expect = 4.016e-27
Identity = 94/320 (29.38%), Postives = 144/320 (45.00%), Query Frame = -2
Query:  132 SKVHMALVFIPDD-KVYAKVKNFTMST-GLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKM----------APTMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMK---MIEKIYENQTLPQIIYVVVKKRISVKFF----KD----GANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLA 1013
            S + + +V +P    VYA+VK    +  G+ TQCV  +N      R          ++M  KLG    G+N  +           P +  G D  H   G   K S+ A V S+ A  S+Y + V   + + E   +L       L  F       P R+++YRDGV + Q     ++E  A+ +   M+E+ Y+    P I ++ V+KR   + F    KD      N  PGT VD  I  P  ++FYL S    +GT+ P++Y+VL D    N   +E        LQQ+TY + H Y     ++ +P P +YAH +A
Sbjct:  656 SGIQLVVVVLPGKTPVYAEVKRVGDTVLGIATQCVQAKNAI----RTTPQTLSNLCLKMNVKLG----GVNSILLPNVRPRIFNEPVIFFGCDITHPPAGDSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIISDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQFFNVLQYELRAIREACMMLERGYQ----PGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDN--NLTADE--------LQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVA 953          
BLAST of SMEDWI-1 vs. Ensembl Celegans
Match: alg-1 (pep chromosome:WBcel235:X:13949114:13956261:1 gene:WBGene00000105.1 transcript:F48F7.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-1)

HSP 1 Score: 119.398 bits (298), Expect = 4.030e-27
Identity = 94/320 (29.38%), Postives = 144/320 (45.00%), Query Frame = -2
Query:  132 SKVHMALVFIPDD-KVYAKVKNFTMST-GLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKM----------APTMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMK---MIEKIYENQTLPQIIYVVVKKRISVKFF----KD----GANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLA 1013
            S + + +V +P    VYA+VK    +  G+ TQCV  +N      R          ++M  KLG    G+N  +           P +  G D  H   G   K S+ A V S+ A  S+Y + V   + + E   +L       L  F       P R+++YRDGV + Q     ++E  A+ +   M+E+ Y+    P I ++ V+KR   + F    KD      N  PGT VD  I  P  ++FYL S    +GT+ P++Y+VL D    N   +E        LQQ+TY + H Y     ++ +P P +YAH +A
Sbjct:  677 SGIQLVVVVLPGKTPVYAEVKRVGDTVLGIATQCVQAKNAI----RTTPQTLSNLCLKMNVKLG----GVNSILLPNVRPRIFNEPVIFFGCDITHPPAGDSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIISDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQFFNVLQYELRAIREACMMLERGYQ----PGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDN--NLTADE--------LQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVA 974          
BLAST of SMEDWI-1 vs. Ensembl Fly
Match: piwi (gene:FBgn0004872 transcript:FBtr0080166)

HSP 1 Score: 211.075 bits (536), Expect = 5.183e-70
Identity = 144/477 (30.19%), Postives = 233/477 (48.85%), Query Frame = -2
Query:  120 IPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDF-CKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWK--FGEIK-FDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGR--LRINYTMD-SISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSIS-AKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTL--PQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVG 1508
            IP ELC + G +   RSN  L + + +  +  P++R + +R F  +     +S   ++ W M +++    ++GR +   +I  +  K+      DW+  F + +    P     R+ V+   RN       ++ + R      LRI    +  I   R+     A+ D +R S   + L  +P+D    Y+ +K    +   + TQ VT +   NR      ++A K  +Q+  KLGY PW I L ++  M +G D   S +  KR+  A + S+   + S Y S V      +     L      AL  +Q++   +P R++ YRDGV    L    +FE   +++ ++  Y    L  PQ+ Y+VV + ++ +FF +G NP PGT+VD+ I  P  Y+FYLVSQ+  +GT SPT+YNVL  +            +SP  +Q++TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:  364 IP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVR-SDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRS---LMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMG----------LSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          

HSP 2 Score: 75.0998 bits (183), Expect = 5.183e-70
Identity = 75/283 (26.50%), Postives = 130/283 (45.94%), Query Frame = -1
Query: 1591 QPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMEN--KSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIK-DVE--ISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFF-LGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRD----------IITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISR 2388
            +P  +  K G DG  V L++N+     K E     Y V  E   ++ R ++ +L  +AN   +G  + FDG +LFTT K+  +    +   K D+E  ISI+ +         + Q++N++       +  E +GR  F   +  E   IRE    FKM+   +  GY T+I +   +      LL  E  ++V+    +  + RR   +    +D          ++T YNN+TYRI+D+              + IS++ Y+  +YNI +++  QP +IS+
Sbjct:   82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRAKIE---IRE----FKME---LWPGYETSIRQHEKD-----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK 347          
BLAST of SMEDWI-1 vs. Ensembl Fly
Match: piwi (gene:FBgn0004872 transcript:FBtr0340227)

HSP 1 Score: 211.075 bits (536), Expect = 5.183e-70
Identity = 144/477 (30.19%), Postives = 233/477 (48.85%), Query Frame = -2
Query:  120 IPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDF-CKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWK--FGEIK-FDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGR--LRINYTMD-SISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSIS-AKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTL--PQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVG 1508
            IP ELC + G +   RSN  L + + +  +  P++R + +R F  +     +S   ++ W M +++    ++GR +   +I  +  K+      DW+  F + +    P     R+ V+   RN       ++ + R      LRI    +  I   R+     A+ D +R S   + L  +P+D    Y+ +K    +   + TQ VT +   NR      ++A K  +Q+  KLGY PW I L ++  M +G D   S +  KR+  A + S+   + S Y S V      +     L      AL  +Q++   +P R++ YRDGV    L    +FE   +++ ++  Y    L  PQ+ Y+VV + ++ +FF +G NP PGT+VD+ I  P  Y+FYLVSQ+  +GT SPT+YNVL  +            +SP  +Q++TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:  364 IP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVR-SDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRS---LMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMG----------LSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          

HSP 2 Score: 75.0998 bits (183), Expect = 5.183e-70
Identity = 75/283 (26.50%), Postives = 130/283 (45.94%), Query Frame = -1
Query: 1591 QPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMEN--KSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIK-DVE--ISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFF-LGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRD----------IITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISR 2388
            +P  +  K G DG  V L++N+     K E     Y V  E   ++ R ++ +L  +AN   +G  + FDG +LFTT K+  +    +   K D+E  ISI+ +         + Q++N++       +  E +GR  F   +  E   IRE    FKM+   +  GY T+I +   +      LL  E  ++V+    +  + RR   +    +D          ++T YNN+TYRI+D+              + IS++ Y+  +YNI +++  QP +IS+
Sbjct:   82 RPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSG--YLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRAKIE---IRE----FKME---LWPGYETSIRQHEKD-----ILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISK 347          
BLAST of SMEDWI-1 vs. Ensembl Fly
Match: aub (gene:FBgn0000146 transcript:FBtr0112793)

HSP 1 Score: 196.438 bits (498), Expect = 9.137e-67
Identity = 145/485 (29.90%), Postives = 239/485 (49.28%), Query Frame = -2
Query:  117 DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGK-SKDYMKSWGMCIEEQPITIRGRELAPVDI-FSNEVKINTKIPDDWKFGEIKFDVPKGTAH--RFGVLVVDRNPSHFNNFIEDVKREIGRLRINYT---MDSISSCRSNEVEDALTDFIRVS-KVHMALVFIPDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRR--KTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSISAKFS-QYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYEN---QTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK 1523
            DQ++ I  EL    G +D+ R++    + +    +  P  R+  +R F K   + K S + +KSW + ++   + I  R L P  I F N+         DW   E +        H  R+ V+   RN      F++   R    +++N      + I   R+     A+ +      ++ M ++  P+++ Y+ +K  T +   + +Q VT +  + R  +     ++A K V+QM +KL   PW + + +   M VG D  HS K   +S  A V ++  K S +Y S VN      E  E +  N   AL ++Q +  ++P R++ +RDGVGD QL      E + +   +++IY++   Q   ++ +++V KRI+ ++F    NP PGTVVD+ I  P  Y+F+LVSQ    GT SPT+YNV+ D    N             LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +
Sbjct:  305 DQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWT-NEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADK----------LQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 778          

HSP 2 Score: 78.9518 bits (193), Expect = 9.137e-67
Identity = 74/296 (25.00%), Postives = 139/296 (46.96%), Query Frame = -1
Query: 1555 QPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTE---NLVIK-----DVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFK--ILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQID-------QLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKN 2388
            +P  +T K G  G  +++++NY     +     Y Y V        T+L     Y +    G  + FDG  +F  +++ + +D+     LV K     ++EI I+ + +      E +Q++N++       +  + + R ++           +  +   ++NF+  +  GY T+I +  N+    S + +  ++ R     N++S   RD  D        ++G  I+T YNNKTYRI D+  +     + +  D +ISY++Y+K+RYNI +++ KQP V+S       RP +KN
Sbjct:   25 RPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILGG-YIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-----------DPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH--KVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMS-------RPTDKN 299          
BLAST of SMEDWI-1 vs. Ensembl Fly
Match: aub (gene:FBgn0000146 transcript:FBtr0080165)

HSP 1 Score: 196.438 bits (498), Expect = 1.026e-66
Identity = 145/485 (29.90%), Postives = 239/485 (49.28%), Query Frame = -2
Query:  117 DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGK-SKDYMKSWGMCIEEQPITIRGRELAPVDI-FSNEVKINTKIPDDWKFGEIKFDVPKGTAH--RFGVLVVDRNPSHFNNFIEDVKREIGRLRINYT---MDSISSCRSNEVEDALTDFIRVS-KVHMALVFIPDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRK--TVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFS-QYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYEN---QTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK 1523
            DQ++ I  EL    G +D+ R++    + +    +  P  R+  +R F K   + K S + +KSW + ++   + I  R L P  I F N+         DW   E +        H  R+ V+   RN      F++   R    +++N      + I   R+     A+ +      ++ M ++  P+++ Y+ +K  T +   + +Q VT +  + R  +     ++A K V+QM +KL   PW + + +   M VG D  HS   K +S  A V ++  K S +Y S VN      E  E +  N   AL ++Q +  ++P R++ +RDGVGD QL      E + +   +++IY++   Q   ++ +++V KRI+ ++F    NP PGTVVD+ I  P  Y+F+LVSQ    GT SPT+YNV+ D    N             LQ ++Y +TH+Y+N+ GTIRVP   HYAH+LA LV +
Sbjct:  376 DQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDARADWT-NEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADK----------LQMLSYKMTHMYYNYSGTIRVPAVCHYAHKLAFLVAE 849          

HSP 2 Score: 78.5666 bits (192), Expect = 1.026e-66
Identity = 74/296 (25.00%), Postives = 139/296 (46.96%), Query Frame = -1
Query: 1555 QPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTE---NLVIK-----DVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFK--ILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQID-------QLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKN 2388
            +P  +T K G  G  +++++NY     +     Y Y V        T+L     Y +    G  + FDG  +F  +++ + +D+     LV K     ++EI I+ + +      E +Q++N++       +  + + R ++           +  +   ++NF+  +  GY T+I +  N+    S + +  ++ R     N++S   RD  D        ++G  I+T YNNKTYRI D+  +     + +  D +ISY++Y+K+RYNI +++ KQP V+S       RP +KN
Sbjct:   96 RPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILGG-YIFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRYYY-----------DPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH--KVMRTETLYNILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIIIRDLKQPLVMS-------RPTDKN 370          
BLAST of SMEDWI-1 vs. Ensembl Fly
Match: AGO3 (gene:FBgn0250816 transcript:FBtr0299882)

HSP 1 Score: 205.682 bits (522), Expect = 7.354e-55
Identity = 151/516 (29.26%), Postives = 254/516 (49.22%), Query Frame = -2
Query:   54 KKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCK-WTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHF-NNFIEDVKREIGRLRINY---TMDSISSCRSNEVEDALTDFIRV-SKVHMALVFIPDDKVYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1562
            KK+   P    E  Q   IP ELCYL G  D  RS+  L + + T  +  P +R   +  F +  +    +++ + SWG+ +      I GR++    I+ +++ ++     ++    +  ++ K       +++  RN      + ++++K+    L +N    TM S+   R +    AL   I + +++ + +     D  YA +K    S   + +Q +  +   N  D + ++V  K V+QM  KLG   W + +     MI G+D++H  + +  SV A V SI++ +SQ+ S       + E    L  +F  AL  ++ +   +P  +IIYRDG+GD QL     +E    +   E +  N+   +I Y+VV+KRI+ + F        NP PGTVVD+ I K N Y+F+LVSQ   +GT +PT+Y VL D               P ++Q+++Y L  LY+NW GT+R+P    YAH+LA L+G+ I R V      + + E+LFYL
Sbjct:  377 KKSRGIP-AERENLQFCLIP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISVSAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAKTLQN--DLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYE----IPQFEMVCGNRI--KISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDD----------CNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQSIQRDVA-----EALSEKLFYL 867          

HSP 2 Score: 65.4698 bits (158), Expect = 1.893e-10
Identity = 54/201 (26.87%), Postives = 93/201 (46.27%), Query Frame = -1
Query: 1558 KDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKK--ISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK 2121
            +DVE+ IR+L    +      Q+ NI+F+ +   +   K  R+ F  S          P    +   ++  GY T +     +      +L  +  +R+L +  V+ +           Y+      L+G  ++T+YNN+TY+I+DI   D N   Q   K    SY+ Y+KQ +NIN+K+  QP + S +K+S   P E+
Sbjct:  202 EDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQFDPSR---------PKIIPLAKLEVWPGYVTAV-----DEYKGGLMLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDIC-FDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYS-IKKSRGIPAER 386          
BLAST of SMEDWI-1 vs. Ensembl Zebrafish
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:368200])

HSP 1 Score: 215.312 bits (547), Expect = 1.775e-75
Identity = 152/502 (30.28%), Postives = 244/502 (48.61%), Query Frame = -2
Query:   54 ELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDI-RDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKIN-TKIPDDWKFGEIKFDVPKGTAHRFG---VLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV------SKVHMALVFIP---DDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFK--DG--ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1499
            E CYL G +D  R++ N+ K+L +  +  P +R   I R        G  ++ + +WG+  E + +++ GR L    I              DW   E++  +P  +        +    RN     + ++ + +  G + I      +      E ED     +R        +  M +V +P    DK     K   +     +QCV  R  S    +   TVA K  +QM  K+G + W + + +   MIVG+D +H +  GKRS+ A V S++   S++ S         E  + L  +   AL  +    N++P R+I+YRDGVGD  L     +E   +M+ I+ + ++   P++  VVVKKRIS +FF   DG  ANP PGTV+D ++ +P +Y+F++VSQ    G  +PT+YNV+ D           S + P  +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ IH+    P +N  + + L+YL
Sbjct:  382 EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWS-KEMR-GLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIR-----MQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISK--PQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN----------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHK---EPNMN--LDDFLYYL 858          

HSP 2 Score: 89.3521 bits (220), Expect = 1.775e-75
Identity = 84/307 (27.36%), Postives = 136/307 (44.30%), Query Frame = -1
Query: 1582 RGGLQRRF---AIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED---TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVY---RRDQIDQ---------LIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2433
            RGG +R F    +    L       K G  G  + L++N+     +     Y Y V     ME++ +R+ L     + + +  G+   FDG  LF  +K  + E    +E    + VEI++ L      +S    Q  NI+F  I   +  ++IGR ++   +         P         I  G+ TTI +       +S +L  +  ++VL    V+      R+   DQ         L+G  I+TKYNNKTYRI DI  +   N+  + GD +IS+ NYFK +Y +++ +  Q  ++S VKR
Sbjct:   77 RGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLLSRPMWALYQYHVDYKPPMESRRLRSAL----LFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDD---------PFNIPQHRLTIWPGFMTTILQYE-----SSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKR 365          
BLAST of SMEDWI-1 vs. Ensembl Zebrafish
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:368200])

HSP 1 Score: 215.312 bits (547), Expect = 1.775e-75
Identity = 152/502 (30.28%), Postives = 244/502 (48.61%), Query Frame = -2
Query:   54 ELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDI-RDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKIN-TKIPDDWKFGEIKFDVPKGTAHRFG---VLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV------SKVHMALVFIP---DDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFK--DG--ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1499
            E CYL G +D  R++ N+ K+L +  +  P +R   I R        G  ++ + +WG+  E + +++ GR L    I              DW   E++  +P  +        +    RN     + ++ + +  G + I      +      E ED     +R        +  M +V +P    DK     K   +     +QCV  R  S    +   TVA K  +QM  K+G + W + + +   MIVG+D +H +  GKRS+ A V S++   S++ S         E  + L  +   AL  +    N++P R+I+YRDGVGD  L     +E   +M+ I+ + ++   P++  VVVKKRIS +FF   DG  ANP PGTV+D ++ +P +Y+F++VSQ    G  +PT+YNV+ D           S + P  +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ IH+    P +N  + + L+YL
Sbjct:  382 EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWS-KEMR-GLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIR-----MQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISK--PQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN----------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHK---EPNMN--LDDFLYYL 858          

HSP 2 Score: 89.3521 bits (220), Expect = 1.775e-75
Identity = 84/307 (27.36%), Postives = 136/307 (44.30%), Query Frame = -1
Query: 1582 RGGLQRRF---AIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED---TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVY---RRDQIDQ---------LIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2433
            RGG +R F    +    L       K G  G  + L++N+     +     Y Y V     ME++ +R+ L     + + +  G+   FDG  LF  +K  + E    +E    + VEI++ L      +S    Q  NI+F  I   +  ++IGR ++   +         P         I  G+ TTI +       +S +L  +  ++VL    V+      R+   DQ         L+G  I+TKYNNKTYRI DI  +   N+  + GD +IS+ NYFK +Y +++ +  Q  ++S VKR
Sbjct:   77 RGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLLSRPMWALYQYHVDYKPPMESRRLRSAL----LFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDD---------PFNIPQHRLTIWPGFMTTILQYE-----SSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKR 365          
BLAST of SMEDWI-1 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 174.096 bits (440), Expect = 5.048e-44
Identity = 139/538 (25.84%), Postives = 244/538 (45.35%), Query Frame = -2
Query:   54 NNHLLYRESSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA--HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVE-------DALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKI--YENQTLPQIIYVVVKKRISVKFFKDGAN----PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1613
            N  +  +E        + K  + P G   T + L +P EL ++ G  +  R +    K+L   +    ++    ++       +  ++   +  WG+ I ++ +  +GR L    I  +     T    DW   E+  D    T   + + V    R        +    R  G + +          R +  E         LT   RV  V   +    DD   A  K   + + + +Q +  R  S    ++ ++VA K ++Q+  KLG + W +N+ +   M++G+D  H  + K RSV   V S+++  +++ S V       E         L AL  +    +  P +++IYRDGV D QL   + +E   ++K  E I  YE    P++ ++VV+KRIS   +  G++    P+PGTV+D  +   ++ +FYL++    +G   PT+Y  + +T          + ++P  LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +H   + PAI  ++ E+LF+L
Sbjct:  532 NYGITIKELDQPLLIHRPKERSRPGGKVITGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICLHSASFVTSPAVDWSR-ELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFVKSIHSQLTSEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQ--PQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETIPNYE----PKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNT----------ANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLH---SEPAI--QLSEKLFFL 1046          

HSP 2 Score: 69.3218 bits (168), Expect = 1.835e-11
Identity = 61/280 (21.79%), Postives = 118/280 (42.14%), Query Frame = -1
Query: 1585 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDG------RRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKI-SYLNYFKQRYNINLKNDKQPFVISRVK 2367
            KIG  G  + + SNY     K +   + Y V          +   +   +    G+   FDG      +RL       ++  T+N   ++++I I+L      +S+      N+V   +   +G + +GR  +  +                   ++  GYST+I     ++      L ++  ++VL  ++V+ V           ++ +   + +G  +IT+YNN+TYRI DI+      D   L D  + ++++Y+++ Y I +K   QP +I R K
Sbjct:  289 KIGTKGSPIPIGSNYIPICCKNDA-VFQYHVTFTPNVESLSMRFGMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAERKTDN---QEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPNAV---------VILGKHRLQVWPGYSTSI-----KHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQGSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLIHRPK 550          
BLAST of SMEDWI-1 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 174.096 bits (440), Expect = 5.048e-44
Identity = 139/538 (25.84%), Postives = 244/538 (45.35%), Query Frame = -2
Query:   54 NNHLLYRESSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA--HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVE-------DALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKI--YENQTLPQIIYVVVKKRISVKFFKDGAN----PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1613
            N  +  +E        + K  + P G   T + L +P EL ++ G  +  R +    K+L   +    ++    ++       +  ++   +  WG+ I ++ +  +GR L    I  +     T    DW   E+  D    T   + + V    R        +    R  G + +          R +  E         LT   RV  V   +    DD   A  K   + + + +Q +  R  S    ++ ++VA K ++Q+  KLG + W +N+ +   M++G+D  H  + K RSV   V S+++  +++ S V       E         L AL  +    +  P +++IYRDGV D QL   + +E   ++K  E I  YE    P++ ++VV+KRIS   +  G++    P+PGTV+D  +   ++ +FYL++    +G   PT+Y  + +T          + ++P  LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +H   + PAI  ++ E+LF+L
Sbjct:  532 NYGITIKELDQPLLIHRPKERSRPGGKVITGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICLHSASFVTSPAVDWSR-ELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFVKSIHSQLTSEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQ--PQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETIPNYE----PKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNT----------ANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLH---SEPAI--QLSEKLFFL 1046          

HSP 2 Score: 69.3218 bits (168), Expect = 1.835e-11
Identity = 61/280 (21.79%), Postives = 118/280 (42.14%), Query Frame = -1
Query: 1585 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDG------RRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKI-SYLNYFKQRYNINLKNDKQPFVISRVK 2367
            KIG  G  + + SNY     K +   + Y V          +   +   +    G+   FDG      +RL       ++  T+N   ++++I I+L      +S+      N+V   +   +G + +GR  +  +                   ++  GYST+I     ++      L ++  ++VL  ++V+ V           ++ +   + +G  +IT+YNN+TYRI DI+      D   L D  + ++++Y+++ Y I +K   QP +I R K
Sbjct:  289 KIGTKGSPIPIGSNYIPICCKNDA-VFQYHVTFTPNVESLSMRFGMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAERKTDN---QEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPNAV---------VILGKHRLQVWPGYSTSI-----KHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQGSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLIHRPK 550          
BLAST of SMEDWI-1 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 124.02 bits (310), Expect = 2.228e-28
Identity = 108/462 (23.38%), Postives = 197/462 (42.64%), Query Frame = -2
Query:  279 NNHLLYRESSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA--HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVE-------DALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKI--YENQTLPQIIYVVVKKRISVKFFKDGAN----PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDT 1613
            N  +  +E        + K  + P G   T + L +P EL ++ G  +  R +    K+L   +    ++    ++       +  ++   +  WG+ I ++ +  +GR L    I  +     T    DW   E+  D    T   + + V    R        +    R  G + +          R +  E         LT   RV  V   +    DD   A  K   + + + +Q +  R  S    ++ ++VA K ++Q+  KLG + W +N+ +   M++G+D  H  + K RSV   V S+++  +++ S V       E         L AL  +    +  P +++IYRDGV D QL   + +E   ++K  E I  YE    P++ ++VV+KRIS   +  G++    P+PGTV+D  +   ++ +FYL++    +G   PT+Y  + +T
Sbjct:  532 NYGITIKELDQPLLIHRPKERSRPGGKVITGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICLHSASFVTSPAVDWSR-ELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFVKSIHSQLTSEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQ--PQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETIPNYE----PKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNT 985          

HSP 2 Score: 69.707 bits (169), Expect = 1.347e-11
Identity = 61/280 (21.79%), Postives = 118/280 (42.14%), Query Frame = -1
Query: 1585 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDG------RRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKI-SYLNYFKQRYNINLKNDKQPFVISRVK 2367
            KIG  G  + + SNY     K +   + Y V          +   +   +    G+   FDG      +RL       ++  T+N   ++++I I+L      +S+      N+V   +   +G + +GR  +  +                   ++  GYST+I     ++      L ++  ++VL  ++V+ V           ++ +   + +G  +IT+YNN+TYRI DI+      D   L D  + ++++Y+++ Y I +K   QP +I R K
Sbjct:  289 KIGTKGSPIPIGSNYIPICCKNDA-VFQYHVTFTPNVESLSMRFGMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAERKTDN---QEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPNAV---------VILGKHRLQVWPGYSTSI-----KHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQGSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLIHRPK 550          
BLAST of SMEDWI-1 vs. Ensembl Xenopus
Match: cd74 (CD74 molecule [Source:Xenbase;Acc:XB-GENE-922847])

HSP 1 Score: 218.394 bits (555), Expect = 1.598e-69
Identity = 159/520 (30.58%), Postives = 255/520 (49.04%), Query Frame = -2
Query:   54 ENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPD--DWKFGEIKFDVPKGTAH--RFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1553
            +N P GP      L IP E C+L G +D  RS+ N+ K+L    +  P +R   +  F K      S +  ++ WG+  + + +   GR +AP +      K     P   DW   E++        H   + +L   RN    N   +++ +  G++ I      ++     EV+D    +++V +      V M +  +     DK  A  K   +   + +QCV  +  +    +   +VA K  +QM  K+G + W + + +   MIVG+D +H + +GKRS+ A V S++   +++ S       K E  + L      AL  + N   ++P R+IIYRDGVGD QL    ++E   +   I    E    P++  +VVKKR+S +FF        NP PGT+VD +I +P +Y+F+++SQ    G+ SPT+YNV+ D+            + P  +Q++TY L HLY+NW G IRVP P  YAH+LA LVG+ IHR    P +   + +RL+YL
Sbjct:  373 QNVPAGPI-----LLIP-EFCFLTGLTDRMRSDFNVMKDLAIHTRLAPEQREIQVGKFLKNIHKDDSVQKELQDWGLNFDSKLLPFAGR-VAPAEKILQAGKTADYNPQFADWS-RELRGPTLIRVKHLDNWVLLYTRRNYDAANTLTQNLFKVSGQMGIK-----MNRAVMVEVDDTTDAYVKVLQQKVTPDVQMVVCLLSSNRKDKYDAIKKYLCIDCPVPSQCVLAKTLNK--PQTVVSVATKIALQMNCKMGGELWTVEIPLKELMIVGIDCYHDTLSGKRSIGAFVASLNPSMTRWFSRCVLQAQKQEIVDGLKVCMHAALKAWFNCNKSLPSRIIIYRDGVGDGQLKTMVEYEIPQLQDCIRSA-EKDYSPKLTVIVVKKRVSARFFAHVGGRLQNPPPGTIVDVEITRPEWYDFFIISQSVRVGSVSPTHYNVVYDS----------GALKPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHR---EPHLT--LSDRLYYL 861          

HSP 2 Score: 67.0106 bits (162), Expect = 1.598e-69
Identity = 68/284 (23.94%), Postives = 124/284 (43.66%), Query Frame = -1
Query: 1579 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVI------KDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSN---CESGGIREGPSFFKM-----DNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGD---KKISYLNYFKQRYNINLKNDKQPFVISRVKRS 2367
            K G  G ++ L +N+     + +   + Y +     ME++ +R  L     + + +  G+   FDG  LF   +     D  N V       + V+I+I L       S   +Q  NI+F  +   M  ++IGR ++  ++     S G+   P F        +N  +    S  + R      + + L Y+  +N+ +  +    +  +D    LIG+ ++TKYNNKTYRI DI   D   E         +IS+++Y++ +YN  + +  QP ++   K+ 
Sbjct:  105 KTGSSGSIIQLSTNHIKLISRPQWVLFQYHIDYAPQMESRGLRCAL----LFQHEELIGKARAFDGTMLFLPKRL----DKVNEVFSQTRNGETVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYYNPNDQIEISSHGLTIYPGFSTSILQYENNIMLSIDVSHKVLR------SETVLDYMYNVNQKVESHKFHDICSKD----LIGQIVLTKYNNKTYRIDDI-NWDFTPESTFKKSDGSEISFVDYYRTQYNKGITDLNQPALVHNPKKP 369          
BLAST of SMEDWI-1 vs. Ensembl Xenopus
Match: cd74 (CD74 molecule [Source:Xenbase;Acc:XB-GENE-922847])

HSP 1 Score: 218.394 bits (555), Expect = 1.639e-69
Identity = 159/520 (30.58%), Postives = 255/520 (49.04%), Query Frame = -2
Query:   54 ENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPD--DWKFGEIKFDVPKGTAH--RFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK------VHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1553
            +N P GP      L IP E C+L G +D  RS+ N+ K+L    +  P +R   +  F K      S +  ++ WG+  + + +   GR +AP +      K     P   DW   E++        H   + +L   RN    N   +++ +  G++ I      ++     EV+D    +++V +      V M +  +     DK  A  K   +   + +QCV  +  +    +   +VA K  +QM  K+G + W + + +   MIVG+D +H + +GKRS+ A V S++   +++ S       K E  + L      AL  + N   ++P R+IIYRDGVGD QL    ++E   +   I    E    P++  +VVKKR+S +FF        NP PGT+VD +I +P +Y+F+++SQ    G+ SPT+YNV+ D+            + P  +Q++TY L HLY+NW G IRVP P  YAH+LA LVG+ IHR    P +   + +RL+YL
Sbjct:  353 QNVPAGPI-----LLIP-EFCFLTGLTDRMRSDFNVMKDLAIHTRLAPEQREIQVGKFLKNIHKDDSVQKELQDWGLNFDSKLLPFAGR-VAPAEKILQAGKTADYNPQFADWS-RELRGPTLIRVKHLDNWVLLYTRRNYDAANTLTQNLFKVSGQMGIK-----MNRAVMVEVDDTTDAYVKVLQQKVTPDVQMVVCLLSSNRKDKYDAIKKYLCIDCPVPSQCVLAKTLNK--PQTVVSVATKIALQMNCKMGGELWTVEIPLKELMIVGIDCYHDTLSGKRSIGAFVASLNPSMTRWFSRCVLQAQKQEIVDGLKVCMHAALKAWFNCNKSLPSRIIIYRDGVGDGQLKTMVEYEIPQLQDCIRSA-EKDYSPKLTVIVVKKRVSARFFAHVGGRLQNPPPGTIVDVEITRPEWYDFFIISQSVRVGSVSPTHYNVVYDS----------GALKPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHR---EPHLT--LSDRLYYL 841          

HSP 2 Score: 67.0106 bits (162), Expect = 1.639e-69
Identity = 68/283 (24.03%), Postives = 124/283 (43.82%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVI------KDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSN---CESGGIREGPSFFKM-----DNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQL---GDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            K G  G ++ L +N+     + +   + Y +     ME++ +R  L     + + +  G+   FDG  LF   +     D  N V       + V+I+I L       S   +Q  NI+F  +   M  ++IGR ++  ++     S G+   P F        +N  +    S  + R      + + L Y+  +N+ +  +    +  +D    LIG+ ++TKYNNKTYRI DI   D   E         +IS+++Y++ +YN  + +  QP ++   K+
Sbjct:   85 KTGSSGSIIQLSTNHIKLISRPQWVLFQYHIDYAPQMESRGLRCAL----LFQHEELIGKARAFDGTMLFLPKRL----DKVNEVFSQTRNGETVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYYNPNDQIEISSHGLTIYPGFSTSILQYENNIMLSIDVSHKVLR------SETVLDYMYNVNQKVESHKFHDICSKD----LIGQIVLTKYNNKTYRIDDI-NWDFTPESTFKKSDGSEISFVDYYRTQYNKGITDLNQPALVHNPKK 348          
BLAST of SMEDWI-1 vs. Ensembl Xenopus
Match: piwil3 (piwi-like RNA-mediated gene silencing 3 [Source:NCBI gene;Acc:100496286])

HSP 1 Score: 202.216 bits (513), Expect = 8.974e-69
Identity = 152/517 (29.40%), Postives = 244/517 (47.20%), Query Frame = -2
Query:   54 ELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDI---------------FSNEVKINTKIP----DDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV---------SKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1499
            ELC L G +D  R++  + ++L    +  P +R   +  F  +    ++ +  ++ WG+  ++Q +   GR   P  I               +S E++  T I     D+W         P+        LV   N          V ++IG +R+N       + R  EV+D    +I+V           V   L  I  +K  +  K   +     +QCV  R  S    +   +VA K  MQM  K+G + W + + +   M++G+D +H + +GKRS+   V S++   +++ S       K E  + L      +L  + N    +P R++IYRDGVGD QL     +E    +  I+    +   P++  +VVKKRI+ +FF        NP PGTVVD ++ +P +Y+F++VSQ   +GT SPT+YNV+ D+          S + P  +Q++TY L HLY+NW G IRVP P  YAH+LA LVG+ IH+    P +   +  RL+YL
Sbjct:  393 ELCNLTGLTDRMRNDFGVMRDLAVHTRLPPDQREKQVARFLNYIHKDENVQKELRDWGLNFDKQLLPFVGRVSPPERILQAGRTADYNPQFADWSREMRGQTLISVRHLDNWMLL-----YPRRCYDAAQTLVQTLN---------KVAQQIG-MRMN-------NVRMFEVDDRANSYIQVLNAEVNPDTQMVVCVLSSIHKEKYDSIKKYLCLQIPTPSQCVVARTLSK--PQTVLSVATKIAMQMNCKMGGELWSVEIPLGEMMVIGIDCYHDTLSGKRSIAGFVASMNRNLTRWYSRCVLQDQKQEIVDGLKVCLQASLHAWFNCNKNLPSRILIYRDGVGDGQLKTLVNYEIPQFLDCIKSAGRDYC-PKLSIIVVKKRINARFFAHLGGRIQNPPPGTVVDVEVTRPEWYDFFIVSQSVRQGTVSPTHYNVVYDS----------SGLKPDYMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHK---EPHLA--LSNRLYYL 869          

HSP 2 Score: 80.4925 bits (197), Expect = 8.974e-69
Identity = 76/287 (26.48%), Postives = 134/287 (46.69%), Query Frame = -1
Query: 1567 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED--TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV----YR----RDQID----QLIGRDIITKYNNKTYRISDI-KEMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRP 2367
            K G  G  + L +N+     + +   Y Y +     ME++ +RT L     Y + +  G+   FDG  LF   + +   +  ++    ++V+I+I L       S   +Q  NI+F  +   M  ++IGR ++  S+         P      N  I  G++T+I +        S +L L+  ++VL    V+ V    YR    RD  D    +L+G+ ++TKYNNKTYRI +I   M      +  D   IS+++Y++ +YN  +++ +Q  + +  +R  VRP
Sbjct:  115 KTGVSGSTIQLSTNHIKLVSRPQWVLYQYHIDYNPQMESRRLRTAL----LYQHEELIGKARAFDGTMLFAPKRLNKATEVFSQTRNGENVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYYNPSD---------PIEISQHNLTIWPGFTTSILQYE-----TSIMLSLDVSHKVLRSETVLDVMTKLYRMHGDRDFADAVTKELLGQIVLTKYNNKTYRIDEICWNMTPQSTFKKSDGSDISFVDYYRMQYNKEIRDLRQALIANIPRR--VRP 381          
BLAST of SMEDWI-1 vs. Ensembl Xenopus
Match: bckdhb (branched chain keto acid dehydrogenase E1, beta polypeptide [Source:Xenbase;Acc:XB-GENE-953785])

HSP 1 Score: 211.46 bits (537), Expect = 5.273e-67
Identity = 153/527 (29.03%), Postives = 254/527 (48.20%), Query Frame = -2
Query:   54 AQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREP---RERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDV-PKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK------VHMALVFIPDDK--VYAKVKNF-TMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKR-SVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQT--LPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1571
            A K K  + P+ P    +++ +  ELCYL G S    S+  L K+L    + +P   ++RL  + D  + T    ++  ++ WG+ +++Q I + GR   P  IF  +       P DW        V        + +L   RN     N ++ + +    +  +  M  I      +VED    F+R  +      + +    IP ++   Y  +K F ++   + +QCV  R    +  +   +VA+K  MQM  KLG + W + + +   M+VG+D       K  SV   V S +A+ +++ S     K  ++F + L      A+  +Q   N +P R+++YRDGVGD QL     +E   + +++    E +T   P++  +VV+K+   +F+        NP  GT+VD +  +P +Y+FYL+SQ   +GT +PT YNVL+D           + + P  +Q++TY L HLY+NW G IRVP P  YAH+L  LVG+ IHR  +P      +  +LFYL
Sbjct:  328 ALKAKKSDNPDAP----RAVHLIPELCYLTGLSSRALSDFRLMKDLSMETQLDPERRQQRLQRLADSIQRTPEASAE--LEKWGLRMDKQ-IPVTGRIAPPERIFMRDNVCTPGSPADWARDTRNEKVICVAPLQNWLMLFSYRNADVAENLLQCLMKVASGMGFHMDMPRIV-----QVEDNPVSFLRTLQKNVTPDLQLVFCVIPTNQKDSYDSIKKFLSLDQPVPSQCVQNRTLGRQ--QMMMSVANKIAMQMICKLGGELWAVEIPLKALMVVGIDINKDAVNKSMSVVGFVASTNARLTRWHSRCIIQKTTSDFADCLKMCMKGAIQNWQRCNNDLPNRIVVYRDGVGDGQLKMVVDYE---IPQLLSSFRETKTSYCPRLSVIVVRKKCISRFYTQTGRGIQNPVLGTIVDSEATRPEWYDFYLISQNARQGTVNPTYYNVLLDE----------NGLKPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLTFLVGQSIHREPSP-----ELSHKLFYL 822          

HSP 2 Score: 65.4698 bits (158), Expect = 5.273e-67
Identity = 60/275 (21.82%), Postives = 116/275 (42.18%), Query Frame = -1
Query: 1585 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVV----SVYRRDQID--------QLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISRVK 2367
            K G  G  V L +N     +  +   Y Y V    +    KL+  L Y++ +  G+   F G  LF +              + V+I+I L      +S    Q   I+F  +   +   ++GR ++  ++         P         +  G+  +I +  ++    + + +     +VL    V+    ++Y +   +        +L+G  ++T+YNNKTYR+ DI       D     D  +I+Y +Y+ Q+Y+IN+ + +QP ++S +K
Sbjct:   70 KTGTSGAPVKLMTNLFGLTLPTQWKLYQYRVDFSPEFASRKLKTALLYSHGETLGRARAFHGEILFLSRNIGKVNAFTTRKGETVKITITLTNQLPADSPVCIQFFGILFKKVFKSLNMYQVGRNYYNPAD---------PVIIPQHRLMLWPGFVLSIMKLESQLALCADVSH-----KVLRNETVLDSMKALYSKVPKERFTDICEKELLGLVVLTRYNNKTYRVDDIDWSTKPTDSFPRKDGSEITYTDYYSQQYSINISDLQQPMLVSALK 330          
BLAST of SMEDWI-1 vs. Ensembl Xenopus
Match: piwil3 (piwi-like RNA-mediated gene silencing 3 [Source:NCBI gene;Acc:100496286])

HSP 1 Score: 189.119 bits (479), Expect = 7.150e-65
Identity = 151/517 (29.21%), Postives = 239/517 (46.23%), Query Frame = -2
Query:   54 ELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDI---------------FSNEVKINTKIP----DDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV---------SKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1499
            ELC L G +D  R++  + ++L    +  P +R   +  F  +    ++ +  ++ WG+  ++Q +   GR   P  I               +S E++  T I     D+W         P+        LV   N          V ++IG +R+N       + R  EV+D    +I+V           V   L  I  +K  +  K   +     +QCV  R  S    +   +VA K  MQM  K+G + W + + +   M++G+D +H + +GKRS+        A FS  + F+            L      +L  + N    +P R++IYRDGVGD QL     +E    +  I+    +   P++  +VVKKRI+ +FF        NP PGTVVD ++ +P +Y+F++VSQ   +GT SPT+YNV+ D+          S + P  +Q++TY L HLY+NW G IRVP P  YAH+LA LVG+ IH+    P +   +  RL+YL
Sbjct:  403 ELCNLTGLTDRMRNDFGVMRDLAVHTRLPPDQREKQVARFLNYIHKDENVQKELRDWGLNFDKQLLPFVGRVSPPERILQAGRTADYNPQFADWSREMRGQTLISVRHLDNWMLL-----YPRRCYDAAQTLVQTLN---------KVAQQIG-MRMN-------NVRMFEVDDRANSYIQVLNAEVNPDTQMVVCVLSSIHKEKYDSIKKYLCLQIPTPSQCVVARTLSK--PQTVLSVATKIAMQMNCKMGGELWSVEIPLGEMMVIGIDCYHDTLSGKRSI--------AGFSSCVIFI------------LYFLLPASLHAWFNCNKNLPSRILIYRDGVGDGQLKTLVNYEIPQFLDCIKSAGRDYC-PKLSIIVVKKRINARFFAHLGGRIQNPPPGTVVDVEVTRPEWYDFFIVSQSVRQGTVSPTHYNVVYDS----------SGLKPDYMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHK---EPHLA--LSNRLYYL 859          

HSP 2 Score: 80.8777 bits (198), Expect = 7.150e-65
Identity = 76/287 (26.48%), Postives = 134/287 (46.69%), Query Frame = -1
Query: 1567 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED--TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV----YR----RDQID----QLIGRDIITKYNNKTYRISDI-KEMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRP 2367
            K G  G  + L +N+     + +   Y Y +     ME++ +RT L     Y + +  G+   FDG  LF   + +   +  ++    ++V+I+I L       S   +Q  NI+F  +   M  ++IGR ++  S+         P      N  I  G++T+I +        S +L L+  ++VL    V+ V    YR    RD  D    +L+G+ ++TKYNNKTYRI +I   M      +  D   IS+++Y++ +YN  +++ +Q  + +  +R  VRP
Sbjct:  125 KTGVSGSTIQLSTNHIKLVSRPQWVLYQYHIDYNPQMESRRLRTAL----LYQHEELIGKARAFDGTMLFAPKRLNKATEVFSQTRNGENVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYYNPSD---------PIEISQHNLTIWPGFTTSILQYET-----SIMLSLDVSHKVLRSETVLDVMTKLYRMHGDRDFADAVTKELLGQIVLTKYNNKTYRIDEICWNMTPQSTFKKSDGSDISFVDYYRMQYNKEIRDLRQALIANIPRR--VRP 391          
BLAST of SMEDWI-1 vs. Ensembl Mouse
Match: Piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:MGI Symbol;Acc:MGI:1928897])

HSP 1 Score: 201.06 bits (510), Expect = 4.513e-67
Identity = 142/506 (28.06%), Postives = 236/506 (46.64%), Query Frame = -2
Query:   54 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSN--EVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV------SKVHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1517
            ++ IP ELCYL G +D  R++ N+ K+L    +  P +R  ++     +     + +  ++ WG+  +   ++  GR L    I         N +  D  K       +       + ++   RN    N+ I+++ +    + I      +      EV+D    ++R       S   + +  +     DK  A  K         +QCV  R    +  +    +A K  +QM  K+G + W +++ +   MIVG+D +H  T G+RS+   V SI+   +++ S         E  + L      AL  +      MP R+I+YRDGVGD QL     +E    +  ++ +      P++  +VVKKR++ +FF        NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ D+          S + P  +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ IHR       N  +  RL+YL
Sbjct:  381 AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQ-----MKKAIMIEVDDRTEAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYN-PRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDS----------SGLKPDHIQRLTYKLCHVYYNWPGVIRVPAPCQYAHKLAFLVGQSIHR-----EPNLSLSNRLYYL 862          

HSP 2 Score: 75.485 bits (184), Expect = 4.513e-67
Identity = 73/286 (25.52%), Postives = 131/286 (45.80%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSD-----EDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVV----SVYRR-------DQID-QLIGRDIITKYNNKTYRISDIKEMDVNDEV---QLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            K G  G +V L +N+     + +   Y Y +    +ME + +R+ L     + +    G+   FDG  LF   +           T N   + V I+I L       S    Q  NI+F  +   M  ++IGR ++  S+         P         I  G++T+I +  N     + +L  +  ++VL    V+    ++Y++       +Q+  +LIG  ++TKYNNKTYR+ DI + D N +    +    ++S+L Y++++YN  + + KQP ++S+ KR
Sbjct:  105 KTGSSGIIVKLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSAL----LFQHEDLIGRCHAFDGTILFLPKRLQHKVTEVFSQTRNG--EHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSD---------PIDIPNHRLVIWPGFTTSILQYEN-----NIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVSKELIGLIVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR 369          
BLAST of SMEDWI-1 vs. Ensembl Mouse
Match: Piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:MGI Symbol;Acc:MGI:3041167])

HSP 1 Score: 181.8 bits (460), Expect = 3.119e-63
Identity = 135/522 (25.86%), Postives = 241/522 (46.17%), Query Frame = -2
Query:   54 KKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREP---RERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTA-HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVH------MALVFIPDDK--VYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQAS-VFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDG----ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1562
            K+  N+   P    Q + +  ELC+L G S    S+  L K +    +  P   +++L  + D  +     + +  +++WG+    Q +++ GR +    I   +         DW        V      +R+ ++  +R       F+  ++R  G +  N     I      +V++    F+R  +VH      + +  +P ++   Y  +K +  S   + +QCV  R  + +      +VA K  MQM  KLG + W + + +   M+VG+D       K  V    V SI+++ +++ S     +   +  + L      AL  +    + +P R+++YRDGVG+ QL    ++E   ++K + +   +    ++  VVV+KR  ++ F        NP  GTVVD +  +P +Y+FYL+SQ   +GT SPT+YNV+ D           + + P  +Q++T+ L HLY+NW G I VP P  YAH+L  LV + +H+    P++   +   LFYL
Sbjct:  356 KRKRNDNSEP----QMVHLMPELCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRNPVARFE--LETWGLHFGSQ-LSLTGRVVPSEKILLQDHTCQPAFAADWSKDMRSCKVLSSQPLNRWLIVCCNRAEHLIEAFLSCLRRVGGSMGFNVGYPKII-----KVDETPAAFLRAIQVHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTML--SVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTECGSDARSCRLSVVVVRKRCLLRLFASTDHTVQNPPLGTVVDSEATRPEWYDFYLISQTANRGTVSPTHYNVIYDD----------NALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHK---EPSLE--LANNLFYL 848          

HSP 2 Score: 82.0333 bits (201), Expect = 3.119e-63
Identity = 72/280 (25.71%), Postives = 124/280 (44.29%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWH---SDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERIN-RVLNENNVV------------SVYRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            K G  G  V L +N  N ++  +   Y Y V         +L + L Y +S  + +   FDG  LF + K     ++  +E    + ++I++ L +    NS    Q  N++F  I   +   +IGR F+  S          P         +  G++ +++         S LL+   +N +VL    V+            S +      QL+G  ++T+YNNKTYRI DI   +      Q  D  +++Y++Y+KQ+Y+I L +  QP ++S +KR
Sbjct:   93 KTGSSGIPVRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYNHSILSDKAKAFDGASLFLSEKLDQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFYKPSE---------PVEIPQYKLSLWPGFAISVSH------FESKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTRYNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKR 357          
BLAST of SMEDWI-1 vs. Ensembl Mouse
Match: Piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:MGI Symbol;Acc:MGI:1928897])

HSP 1 Score: 166.392 bits (420), Expect = 1.270e-56
Identity = 120/462 (25.97%), Postives = 210/462 (45.45%), Query Frame = -2
Query:  183 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKS-KDYMKSWGMCIEEQPITIRGRELAPVDIFSN--EVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV------SKVHMALVFIPD---DKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNW 1517
            ++ IP ELCYL G +D  R++ N+ K+L    +  P +R  ++     +     + +  ++ WG+  +   ++  GR L    I         N +  D  K       +       + ++   RN    N+ I+++ +    + I      +      EV+D    ++R       S   + +  +     DK  A  K         +QCV  R    +  +    +A K  +QM  K+G + W +++ +   MIVG+D +H  T G+RS+   V SI+   +++ S         E  + L      AL  +      MP R+I+YRDGVGD QL     +E    +  ++ +      P++  +VVKKR++ +FF        NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ D+          S + P  +Q++TY L H+Y+NW
Sbjct:  381 AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQ-----MKKAIMIEVDDRTEAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQ--QTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYN-PRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDS----------SGLKPDHIQRLTYKLCHVYYNW 823          

HSP 2 Score: 75.0998 bits (183), Expect = 1.270e-56
Identity = 73/286 (25.52%), Postives = 131/286 (45.80%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSD-----EDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVV----SVYRR-------DQID-QLIGRDIITKYNNKTYRISDIKEMDVNDEV---QLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            K G  G +V L +N+     + +   Y Y +    +ME + +R+ L     + +    G+   FDG  LF   +           T N   + V I+I L       S    Q  NI+F  +   M  ++IGR ++  S+         P         I  G++T+I +  N     + +L  +  ++VL    V+    ++Y++       +Q+  +LIG  ++TKYNNKTYR+ DI + D N +    +    ++S+L Y++++YN  + + KQP ++S+ KR
Sbjct:  105 KTGSSGIIVKLSTNHFRLTSRPQWALYQYHIDYNPLMEARRLRSAL----LFQHEDLIGRCHAFDGTILFLPKRLQHKVTEVFSQTRNG--EHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSD---------PIDIPNHRLVIWPGFTTSILQYEN-----NIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVSKELIGLIVLTKYNNKTYRVDDI-DWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKR 369          
BLAST of SMEDWI-1 vs. Ensembl Mouse
Match: Piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:MGI Symbol;Acc:MGI:1930036])

HSP 1 Score: 161.384 bits (407), Expect = 5.151e-52
Identity = 116/477 (24.32%), Postives = 220/477 (46.12%), Query Frame = -2
Query:  114 ELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGK-SKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGT--AHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV----SKVHMALVFI--PDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGAN----PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKI 1499
            EL ++ G  +  + +    K+L   +   P++    +    +     + + + +  WG+ + +    I GR L    I        T    +W   E+  D    T   H + +    R        +  +++  G + +  +  +    + + +E  +     +     K+ M +  I    D +Y  +K    + + + +Q +  R        R ++VA K ++QM  KLG + WG+++ +   M++G+D +H  + G RSV   V SI+   +++ S V       E  ++L    + +L  +    + +P ++++YRDGV D QL     +E   + K  E  ++N   P+++  VV+K+IS   +    +    P+PGTVVD  I    + +FYL++    +G   PT+Y  +++T          + +SP  +Q++T+ L H+Y+NW GTIRVP P  YAH+LA L G+I
Sbjct:  494 ELSFMTGIPEKMKKDFRAMKDLTQQINLSPKQHHGALECLLQRISQNETASNELTRWGLSLHKDVHKIEGRLLPMERINLRNTSFVTSEDLNW-VKEVTRDASILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRISPPAWVELKDDRIETYIRTIQSLLGVEGKIQMVVCIIMGTRDDLYGAIKKLCCVQSPVPSQVINVRTIGQ--PTRLRSVAQKILLQMNCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKYYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEA-FDNYH-PKMVVFVVQKKISTNLYLAAPDHFVTPSPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYICVLNT----------ANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQI 955          

HSP 2 Score: 65.0846 bits (157), Expect = 5.151e-52
Identity = 53/192 (27.60%), Postives = 92/192 (47.92%), Query Frame = -1
Query: 1591 DVEISIRL-LTTFLKN-SEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERI-NRVLNENNVVSVYR----------RDQIDQL-IGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISR 2118
            D EISI++ LT  L+  S+      N+VF  +   +  + +GR F+  ++             +    +I  GY+ +I R      T   L  L  + ++V+  ++V+ V            +D+  +L +G  +IT+YNN+TYRI D+       D   + D K+I++L Y+ + Y I +K D QP +I R
Sbjct:  297 DAEISIKIQLTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSA---------MVLQQHRLQIWPGYAASIRR------TDGGLFLLADVSHKVIRNDSVLDVMHAIYQQNKEHFQDECSKLLVGSIVITRYNNRTYRIDDVDWNKTPKDSFVMSDGKEITFLEYYSKNYGITVKEDDQPLLIHR 473          
BLAST of SMEDWI-1 vs. Ensembl Mouse
Match: Piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:MGI Symbol;Acc:MGI:3041167])

HSP 1 Score: 129.028 bits (323), Expect = 6.093e-30
Identity = 97/387 (25.06%), Postives = 172/387 (44.44%), Query Frame = -2
Query:   54 HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVH------MALVFIPDDK--VYAKVKNFTMS-TGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQAS-VFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1181
            +R+ ++  +R       F+  ++R  G +  N     I      +V++    F+R  +VH      + +  +P ++   Y  +K +  S   + +QCV  R  + +      +VA K  MQM  KLG + W + + +   M+VG+D       K  V    V SI+++ +++ S     +   +  + L      AL  +    + +P R+++YRDGVG+ QL    ++E   ++K + +                          G++                Y+FYL+SQ   +GT SPT+YNV+ D           + + P  +Q++T+ L HLY+NW G I VP P  YAH+L  LV + +H+    P++   +   LFYL
Sbjct:  553 NRWLIVCCNRAEHLIEAFLSCLRRVGGSMGFNVGYPKII-----KVDETPAAFLRAIQVHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTML--SVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTEC-------------------------GSDAR--------------YDFYLISQTANRGTVSPTHYNVIYDD----------NALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHK---EPSLE--LANNLFYL 878          

HSP 2 Score: 77.0258 bits (188), Expect = 8.852e-14
Identity = 74/272 (27.21%), Postives = 123/272 (45.22%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWH---SDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSF----FKMD-NFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            K G  G  V L +N  N ++  +   Y Y V         +L + L Y +S  + +   FDG  LF + K     ++  +E    + ++I++ L +    NS    Q  N++F  I   +   +IGR F+  S        E P +    F  D N+K+L           NE    + L ++      L     +S +      QL+G  ++T+YNNKTYRI DI   +      Q  D  +++Y++Y+KQ+Y+I L +  QP ++S +KR
Sbjct:  156 KTGSSGIPVRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYNHSILSDKAKAFDGASLFLSEKLDQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFYKPSE-----PVEIPQYNKLLFNADVNYKVL----------RNE----TVLDFMTD----LCLRTGMSCFTEMCHKQLVGLVVLTRYNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKR 404          
BLAST of SMEDWI-1 vs. UniProt
Match: sp|Q2Q5Y9|PIWI1_SCHMD (Piwi-like protein 1 OS=Schmidtea mediterranea OX=79327 GN=wi-1 PE=2 SV=1)

HSP 1 Score: 1049.27 bits (2712), Expect = 0.000e+0
Identity = 503/504 (99.80%), Postives = 504/504 (100.00%), Query Frame = -2
Query:   54 KKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1565
            K+KTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL
Sbjct:  305 KEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          

HSP 2 Score: 627.091 bits (1616), Expect = 0.000e+0
Identity = 306/307 (99.67%), Postives = 307/307 (100.00%), Query Frame = -1
Query: 1558 MDSTNVTSDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK 2478
            MDSTNVT+DPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
Sbjct:    1 MDSTNVTTDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK 307          
BLAST of SMEDWI-1 vs. UniProt
Match: sp|Q2PC95|PIWIL_DUGJA (Piwi-like protein OS=Dugesia japonica OX=6161 GN=iwi PE=2 SV=1)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 298/509 (58.55%), Postives = 386/509 (75.83%), Query Frame = -2
Query:   54 KKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKS-WGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1565
            K+K  NE E P + D +L+I GELC+LCGFSD E+SNI+LQKNLG VLKR PRERL+DI  FC W     +   M + WG+ I+  P+ I GREL   D+ S   +IN KI DDWKFG+++F+V KG  H   V++VDRN S + NF+ DV+ EI +LR +  +  +  C +N+VE +L D +R       +ALVF+PDD+VYAKVK+FT+STGLLTQCVT RNG+NR+D+RR+ V+ K+VMQ+FSK GYDPW I++KM PTMIVG+DTFH+K  K+S+ ASVFSI++ FSQY+SF NS KGK EFH+ L  NF  ALT F+  +  +P+R+++YRDGVGDSQL FTK+FE DA+  ++E IY+     +PQIIYV+VKKRI  K F  G N NPGT+VD++IVKPNF+EF+LVSQ+ T+GTASPTNYNVL DT++ N K   +  ++P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAH+LAEL+GK+H+G TP  IN+RIR RLFYL
Sbjct:  311 KRKEHNENEAPEDMDLTLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQN-KAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          

HSP 2 Score: 317.005 bits (811), Expect = 0.000e+0
Identity = 153/297 (51.52%), Postives = 211/297 (71.04%), Query Frame = -1
Query: 1558 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSI--RTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIRE--GPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK 2436
            RRGGLQ+RF I+EP LQP+   DKIG  G+VV L+SN+  F++     + MYD       +  + KL++L+      N    FC+DGRRLFT+  W    D +   I + ++S+RL++TFL ++EEYYQMIN++ NN+QI MGQEKIG+ +FLGSN     + +  GP+FF+ +NFK+LGG+ TT+ RGT  NG  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDI+TKYNNKTYRIS+IKEM++N+  ++  + +SY  YFK+RYNINL  ++QPFV++RVK+   R K K
Sbjct:   17 RRGGLQKRFRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRK 313          
BLAST of SMEDWI-1 vs. UniProt
Match: sp|Q2Q5Y8|PIWI2_SCHMD (Piwi-like protein 2 OS=Schmidtea mediterranea OX=79327 GN=wi-2 PE=2 SV=1)

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 294/496 (59.27%), Postives = 381/496 (76.81%), Query Frame = -2
Query:   54 DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYM-KSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISF-VNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQT--LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1523
            D +L+IPGELC+LCGFSD E+SN++LQKNLG VLKREPRERL+DI  +C W     +   M   W + I+ +P+ I GREL P D+ S   KIN K+ DDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SF VNS KG+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY+     +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P AIN+RIR RLFYL
Sbjct:  339 DMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          

HSP 2 Score: 300.442 bits (768), Expect = 0.000e+0
Identity = 144/292 (49.32%), Postives = 201/292 (68.84%), Query Frame = -1
Query: 1570 RGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVR 2433
            RGGL+  F I+EP LQP  +T+K G  GR V L+SN+  F++     F MYD V     +  K++L       + N  P  FCFDGRRLFT+ KWH + D +     + ++++RL++T L  +EEYYQMIN++ NN+Q+ +GQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK+RYNI L    QPFV++RVK+ M R
Sbjct:   25 RGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRR 316          
BLAST of SMEDWI-1 vs. UniProt
Match: sp|Q8UVX0|PIWL1_DANRE (Piwi-like protein 1 OS=Danio rerio OX=7955 GN=piwil1 PE=1 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.096e-74
Identity = 152/502 (30.28%), Postives = 244/502 (48.61%), Query Frame = -2
Query:   54 ELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDI-RDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKIN-TKIPDDWKFGEIKFDVPKGTAHRFG---VLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRV------SKVHMALVFIP---DDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFK--DG--ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1499
            E CYL G +D  R++ N+ K+L +  +  P +R   I R        G  ++ + +WG+  E + +++ GR L    I              DW   E++  +P  +        +    RN     + ++ + +  G + I      +      E ED     +R        +  M +V +P    DK     K   +     +QCV  R  S    +   TVA K  +QM  K+G + W + + +   MIVG+D +H +  GKRS+ A V S++   S++ S         E  + L  +   AL  +    N++P R+I+YRDGVGD  L     +E   +M+ I+ + ++   P++  VVVKKRIS +FF   DG  ANP PGTV+D ++ +P +Y+F++VSQ    G  +PT+YNV+ D           S + P  +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ IH+    P +N  + + L+YL
Sbjct:  382 EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWS-KEMR-GLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIR-----MQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISK--PQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTMGQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDN----------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHK---EPNMN--LDDFLYYL 858          

HSP 2 Score: 89.3521 bits (220), Expect = 1.096e-74
Identity = 84/307 (27.36%), Postives = 136/307 (44.30%), Query Frame = -1
Query: 1582 RGGLQRRF---AIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED---TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVY---RRDQIDQ---------LIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2433
            RGG +R F    +    L       K G  G  + L++N+     +     Y Y V     ME++ +R+ L     + + +  G+   FDG  LF  +K  + E    +E    + VEI++ L      +S    Q  NI+F  I   +  ++IGR ++   +         P         I  G+ TTI +       +S +L  +  ++VL    V+      R+   DQ         L+G  I+TKYNNKTYRI DI  +   N+  + GD +IS+ NYFK +Y +++ +  Q  ++S VKR
Sbjct:   77 RGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLLSRPMWALYQYHVDYKPPMESRRLRSAL----LFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDD---------PFNIPQHRLTIWPGFMTTILQYE-----SSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKR 365          
BLAST of SMEDWI-1 vs. UniProt
Match: sp|A8D8P8|SIWI_BOMMO (Piwi-like protein Siwi OS=Bombyx mori OX=7091 GN=Siwi PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.110e-73
Identity = 140/478 (29.29%), Postives = 236/478 (49.37%), Query Frame = -2
Query:  120 ELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCK-WTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIP-----DDW-KFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSN---EVEDALTDFIRVSKVHMALVFIP---DDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF----KDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVG 1499
            ELC   G SD  R+N  L ++L    K  P +R+  + +F + +T   +  + + +W + + ++ + I+GR+L P +I       N K P     + W +    K  +     + + V+  +R      +FI+ + +  G +        +   R +   E  +   + I      + L  +     D+  A  K  T+   + TQ V  RN S++      ++A K  +Q+  KLG  PW +++ +   M+VG D  H +++ ++S  A V ++  + +QY S VN+     E   ++G N  +A+  F+ K  T P R+ IYRDGVGD Q+ +    E   + K + +IY    + ++ +++V KRI+ + F    + G NP PGTV+D+ +  P  Y+FYLVSQ   +GT +PT+YNV+ DT   N          P  +Q++TY LTHLYFN    +RVP    YAH+LA L  
Sbjct:  421 ELCRQTGLSDEMRANFKLMRSLDVHTKIGPDKRIEKLNNFNRRFTSTPEVVEELATWSLKLSKELVKIKGRQLPPENIIQAN---NVKYPAGDTTEGWTRDMRSKHLLAIAQLNSWVVITPERQRRDTESFIDLIIKTGGGVGFRMRSPDLVVIRHDGPIEYANMCEEVIARKNPALILCVLARNYADRYEAIKKKCTVDRAVPTQVVCARNMSSKSA---MSIATKVAIQINCKLGGSPWTVDIPLPSLMVVGYDVCHDTRSKEKSFGAFVATLDKQMTQYYSIVNAHTSGEELSSHMGFNIASAVKKFREKNGTYPARIFIYRDGVGDGQIPYVHSHEVAEIKKKLAEIYAGVEI-KLAFIIVSKRINTRIFVQRGRSGENPRPGTVIDDVVTLPERYDFYLVSQNVREGTIAPTSYNVIEDTTGLN----------PDRIQRLTYKLTHLYFNCSSQVRVPSVCQYAHKLAFLAA 881          

HSP 2 Score: 87.8113 bits (216), Expect = 1.110e-73
Identity = 73/292 (25.00%), Postives = 133/292 (45.55%), Query Frame = -1
Query: 1570 QPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWH-------SDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVR 2388
            +P+ VT K G  G  + L +NY       +   Y Y V +  +   T +   L   +SK  G  + FDG  L+T ++ H       SD  T+N   + + I I+L          Y Q+ NI+       +  + +GR +F     +     + P F      +I  GY TTI +  +       LL  E  ++VL  + V+ +           Y++  ++ ++G+ ++T YN +TYR+ D+   +      ++ D+ I+Y+ Y+ ++YN+ +++  QP +ISR K   +R
Sbjct:  136 RPEAVTSKKGTSGTPLDLLANYFTVETTPKWGLYQYHVDISPEEDSTGVRKALMRVHSKTLGG-YLFDGTVLYTVNRLHPDPMELYSDRKTDN---ERMRILIKLTCEVSPGDYHYIQIFNIIIRKCFNLLKLQLMGRDYF-----DPEAKIDIPEF----KLQIWPGYKTTINQYEDR-----LLLVTEIAHKVLRMDTVLQMLSEYAATKGNNYKKIFLEDVVGKIVMTDYNKRTYRVDDVAWNVSPKSTFKMRDENITYIEYYYKKYNLRIQDPGQPLLISRSKPREIR 409          
BLAST of SMEDWI-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|19621511 (tr|D2Z0D8|D2Z0D8_DUGJA DjPiwiA OS=Dugesia japonica OX=6161 GN=DjpiwiA PE=2 SV=1)

HSP 1 Score: 963.37 bits (2489), Expect = 0.000e+0
Identity = 452/504 (89.68%), Postives = 483/504 (95.83%), Query Frame = -2
Query:   54 KKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1565
            K+K+ENEPEGP E DQSLSIPGELCYLCGFSDSERSN+NLQK+LG VLKREPRERLNDI+DFCKWTG GKSK++M +W M IEEQPITIRGREL PVDI SN+VKIN KIPDDWKFGE+KFDVPKG AHRFGVLVVDRNP+HFNNFI+DVKREIGRLRINYT+D+ISSCR NEVE+AL++F+RV+KVH+ALVFIPDDK+YAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSIS+KFSQYISFVNSSKGKNEFHENLGKNFLTA+TTFQ KF TMP R IIYRDGVGDSQLAFTKKFET+AVMKMIEKIYENQ LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQ+TTKGTASPTNYNVLMDTK+ NKKTNE+S M+PSVLQQIT+SLTHLYFNWMGTIRVPVPTHYAHRLAELVGK+HRG TPP IN+RIRERLFYL
Sbjct:  306 KEKSENEPEGPKEMDQSLSIPGELCYLCGFSDSERSNLNLQKSLGGVLKREPRERLNDIKDFCKWTGGGKSKNFMTNWNMSIEEQPITIRGRELPPVDIASNDVKINAKIPDDWKFGEVKFDVPKGIAHRFGVLVVDRNPNHFNNFIDDVKREIGRLRINYTIDNISSCRGNEVEEALSEFVRVNKVHLALVFIPDDKIYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISSKFSQYISFVNSSKGKNEFHENLGKNFLTAITTFQQKFGTMPHRFIIYRDGVGDSQLAFTKKFETEAVMKMIEKIYENQNLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYNNKKTNEISPMAPSVLQQITFSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGATPPTINERIRERLFYL 809          

HSP 2 Score: 534.258 bits (1375), Expect = 7.006e-174
Identity = 258/309 (83.50%), Postives = 281/309 (90.94%), Query Frame = -1
Query: 1555 MDSTNVTSDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVR-PKEKN 2478
            MD TNV  DP  RPRRGGLQRRFAIIEPALQP+T+ DK+GKDGRVV+LKSNYANF+IKVEGPFYMYDVVME KSIR+KLELLLAY  +K +GQPFCFDGRRLFTT+KW+  +D E   + +VEISIRLLTTFLKNSEEYYQMINIVFNNIQ+FMGQEKIGRQFFLGSNCESGGIREGPSFFKM+NFKILGGYSTTITRGTN++GTASTLLYLERINRVLNEN+V++VYRRDQIDQLIGRDIITKYNNKTYRISDIKEMD NDE+ L   KISY NYFKQRYNINLK DKQPFVISR+KRS    PKEK+
Sbjct:    1 MDITNVPRDPASRPRRGGLQRRFAIIEPALQPETIIDKVGKDGRVVNLKSNYANFSIKVEGPFYMYDVVMEPKSIRSKLELLLAYGKTKGDGQPFCFDGRRLFTTTKWNRTDDVEKFTVNNVEISIRLLTTFLKNSEEYYQMINIVFNNIQLFMGQEKIGRQFFLGSNCESGGIREGPSFFKMENFKILGGYSTTITRGTNDDGTASTLLYLERINRVLNENSVLAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDFNDEIDLNGSKISYSNYFKQRYNINLKTDKQPFVISRIKRSAAHNPKEKS 309          
BLAST of SMEDWI-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|23080241 (tr|T1E104|T1E104_9PLAT PIWI-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 380/505 (75.25%), Postives = 444/505 (87.92%), Query Frame = -2
Query:   54 QKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1568
            +K+  ENEP+ P E DQSLSIPGELC+LCGFSD+ERSNINLQK+LG+VLKREPRERLNDI DFC WT  GK+  +MK WG+ IE+QPITI+GREL  VD+FSN  +INTK  DDWKFGE+KFD+P+G  HRFG+LV+DRN + FN FI+D+KRE+ RLRIN T++++SSCR+NE+EDALTDF+RV KVHMA+VFI DDKVYA+VKNFT+STGLLTQCVT RN +NRDDRRRK VADKSVMQMF+KLGYDPWG+ LKM PTM+VGLDTFHSKTGKRS+QASVFSIS KFSQY+SFVNSSKGKNE+H+NL +NF +A+ TF++KFNT+P R IIYRDGVGDSQL FTKK+ETD V+K++EK+YEN  LPQIIY++VKKRISVKFFKDG NPNPGT+VDE +VKPNFYEFYLVSQ+TTKGTA+PTNYNVLMDT+ TN    +  +  P  LQ ITY+LTHLYFNWMGTIRVPVPTHYAHRLAELVG +HRG  PP I+DRIRERLFYL
Sbjct:  298 RKENIENEPDAPKEADQSLSIPGELCFLCGFSDNERSNINLQKSLGSVLKREPRERLNDIADFCHWTKEGKADSFMKKWGVEIEDQPITIKGRELNGVDVFSNRQRINTKSSDDWKFGEVKFDIPQGAQHRFGILVIDRNANQFNQFIDDMKREMSRLRINNTIEAVSSCRANEIEDALTDFVRVQKVHMAIVFIGDDKVYARVKNFTISTGLLTQCVTIRNATNRDDRRRKVVADKSVMQMFAKLGYDPWGVELKMVPTMVVGLDTFHSKTGKRSIQASVFSISHKFSQYLSFVNSSKGKNEYHDNLVQNFTSAIKTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDEVLKLMEKLYENMRLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEMVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNNAGVKAPI-PPGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 801          

HSP 2 Score: 409.453 bits (1051), Expect = 0.000e+0
Identity = 193/293 (65.87%), Postives = 244/293 (83.28%), Query Frame = -1
Query: 1561 RRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVME-NKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKE 2436
            +RGGLQ+RF IIEP LQP  + +K+GK+G++VSLKSNYANF +K +GPF MYDV M   KS+R KLE+L A A  K   +P+CFDGRRLFT S+WH+ E  ++  +K+ E+S+R LT+FL+N+EEYYQM+NI+FNN+Q FMGQE+IGR FFLGSNC+    R GP+FFK DNFKILGG+STT+TRGTN +GTASTLLYLERINRVLNEN+V ++Y ++Q+D LIGRD+ITKYNNKTYRISDIKE+D+ DE++L DKKISY +YFKQRYNI L + KQPFVISR++R  ++ KE
Sbjct:    9 KRGGLQKRFYIIEPVLQPAEIVEKVGKEGKIVSLKSNYANFKLKPKGPFCMYDVKMSVGKSLRGKLEILGAVAALKEPNEPYCFDGRRLFTASEWHNSE-IQSFTVKEEEVSLRFLTSFLENTEEYYQMVNIIFNNVQSFMGQERIGRAFFLGSNCDEVTSRYGPTFFKKDNFKILGGFSTTLTRGTNNDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEIDIKDEIELNDKKISYADYFKQRYNITLNHAKQPFVISRMRRIAIQRKE 300          
BLAST of SMEDWI-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|21264099 (tr|G9B7B7|G9B7B7_9PLAT Piwi A (Fragment) OS=Phagocata kawakatsui OX=1051007 GN=piwiA PE=2 SV=1)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 324/465 (69.68%), Postives = 396/465 (85.16%), Query Frame = -2
Query:  171 KKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTI 1565
            K+  EN+P+ P E D SLSIPGELC+LCGFSDSERSN+NLQK+LG+VLKREPR+RL DI DFC WT  G++  ++  WG+ ++ QP+TI GREL  +D+FSN+  IN +  DDWKFGEIKFD+P G  HRF VLVV+RNP+ F  FI+D+KREIGRLR+ YT+D++ SC+SNE+ED L+DF+R+ KVHMA+VFI DDK YA+VKNFT++TGLLTQCVT RN +NRDDRRRK VADK+VMQ+F+KLGYDPW I LKM PTM+VG+DTFHSKTG+RS+QA+VFSIS++FSQY+SFVNS KG+NE+HENL +NF  A+ TF++KFNT+P R +IYRDGVGDSQL FTKK+ETDAVM+++E IYEN+ LPQI+YV+VKKRI+VKFFKDG NPNPGT+VDEKIVKPNFYEFYLVSQ+TTKGT++PTNYNVLMDT   N+ T     M+P  LQ  TY LTHLYFNWMGTI
Sbjct:   71 KENLENQPDTPREADLSLSIPGELCFLCGFSDSERSNVNLQKSLGSVLKREPRDRLRDISDFCSWTNDGRAAPFIHQWGLMLDNQPVTIIGRELKGIDVFSNKKPINGRQMDDWKFGEIKFDIPVGAQHRFAVLVVERNPAQFTQFIDDMKREIGRLRVTYTIDTVQSCKSNEIEDYLSDFVRIQKVHMAVVFIGDDKNYARVKNFTITTGLLTQCVTVRNATNRDDRRRKVVADKTVMQIFAKLGYDPWSIELKMVPTMVVGMDTFHSKTGRRSIQAAVFSISSRFSQYLSFVNSPKGRNEYHENLSQNFKAAIKTFRDKFNTLPQRFVIYRDGVGDSQLYFTKKYETDAVMRIVESIYENRMLPQIVYVIVKKRIAVKFFKDGNNPNPGTIVDEKIVKPNFYEFYLVSQRTTKGTSTPTNYNVLMDTGLPNQTTVVRVPMTPGQLQHFTYVLTHLYFNWMGTI 535          

HSP 2 Score: 81.6481 bits (200), Expect = 3.223e-12
Identity = 41/72 (56.94%), Postives = 54/72 (75.00%), Query Frame = -1
Query: 1561 LIGRDIITKYNN-KTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKE 1773
            L+GRD++T+    K   ISDIKE+DV +E+ L   KISY++YFKQRYNI L N KQPFVIS+++R M+  KE
Sbjct:    1 LLGRDVLTQIQIIKHTEISDIKEIDVTEEIDLNGTKISYMDYFKQRYNITLTNGKQPFVISKMRRVMINVKE 72          
BLAST of SMEDWI-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18824002 (tr|G9B7C2|G9B7C2_9PLAT Piwi B (Fragment) OS=Seidlia auriculata OX=1051009 GN=piwiB PE=2 SV=1)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 306/493 (62.07%), Postives = 391/493 (79.31%), Query Frame = -2
Query:   54 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTG-AGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQT--LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1517
            +L+IPGELC+LCGFSD E+ NI+LQKNLG +LKREPR+RL+DI  FC W G   K   +MK WG+ +E +P+ I GREL PVD+ S   K+N +IPDDWKFG ++F      ++   +++VDRN  ++  FI+DVK E+  L +N  + S+  C  N++E+ LT  +R S+  V MA+VF+PDDKVYA+VKNFTMSTGLLTQCVT RNG+NR D+RR+ VA KSVMQ+FSK GYDPW + +K+ PTMIVGLDT+H+KTGK+S+QASV+SI++ F+QY+SFVNS  G+ EFHE LG+NF  AL  F +K+   P R++IYRDGVGDSQ+ FTK+FE DA+  ++EK+Y+++   +PQIIYVVVKKRIS KFFK+G NP PGT+VD+++VKPNFYEF+LVSQ+TTKGTASPTNYNVL DTK   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVP PTHYAHRLAEL+GKIH+G  PP INDRIR+RLFYL
Sbjct:  294 TLNIPGELCFLCGFSDQEKGNIDLQKNLGGILKREPRQRLDDIPAFCDWIGKCEKVNSFMKEWGLRVENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVRFATSSRKSYEIDIVIVDRNDFNYQKFIQDVKTELKNLNVNAKVTSVEKCGPNDIENILTSIMRQSRDAVKMAMVFVPDDKVYARVKNFTMSTGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWSVEIKLRPTMIVGLDTYHNKTGKKSIQASVYSINSTFTQYLSFVNSPHGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKK-GSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPPVINDRIRDRLFYL 785          

HSP 2 Score: 296.59 bits (758), Expect = 0.000e+0
Identity = 140/273 (51.28%), Postives = 202/273 (73.99%), Query Frame = -1
Query: 1561 IGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSI--RTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKD-VEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREG--PSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKE 2364
            +G  G+ V L SN+A F I     +YMYDVV+ +  +  + KL+++       +   PFCFDGRRLFT  KWH++ D      +D  +++IRL+T     +EEYYQM+N++FNNIQ+FMGQE+IGR +FLG+N +   I +G  P++F+++NF++LGG+STT+ RGT  +GT+STLLY+ERINRVLNEN+VV+ Y + + D L+GRD+ITKYNNKTYRISDIKEM V ++  L  +K+SY +YFK+RYNI L++  QPFV++R++R++VR K+
Sbjct:    1 MGNIGKTVKLASNFAKFQICQLETYYMYDVVLSDLGVAPKAKLKIISKVQEMNDLKGPFCFDGRRLFTGEKWHNESDIREFAAEDDKKVTIRLITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDIAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRADTLVGRDVITKYNNKTYRISDIKEMSVGEQFDLSGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTIVRKKK 273          
BLAST of SMEDWI-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|19628037 (tr|D2Z0D9|D2Z0D9_DUGJA DjPiwiB OS=Dugesia japonica OX=6161 GN=DjpiwiB PE=2 SV=1)

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 296/500 (59.20%), Postives = 388/500 (77.60%), Query Frame = -2
Query:   54 GPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYM-KSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1538
             P + D +L+IPGELC+LCGFSD E+SN++LQK+LG+VLKREPRERL+DI  FC W  +  + + M   W + IE +P+ I GREL P D+ S   KIN KIPDDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V++K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVN  KG+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY++    +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G +P  IN+RIR RLFYL
Sbjct:  330 APQDKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIKSSDNANGMCNKWQLKIENKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMSDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNSPAVINERIRNRLFYL 828          

HSP 2 Score: 293.123 bits (749), Expect = 0.000e+0
Identity = 143/289 (49.48%), Postives = 193/289 (66.78%), Query Frame = -1
Query: 1558 FAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK 2412
            F I+EP LQP  + +K G  GR V L+SN+  F++     F MYD V     I  K++L       + N  P  FCFDGRRLFT+ KWH + D +     D ++++RL+ T L  +EEYYQMIN++ NN+QI MGQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM V+++ ++  + +SY  YFK RYNI L    QPFV++RVK+ M R + K
Sbjct:   24 FRIVEPNLQPAEIIEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFTQVGIPPKVKLQFIVRVCQENRLPGAFCFDGRRLFTSEKWHGESDIQEFTYDDKKMTLRLVATILPETEEYYQMINVLLNNLQIMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMSVDEKFEMSGRTLSYAEYFKDRYNIRLSQGDQPFVLTRVKKPMRRERRK 312          
BLAST of SMEDWI-1 vs. Ensembl Cavefish
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:103023762])

HSP 1 Score: 218.394 bits (555), Expect = 2.047e-75
Identity = 159/508 (31.30%), Postives = 256/508 (50.39%), Query Frame = -2
Query:   54 LSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFC-KWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKIN-TKIPDDWKFGEIKFDVPKGTA---HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK------VHMALVFIP---DDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYIS-FVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFK--DG--ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1514
            L IP E CYL G +D  R++ N+ K+L +  +  P +R + +  F    +   ++++ + +WG+  E + + + GR L    I       +      DW   E++  +P  ++     + +    RN     + ++ + R  G + I      +      E ED     +R  +        M +V +P    DK     K   +     +QCV  R  S    +   TVA K  +QM  K+G + W I + +   MIVG+D +H +  GKRS+ A V S++   S++ S  V  S+G+ E  + L      AL  +    N +P R+I+YRDGVGD  L     +E   +M+ I+ + E+  +P++  VVVKKRI+ +FF   DG   NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ D           S + P  +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ IH+    P IN  + + L+YL
Sbjct:  376 LLIP-EFCYLTGLTDKMRNDFNIMKDLSSHTRLTPEQRESRLNRFITNISRNTEAQNELSTWGLSFENKLLGLTGRVLPAERILQGSRTYDYNPWAADWS-KEMR-GLPLISSMPLESWLMFYTRRNSDVAQSLLQTLNRVSGPMGIR-----MQRAVMIEYEDRQESLLRALQQNVGPDTQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTLSR--PQALMTVATKIALQMNCKMGGELWSIEIPLKQLMIVGIDCYHDTAAGKRSIGALVASLNHGMSRWFSKCVLQSRGQ-EIIDGLKGALKGALKAYWKYNNCLPSRIIVYRDGVGDGMLQSVVNYEVPQIMQSIKTMGED-YMPKLTVVVVKKRIASRFFARIDGKLTNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVFDN----------SGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHK---EPNIN--LDDFLYYL 856          

HSP 2 Score: 85.5001 bits (210), Expect = 2.047e-75
Identity = 79/307 (25.73%), Postives = 135/307 (43.97%), Query Frame = -1
Query: 1582 RGGLQRRF---AIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED---TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVY---RRDQIDQ---------LIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2433
            RGG +R F    +    L       K G  G  + L++N+     + +   Y Y V     ME++ +R+ L     + + +  G+   FDG  LF   + H+ E    +E    + V+I++ L      +S    Q  NI+F  I   +  ++IGR ++   +         P         I  G+ T I +       +S +L  +  ++VL    V+      R+   DQ         L+G  ++TKYNNKTYRI DI  +   N+  + GD  IS+ +Y+K +Y +++ +  Q  ++S VKR
Sbjct:   75 RGGRRRDFHDAGVHTRQLMEHVKESKTGVSGSKIELRANFMRLLSRPQWALYQYHVDFKPPMESRRLRSAL----LFQHDETLGKARTFDGAILFLPHRLHNTETVLCSETRHGERVQITVTLTNELPPSSPVCLQFYNIIFRRILRMLNMQQIGRHYYNPDD---------PLNIPQHRLTIWPGFVTNILQYE-----SSIMLCTDVSHKVLRSETVLDFMYNLRKQCGDQRFPDACTKELVGLIVLTKYNNKTYRIDDIAWDHTPNNTFKRGDADISFKDYYKTQYGLDITDGNQVLLVSEVKR 363          
BLAST of SMEDWI-1 vs. Ensembl Cavefish
Match: piwil2 (piwi like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:103024883])

HSP 1 Score: 159.458 bits (402), Expect = 2.535e-52
Identity = 122/524 (23.28%), Postives = 237/524 (45.23%), Query Frame = -2
Query:   54 FAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIK-FDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDAL----TDFIRVSKVHMALVFIPD--DKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKI--YENQTLPQIIYVVVKKRISVKFFKDGAN----PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1574
               + K  ++P G       + +  EL ++ G  +  R +    K+L   +     +  + I+   +   +  ++ + ++ WG+ I  + +  +GR L    I        +    DW    ++   +     + + V    R        +    +  G + I          R +  E  +    +       V + +  I    D +Y+ +K    + +   +Q +  R  S    ++ +++A K ++QM  KLG + W +++ +   M++G+D  H  + K RSV   V S+++  +++ S V       E         L AL  +    ++ P +++IYRDGV D QL   +++E   ++K  E    YE    P++ ++VV+KRIS   +  G      P PGTV+D  +   ++ +F+L++    +G   PT+Y  + +T          + ++P  LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +H   + PAI  ++ ++L++L
Sbjct:  602 LVHRPKERSKPGGKQIITGEILLLPELSFMTGIPEKMRKDFRAMKDLTVHINVSAEQHTHSIKQLLQNINSNPEALNELQRWGLEISPEILMTQGRTLPMETICLQSASFVSSSSADWSREVVRDASISSIPLYCWAVFYPRRAAEQAEELVTMFGKVAGPIGIKLERPIRVELRDDRTETYVKSIQSQLTSEPNVQLVVCIITGNRDDLYSAIKKLCCVQSPCPSQAINVRTISQ--PQKLRSIAQKILLQMNCKLGGELWTVSVPLKHLMVIGVDVHHDVSKKKRSVMGFVASLNSLLTRWYSRVTFQMPNEEIINGFRVCLLAALQKYYEMNHSFPEKIVIYRDGVSDGQLKTVEQYEIPQILKCFETFPNYE----PKLTFIVVQKRISTTLYSYGGERFGTPPPGTVLDHTVTNKDWVDFFLMAHSIRQGCGLPTHYISVYNT----------ANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLH---SEPAI--QLADKLYFL 1104          

HSP 2 Score: 67.3958 bits (163), Expect = 2.535e-52
Identity = 62/292 (21.23%), Postives = 122/292 (41.78%), Query Frame = -1
Query: 1585 IEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDG------RRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISRVK 2403
            +E A +P     K G  G  +++ +NY     K E   + Y V          +   +   +    G+   FDG      +RL       ++  T+N   ++++I I++      + +      N+V   +   +G + +GR  +  SN                  ++  GYST I     +       L ++  ++VL  ++V+++           ++ +   + +G  +IT+YNN+TYRI DIK      D   L D  + ++++Y+++ Y I +K   QP ++ R K
Sbjct:  337 VEAAREP---LKKAGTKGNSITIGANYIPIRCKNEA-VFQYHVTFTPNVEALSMRFGMMKDHRSTTGEVVAFDGSILYLPKRLDEVVHLKAERKTDN---QEIDIKIQMTKVLPPHCDLCIPFYNVVLRRVMKIVGLKLVGRDHYDPSNA---------IVLGKHRLQVWPGYSTCI-----KETDGGLYLGVDVSHKVLRNDSVLNIMGVIYQQSPEHFQDECTKEFVGAIVITRYNNRTYRIDDIKWSKSPKDSFTLADGSETTFIDYYRKNYGITVKEIDQPLLVHRPK 607          
BLAST of SMEDWI-1 vs. Ensembl Cavefish
Match: piwil2 (piwi like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:103024883])

HSP 1 Score: 158.303 bits (399), Expect = 6.356e-52
Identity = 122/508 (24.02%), Postives = 234/508 (46.06%), Query Frame = -2
Query:   54 TDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIK-FDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDAL----TDFIRVSKVHMALVFIPD--DKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKI--YENQTLPQIIYVVVKKRISVKFFKDGAN----PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1526
            T + L +P EL ++ G  +  R +    K+L   +     +  + I+   +   +  ++ + ++ WG+ I  + +  +GR L    I        +    DW    ++   +     + + V    R        +    +  G + I          R +  E  +    +       V + +  I    D +Y+ +K    + +   +Q +  R  S    ++ +++A K ++QM  KLG + W +++ +   M++G+D  H  + K RSV   V S+++  +++ S V       E         L AL  +    ++ P +++IYRDGV D QL   +++E   ++K  E    YE    P++ ++VV+KRIS   +  G      P PGTV+D  +   ++ +F+L++    +G   PT+Y  + +T          + ++P  LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +H   + PAI  ++ ++L++L
Sbjct:  649 TGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTVHINVSAEQHTHSIKQLLQNINSNPEALNELQRWGLEISPEILMTQGRTLPMETICLQSASFVSSSSADWSREVVRDASISSIPLYCWAVFYPRRAAEQAEELVTMFGKVAGPIGIKLERPIRVELRDDRTETYVKSIQSQLTSEPNVQLVVCIITGNRDDLYSAIKKLCCVQSPCPSQAINVRTISQ--PQKLRSIAQKILLQMNCKLGGELWTVSVPLKHLMVIGVDVHHDVSKKKRSVMGFVASLNSLLTRWYSRVTFQMPNEEIINGFRVCLLAALQKYYEMNHSFPEKIVIYRDGVSDGQLKTVEQYEIPQILKCFETFPNYE----PKLTFIVVQKRISTTLYSYGGERFGTPPPGTVLDHTVTNKDWVDFFLMAHSIRQGCGLPTHYISVYNT----------ANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLH---SEPAI--QLADKLYFL 1134          

HSP 2 Score: 67.3958 bits (163), Expect = 6.356e-52
Identity = 65/294 (22.11%), Postives = 124/294 (42.18%), Query Frame = -1
Query: 1585 IEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDG------RRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYL--ERINRVLNENNVVSV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISRVK 2403
            +E A +P     K G  G  +++ +NY     K E   + Y V          +   +   +    G+   FDG      +RL       ++  T+N   ++++I I++      + +      N+V   +   +G + +GR  +  SN                  ++  GYST I     + G     LYL  +  ++VL  ++V+++           ++ +   + +G  +IT+YNN+TYRI DIK      D   L D  + ++++Y+++ Y I +K   QP ++ R K
Sbjct:  367 VEAAREP---LKKAGTKGNSITIGANYIPIRCKNEA-VFQYHVTFTPNVEALSMRFGMMKDHRSTTGEVVAFDGSILYLPKRLDEVVHLKAERKTDN---QEIDIKIQMTKVLPPHCDLCIPFYNVVLRRVMKIVGLKLVGRDHYDPSNA---------IVLGKHRLQVWPGYSTCIKE--TDGG-----LYLGVDVSHKVLRNDSVLNIMGVIYQQSPEHFQDECTKEFVGAIVITRYNNRTYRIDDIKWSKSPKDSFTLADGSETTFIDYYRKNYGITVKEIDQPLLVHRPK 637          
BLAST of SMEDWI-1 vs. Ensembl Cavefish
Match: piwil2 (piwi like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:103024883])

HSP 1 Score: 158.303 bits (399), Expect = 1.724e-47
Identity = 122/508 (24.02%), Postives = 234/508 (46.06%), Query Frame = -2
Query:   54 TDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIK-FDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDAL----TDFIRVSKVHMALVFIPD--DKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKI--YENQTLPQIIYVVVKKRISVKFFKDGAN----PNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1526
            T + L +P EL ++ G  +  R +    K+L   +     +  + I+   +   +  ++ + ++ WG+ I  + +  +GR L    I        +    DW    ++   +     + + V    R        +    +  G + I          R +  E  +    +       V + +  I    D +Y+ +K    + +   +Q +  R  S    ++ +++A K ++QM  KLG + W +++ +   M++G+D  H  + K RSV   V S+++  +++ S V       E         L AL  +    ++ P +++IYRDGV D QL   +++E   ++K  E    YE    P++ ++VV+KRIS   +  G      P PGTV+D  +   ++ +F+L++    +G   PT+Y  + +T          + ++P  LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +H   + PAI  ++ ++L++L
Sbjct:  618 TGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTVHINVSAEQHTHSIKQLLQNINSNPEALNELQRWGLEISPEILMTQGRTLPMETICLQSASFVSSSSADWSREVVRDASISSIPLYCWAVFYPRRAAEQAEELVTMFGKVAGPIGIKLERPIRVELRDDRTETYVKSIQSQLTSEPNVQLVVCIITGNRDDLYSAIKKLCCVQSPCPSQAINVRTISQ--PQKLRSIAQKILLQMNCKLGGELWTVSVPLKHLMVIGVDVHHDVSKKKRSVMGFVASLNSLLTRWYSRVTFQMPNEEIINGFRVCLLAALQKYYEMNHSFPEKIVIYRDGVSDGQLKTVEQYEIPQILKCFETFPNYE----PKLTFIVVQKRISTTLYSYGGERFGTPPPGTVLDHTVTNKDWVDFFLMAHSIRQGCGLPTHYISVYNT----------ANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLH---SEPAI--QLADKLYFL 1103          

HSP 2 Score: 52.373 bits (124), Expect = 1.724e-47
Identity = 43/170 (25.29%), Postives = 81/170 (47.65%), Query Frame = -1
Query: 1585 NIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYL--ERINRVLNENNVVSV-----------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISRVK 2049
            ++ F  ++I +G + +GR  +  SN                  ++  GYST I     + G     LYL  +  ++VL  ++V+++           ++ +   + +G  +IT+YNN+TYRI DIK      D   L D  + ++++Y+++ Y I +K   QP ++ R K
Sbjct:  454 HVTFTVMKI-VGLKLVGRDHYDPSNA---------IVLGKHRLQVWPGYSTCIKE--TDGG-----LYLGVDVSHKVLRNDSVLNIMGVIYQQSPEHFQDECTKEFVGAIVITRYNNRTYRIDDIKWSKSPKDSFTLADGSETTFIDYYRKNYGITVKEIDQPLLVHRPK 606          
BLAST of SMEDWI-1 vs. Ensembl Cavefish
Match: ago2 (argonaute RISC catalytic component 2 [Source:NCBI gene;Acc:103030212])

HSP 1 Score: 113.235 bits (282), Expect = 3.803e-25
Identity = 97/336 (28.87%), Postives = 145/336 (43.15%), Query Frame = -2
Query:  111 VHMALVFIPDD-KVYAKVKNFTMST-GLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMA-----------------PTMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF---------KDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLM-DTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLA-----ELVGKIH 1007
            + + +V +P    VYA+VK    +  G+ TQCV  +N              K+  Q  S L      IN+K+                  P + +G D  H   G   K S+ A V S+ A  S+Y + V   + + +  ++L       L  F       P R+I YRDG+ + Q     + E  A+ +   K+ E    P I +VVV+KR   + F         K G  P  GT VD KI  P+ ++FYL S    +GT+ P++Y+VL  D  FT+ +           LQ +TY L H Y     ++ +P P +YAH +A      LV K H
Sbjct:  528 LQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQVKN------------VQKTTPQTLSNLCLK---INVKLGGVNNILLPQGRPLVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQQHRQDIIQDLAAMVRELLIQFYKSTRFKPTRIIYYRDGISEGQFNQVLQHELLAIREACIKL-EKDYQPGITFVVVQKRHHTRLFCMDRNERVGKSGNIPA-GTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNHFTSDE-----------LQVLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEH 835          
BLAST of SMEDWI-1 vs. Ensembl Sea Lamprey
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 191.045 bits (484), Expect = 5.191e-61
Identity = 146/508 (28.74%), Postives = 253/508 (49.80%), Query Frame = -2
Query:   54 QSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAG-KSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPD-DWKFGEIKFDVPKGTAHR-FGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIR-----VSKVHMALVFIP---DDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIE--KIYENQTLPQIIYVVVKKRISVKFFKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1520
            Q++ +  EL Y+ G +D  RS+ ++ K +   ++  P  R N + +F        +++  + +WG+ ++     + GR+L P +I   + K     P+ DW    +        A + + VL   R+    + F+  +      + + + + +I     N+      D IR        V M +   P   DD+ Y+ VK    +   + +Q V  R  S +  +R ++VA K V+QM  KLG + W +++ +   M+VG+D FH+   GK+SV   V S++   S++ S V       E  + L     +A+  +    + +P ++I+YRDGV D+QLA  + FE   VM++    + ++    P+++ VVV+KRIS   F + +    N   G+V+D       +++F+LVSQ   +GT SPT+Y V+    F + K      +S   +Q++TY +THLY+NW GT+RVP P  YAH+LA LVG+       P + D    +LF+L
Sbjct:  290 QTICLIPELAYMTGITDLMRSDFSMMKAISEHMRLGPSLRHNSLMEFISNVKRNPEAQQELSNWGLQMDSDIYKLSGRQLPP-EIIRLQYKAFAFSPEADWTRHIVNTPCITAVAMKNWQVLCTHRDSFLVHEFVTMMCNVGPPMGLVHQLPNIIEL-PNDHTKTYIDCIRKNYSYSQGVQMVMCIFPTLRDDR-YSTVKQVCCVELAVPSQVVQTRTISQQ--KRLRSVAQKVVLQMNCKLGGELWILDIPLKNLMVVGVDVFHNVVLGKQSVVGFVASMNRSVSRWYSRVVRQSTSQELVDGLNLCMTSAIKKYYELNHYLPEKIIMYRDGVSDNQLAIVRDFE---VMQLTNGFRTFDLSYQPKMLVVVVQKRISTNIFLNNSGAMENAPSGSVLDTVATSQEWFDFFLVSQHVRQGTVSPTHYVVI----FNSLK------LSADHVQRLTYKMTHLYYNWSGTVRVPAPCQYAHKLASLVGENLHSDPDPGLCD----KLFFL 775          

HSP 2 Score: 62.7734 bits (151), Expect = 5.191e-61
Identity = 69/285 (24.21%), Postives = 116/285 (40.70%), Query Frame = -1
Query: 1582 KIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENK--SIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIK------DVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV-------------YRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQL--GDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2367
            KIG  G  + + +NY       E   Y Y V       S  T+  LL  + +   N +   FDG  L+   K    +D  NL  K      ++ +SI+       +S+    + NI+F  I   +  + IG+ +           R+ P         I  GY   +     +      +L L+  +RVL  ++V+ V             ++ +    L+G  +IT+YNN+TYRI DI          L    K +S++ Y+K +Y I + +  QP ++ R K+
Sbjct:   15 KIGTYGTPLEIATNYIRLRCSNEA-IYQYHVTFSPDVDSTNTRFGLLNEHKSVIGNTK--AFDGCVLYLPRKL---DDNLNLTSKRISDGVEITLSIKCTKIIKPDSDLCLPIYNIIFKKIMRLLELKLIGKSYL--------NPRQ-PIVINRYRIHIWPGYVVAV-----QKKDGGLMLMLDVSHRVLRMDSVLEVMTHLYESCQSSANFQEECTKALVGHVVITRYNNRTYRIDDIAWDKTPKSTFLNSAGKTMSFVEYYKTQYEITIDDLGQPLLLHRAKQ 279          
BLAST of SMEDWI-1 vs. Ensembl Sea Lamprey
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:368200])

HSP 1 Score: 155.992 bits (393), Expect = 2.581e-50
Identity = 145/509 (28.49%), Postives = 235/509 (46.17%), Query Frame = -2
Query:   54 LSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFC-KWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKIN-TKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK------VHMALVFIP--DDKVYAKVKNF-TMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFH-SKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENL-----GKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDG----ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1514
            L +  E+ YL G SD  RS+ +L K+LG   +  P +R    + F  K     ++ +    WG+  + Q +++ GR +    ++  +      +   DW        +    +    +L+   N S+    I D   ++G     +    I+     EV D    F++  +        M +  +P      Y  +K F  +     +QCV  R  S     R  +VA K  +QM  KLG + W + + +   M+VG+D++H S T  +SV   V S++   +++ S         E  + L      KNF+ +L    +  + M   +IIY        L+F                Y   + P++  VVVKKR   +FF+ G     NP+PGTV+D +  +  +Y+FYLVSQ   +GT +PT+YNV+ DT          S M P  +Q++ Y + HLY+NW G IRVP P HYAH+LA LVG+ IH+    P+++  + +RL+YL
Sbjct:  399 LHLLPEISYLTGLSDKMRSDFHLMKDLGLQTQVGPDKRAMTTQKFIEKLQSNPETCNEFAKWGLSFDRQLLSLTGRVVPCEKLYQKDQSYQYNQRQADWSRESRNMKLMTPISLEEWMLLFTHNNSNEARAIVDNLMQVGPPMGMH----INKPEMFEVLDRAQSFVQTLQQNLNHHTQMVMCVLPTIHKGKYDSIKQFLCVERPFPSQCVLARTLSKPQMIR--SVATKIALQMNCKLGGELWSVEIPIKQLMVVGVDSYHDSITRGQSVCGFVASLNQTLTRWYSRCIFQHAAQEMIDGLKVCMQCKNFI-SLQIASHSNDVMINVVIIYF-------LSFLNS-------------YCCGSRPKVTVVVVKKRGIARFFEFGRSGLQNPSPGTVIDTEATRHEWYDFYLVSQSVRQGTVTPTHYNVVYDT----------SNMKPDHMQRLAYKMCHLYYNWPGVIRVPAPCHYAHKLAFLVGQSIHK---EPSLD--LSDRLYYL 865          

HSP 2 Score: 62.003 bits (149), Expect = 2.581e-50
Identity = 60/274 (21.90%), Postives = 123/274 (44.89%), Query Frame = -1
Query: 1582 GRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWH--SDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRR--DQIDQ----------LIGRDIITKYNNKTYRISDIKEMDVNDEVQL---GDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2352
            G+ V L +NY     +     Y Y V    +    +L + L + +++  G+   FDG  L+   K    S+  ++    + ++I+I L      +S     + NI+F  +   +  ++IGR ++   +  +                +  G+ T+I    ++      +L  +  +++L   +V+       +QI++          L+G+ I+T+YNN+TYRI DI   + N  +        +++Y  Y+ + Y++ +K+ +QP +ISR KR
Sbjct:  129 GQPVKLLTNYFKLMSRKMWMVYQYHVTFSPELESKRLRIALLHEHNELLGETRAFDGCILYLPKKLEKVSEVWSKTRQEQKIKITITLTNELPPSSPTAIVLFNIIFRKVLKMVNMQQIGRNYYNPDDAFT---------IPQHRLHVWPGFVTSIMCYESD-----VMLCADVSHKILRNESVLDFMYTLFEQIEERHFHDACQKELVGQVILTRYNNRTYRIDDI-SWNRNPSMTFLKSDGTEVTYYEYYTKHYSLEVKDMQQPLLISRSKR 387          
BLAST of SMEDWI-1 vs. Ensembl Sea Lamprey
Match: ago2 (argonaute RISC catalytic component 2 [Source:ZFIN;Acc:ZDB-GENE-110606-6])

HSP 1 Score: 105.145 bits (261), Expect = 3.162e-25
Identity = 78/244 (31.97%), Postives = 110/244 (45.08%), Query Frame = -2
Query:  111 PTMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFET----DAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF---------KDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIH 794
            P + +G +  H   G   K S+ A V S+ A  S+Y + V     + E  ++LG      L  F       P R+I YRDGV + Q       E     DA +K+ EK Y+    P I YV V+KR   + F         K G  P   T VD KI  P+ ++FYL S    +GT+ P++Y+VL D    N+        S   LQ +TY L H Y     ++ +P P +YA RL     + H
Sbjct:    9 PVIFLGAEVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQHHRQEIIQDLGTMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLFHELLAIRDACIKL-EKDYQ----PGITYVAVQKRHHTRLFCADRNERIGKSGNIPAGTTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWD---DNR-------FSADELQVLTYQLCHTYVRCTRSVSIPAPAYYA-RLVAFRARYH 236          
BLAST of SMEDWI-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009610.1 (pep scaffold:Pmarinus_7.0:GL477777:44890:66775:1 gene:ENSPMAG00000008651.1 transcript:ENSPMAT00000009610.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 4.232e-9
Identity = 53/211 (25.12%), Postives = 89/211 (42.18%), Query Frame = -2
Query:  420 VHMALVFIPDD-KVYAKVKNFTMST-GLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGIN----------LKMAPTMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF 1007
            + + +V +P    VYA+VK    +  G+ TQCV  +N            + +++  +  K+     G+N          +   P + +G D  H   G   K S+ A V S+ A  S+Y + V   + + E   +L       L  F       P R+I YRDGV + Q       E  A+ +   ++ E +  P I ++VV+KR   + F
Sbjct:  516 LQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVLK--------TSPQTLSNLCLKINVKLGGVNNILVPHIRPAVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQQHRQEIIHDLSSMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLYHELLAIREACIRL-EKEYRPGITFIVVQKRHHTRLF 717          
BLAST of SMEDWI-1 vs. Ensembl Nematostella
Match: EDO49931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFC2])

HSP 1 Score: 202.601 bits (514), Expect = 2.794e-67
Identity = 148/514 (28.79%), Postives = 255/514 (49.61%), Query Frame = -2
Query:   54 DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDF-CKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPD-DWKFGEIKFDVPKGTAHRFGVLVV--DRNPSHFNNFIEDVKREIGRLRINYT---MDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKV--YAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSIS---AKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA---------NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1523
            D  L +P ELC+L G SD  R++ ++ K+L    + +P+ R  D+     +      +   +  WG+      +   GR L    IF      N      DW   EI+      T +    ++V  +R+     +F + + R  G + IN T   M  ++  R++    AL++ I+     + +  +P ++   Y  +K    +  G+ +Q V  R  S +  +   +V  K  +Q+  KLG + W +++ +   MIVG+DT+H  + K RSV   V S++    +  +Y S         E  + L      AL  +Q     +P ++I++RDGVGD QL    + E   ++   ++ +++   P+  + VVKKRI  + F   A         NP PGTVVD+++ +  +++F++VSQ   +GT SPT+YNV+ DT          + + P   QQ++Y LTHLY+NW GT+RVP P  YAH+LA LVG+ +H+    P++  ++ ++L++L
Sbjct:  378 DPVLLLP-ELCFLTGLSDDMRADFSVMKDLAVHTRLDPKARSKDLNKLISEINNNPDASGELSGWGLRFGRNLLDFDGRILPGEKIFQKNKGSNYDPKSADWS-REIRGAPLHSTVNLENWVIVHTNRDSGVATDFQQTLARVCGPMGINTTKPRMVPLNDDRTDSYLKALSNEIQADFPQIVVTIVPSNRKDRYDSIKKLCCLEKGVPSQVVVSRTLSKK--QMLMSVCTKIGIQLNCKLGGEAWAVDIPLKNLMIVGIDTYHDSSQKGRSVGGFVASLNKPCTRQREYYSRCTFQHSGQELVDGLKVCMTAALRQWQQINGVLPDKIIVFRDGVGDGQLRAVIEHEVPQILSTFKQ-FQDGYDPKFGFTVVKKRIQTRLFMREARDPDMRNLMNPPPGTVVDKEVTRSEWFDFFIVSQSVRQGTVSPTHYNVIHDT----------TGLRPDHWQQLSYKLTHLYYNWPGTVRVPAPCQYAHKLAFLVGQSLHK---EPSL--KLADKLYFL 871          

HSP 2 Score: 72.7886 bits (177), Expect = 2.794e-67
Identity = 68/294 (23.13%), Postives = 124/294 (42.18%), Query Frame = -1
Query: 1582 QPDTVTDKIGKDGRV---VSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIK--------DVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSV-------------YRRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2388
            +P T  D   K+G V   V + SNY     + +   Y Y+V    +    K    L     +  G    FDG  LF   K   D+ T+ + ++         VEI+I L      +S     + NI+   I  ++  +++GR ++   N  +               ++  GY+T+I +  +     S LL  +  ++VL +  V+               +  +   +L+G  ++T+YNNKTYR+ DI      N        +IS+ +Y+K+ Y+  + + +QP + S+ K+
Sbjct:   94 EPTTRRDGFNKEGSVGTKVGIVSNYFRLETRPQAAIYQYNVSFSPEVDFKKARFALIGEQRELLGNIRAFDGMVLFLPKKL-PDQVTKIMAVRTRRETPDEPVEITITLTNELPADSPTCLHLFNIILKRILKYIDMKQVGRNYYYIKNAIA---------IPKHGLELWPGYTTSILKYEH-----SILLGADVSHKVLRKQTVLDFLYELYNKMQGRGNFHDEAAKKLVGEIVLTRYNNKTYRVDDIDWNKRPNSTFTTPKGEISFNDYYKKNYDFTITDQEQPLLFSKPKK 372          
BLAST of SMEDWI-1 vs. Ensembl Nematostella
Match: EDO34027 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQI3])

HSP 1 Score: 201.06 bits (510), Expect = 1.668e-62
Identity = 142/515 (27.57%), Postives = 243/515 (47.18%), Query Frame = -2
Query:   54 KKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFC-KWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGT-AHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVS---KVHMALVFIP---DDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDG---ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1562
            KKTE +  G  E    L IP ELC L G +D+ R +  + K++    +  P +R   ++ F        ++ + + +W + ++   +   GR+  P  I       +     DW     +  V      + + V    R+    N+F++ + +    + I      ++  R +  E  L   IR +   +V + +V  P   DD+  A  K   + + + +Q +  +  SN    R  +V  K  +Q+  KLG + W +++     M+ G+D +H K  G RSV   V S++   +++ S V       E  + L    +  +  + +  N +P R+I+YRDGVGD QL     +E     +      E+   P++  +VV+KRI+ + F       NP PG+V+D  + + ++ +F+LVSQ   +GT +PT+Y V+ DT          S   P ++Q+++Y LTHLY+NW GT+RVP P  YAH+LA  VG+   G     + D    RLF+L
Sbjct:  254 KKTEQKRGGVIEV--ILLIP-ELCKLTGLNDAMRKDFRVMKDIAAHTRVNPMQRQEAMKKFVMSINSTPEALEQLTAWNLRLDTSTLMTEGRQFPPEKIIYGNTTGSAGDQADWGRDATREKVISAVNLNNWMVFFTQRDSGKANDFVQTMNKCAPAMGIQVNQPKMNQLRDDRTETYLRS-IRENLHPQVQVVVVIFPTSRDDRYAAVKKLCCVESPVPSQVIISKTISNPTKLR--SVVQKIALQINVKLGGELWALDIPSRSLMVCGIDVYHDKARGGRSVGGLVCSMNRSLTRWYSDVCFQSPGQELIDGLKMLLIKGIRKWHDVNNALPERIIVYRDGVGDGQLKVVAGYEVQQFEECFASFGESYK-PKLAVLVVQKRINTRIFSAEPRLGNPGPGSVLDHTVTRKDWNDFFLVSQHVRQGTVTPTHYVVVYDT----------SNWKPDIMQKLSYKLTHLYYNWPGTVRVPAPCQYAHKLAYQVGQSIHGQPSQELCD----RLFFL 747          

HSP 2 Score: 58.5362 bits (140), Expect = 1.668e-62
Identity = 46/185 (24.86%), Postives = 89/185 (48.11%), Query Frame = -1
Query: 1579 LTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINR-------VLNENNVVSVYRRDQID-QLIGRDIITKYNNKTYRISDIKEMDVNDEVQ-----LGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRS 2094
             T  +   +  +Q+ NI+F  +   +  +++GR F+   N ++      P+     N  +  GY T++     E G         R+ R       +LN ++ V    RD++  +LIG  ++T YNNKTYR+ DI   D N            ++++++ Y+K+ Y I +++  QP +++R K++
Sbjct:   86 FTRVVPPDDAIFQVYNILFRRVMKILDMQQVGRYFY---NPKT------PAHIPQHNLVLWPGYITSLQH--YEGGLMLLCDVHHRLLRTDSCLDYMLNMHSKVGDRFRDEVSKELIGSVVLTTYNNKTYRVDDI---DWNKRPTSTFTFHNGEQMTFVEYYKKSYEIEIRDLDQPMIVNRPKKT 256          
BLAST of SMEDWI-1 vs. Ensembl Nematostella
Match: EDO46431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ46])

HSP 1 Score: 116.701 bits (291), Expect = 1.086e-26
Identity = 100/327 (30.58%), Postives = 147/327 (44.95%), Query Frame = -2
Query:  132 FIRVSKVH----MALVFIPDD-KVYAKVKNF--TMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAP----------TMIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF---------KDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLA 1025
            F R+ + H    M LV +P    VYA+VK    TM  G++TQC+    G N      +T+++   +++ +KLG    G+N  +AP           + +G D  H   G   + SV A V S+ A  S+Y + V     + E    L       L  F       P R++ YRDGV + Q       E  A+ +   K+ E    P I ++VV+KR   + F         K G  P PGT VD  I  P  ++FYL S    +GT+ P++Y+VL D    N   +E        LQ +TY L H Y      + +P P +YAH +A
Sbjct:  499 FRRLKEAHPDLQMILVVLPGKTPVYAEVKRVGDTM-LGVITQCI---QGKNVTKPSPQTLSN-LCLKINAKLG----GVNNILAPEIRPPVFREPVIFLGADVTHPAAGDDKRPSVAAVVGSMDAHPSRYYASVRVQTHRQEIIAELAAMVRELLVQFYRSTRHKPQRIVFYRDGVSEGQFRQVLVHELKAIREACIKL-EVGYQPGISFIVVQKRHHTRLFCQRDQDKCGKSGNVP-PGTTVDRGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDD--NNFSADE--------LQALTYQLCHTYVRCTRAVSIPAPAYYAHLVA 804          
BLAST of SMEDWI-1 vs. Ensembl Nematostella
Match: EDO28124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7C9])

HSP 1 Score: 48.9062 bits (115), Expect = 1.512e-6
Identity = 42/175 (24.00%), Postives = 70/175 (40.00%), Query Frame = -2
Query:  420 MIVGLDTFHSKT-GKRSVQASVFSISAKFSQYISFVNSS---------------KGKNEFHENLGK----NFLT--------------------------------ALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF 788
            M+ G+D +H K  G RSV   V S++   +++ S V                  KG  ++H+ + K     +LT                                A+  + +  N +P R+I+YRDGVGD QL     +E     +      E+   P++  +VV+KRI+ + F
Sbjct:    4 MVCGIDVYHDKARGGRSVGGLVCSMNRSLTRWYSDVCFQSPGQELIDGLKMLLIKGIRKWHDAIRKWHDVCYLTMFVSLSRPSGSGMMPSGSGMMYVIFNVCVLIKAIRKWHDVNNALPERIIVYRDGVGDGQLKVVAGYEVQQFEECFASFGESYK-PKLAVLVVQKRINTRIF 177          
BLAST of SMEDWI-1 vs. Ensembl Medaka
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:100301587])

HSP 1 Score: 220.705 bits (561), Expect = 2.803e-76
Identity = 159/508 (31.30%), Postives = 256/508 (50.39%), Query Frame = -2
Query:   54 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCK-WTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKIN-TKIPDDWKFGEIKFDVPKGTA---HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK------VHMALVFIPDDKV--YAKVKNF-TMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFK----DGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1517
            ++ IP ELCYL G +D  RS+  + ++L    +  P +R++ +  F +   G    ++ +K WG+  +   + +  R LAP  IF      +   +  DW   E++  +P  ++   + + +    RN +   + ++ + +  G L +      +      E ED     +R  K        M +V +P ++   Y  VK +  +     +QCV  R  S    +   TVA K  +QM  K+G + W + + +   MIVG+D +H    GKRS+ A V S++   S++ S         E  + L   F  AL  +    N +P R+I+YRDGVGD QL     FE   +++ I+ + ++   P++  VVVKKRIS +FF       +NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ DT          S + P  +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ IHR       N ++   LFYL
Sbjct:  374 AMLIP-ELCYLTGLTDKMRSDFTIMRDLSENTRLSPDKRISRLSGFIEDICGNAGVQEELKKWGIGFDNHLLNLSARVLAPERIFQGPRSYDYNPMSGDWS-REMR-GIPIISSPPLNNWIMFSTRRNSNEAQSLLQTLGKVSGPLGLR-----LQRAVMIEYEDHQESLLRALKQNVGPTTQMVVVVLPSNRKDKYDSVKKYLCVDCPTPSQCVLSRTLSR--PQALMTVATKIALQMSCKMGGELWSVEIPLKQLMIVGIDCYHDISAGKRSIGAMVASLNQSMSRWYSKCVLQHKGQELMDGLKMAFTGALKDYLKFNNCLPSRIIVYRDGVGDGQLHSVVNFEISQILESIKSLGQDYN-PKVSVVVVKKRISSRFFAMINDKVSNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVYDT----------SGLKPDHMQRLTYKLCHMYYNWQGLIRVPAPCQYAHKLAFLVGQSIHR-----EPNIKLDNYLFYL 855          

HSP 2 Score: 86.2705 bits (212), Expect = 2.803e-76
Identity = 83/307 (27.04%), Postives = 132/307 (43.00%), Query Frame = -1
Query: 1582 RGGLQRRF---AIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED---TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVS--VYRRDQI----------DQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2433
            RGG +R F    +    L       K G  G  + L +N+     + +   Y Y V     ME++ +RT L     Y +++  G    FDG  L    + H  E    +E    + V I++ L       S    Q  NI+F  +   +  ++IGR ++   N         P      N  I  GYSTTI +       +S +L  +  ++VL    V+   V  R +            +LIG  ++TKYNNKTYRI DI  +    +    GD  IS++NY+K +Y +++ +  Q  ++S VK+
Sbjct:   73 RGGHRRDFNDFGVNTRQLMEHVKESKCGTSGSPIQLTANFYRILSRPQWVLYQYHVDFKPPMESRRLRTAL----LYRHAEVIGDARTFDGALLILPRRLHCKETVLYSETKSGEKVLITVTLTNELPPTSPVCIQFYNILFKRVLRLLEMQQIGRNYYNPKN---------PLNIPEHNLTIWPGYSTTILQYE-----SSIMLCTDVSHKVLRSETVLDFMVNLRQKCGNQRFPDACAKELIGLIVLTKYNNKTYRIDDIAWDHTPKNTFTRGDADISFMNYYKTQYGLDITDVNQVLLVSHVKK 361          
BLAST of SMEDWI-1 vs. Ensembl Medaka
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:100301587])

HSP 1 Score: 218.779 bits (556), Expect = 1.255e-74
Identity = 162/511 (31.70%), Postives = 257/511 (50.29%), Query Frame = -2
Query:   54 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLND----IRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKIN-TKIPDDWKFGEIKFDVPKGTA---HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK------VHMALVFIPDDKV--YAKVKNF-TMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFK----DGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1517
            ++ IP ELCYL G +D  RS+  + ++L    +  P +R++     I D C   G    ++ +K WG+  +   + +  R LAP  IF      +   +  DW   E++  +P  ++   + + +    RN +   + ++ + +  G L +      +      E ED     +R  K        M +V +P ++   Y  VK +  +     +QCV  R  S    +   TVA K  +QM  K+G + W + + +   MIVG+D +H    GKRS+ A V S++   S++ S         E  + L   F TAL  +    N +P R+I+YRDGVGD QL     FE   +++ I+ + ++   P++  VVVKKRIS +FF       +NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ DT          S + P  +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ IHR       N ++   LFYL
Sbjct:  341 AMLIP-ELCYLTGLTDKMRSDFTIMRDLSENTRLSPDKRISRLSGFIEDIC---GNAGVQEELKKWGIGFDNHLLNLSARVLAPERIFQGPRSYDYNPMSGDWS-REMR-GIPIISSPPLNNWIMFSTRRNSNEAQSLLQTLGKVSGPLGLR-----LQRAVMIEYEDHQESLLRALKQNVGPTTQMVVVVLPSNRKDKYDSVKKYLCVDCPTPSQCVLSRTLSR--PQALMTVATKIALQMSCKMGGELWSVEIPLKQLMIVGIDCYHDISAGKRSIGAMVASLNQSMSRWYSKCVLQHKGQELMDGLKMAF-TALKDYLKFNNCLPSRIIVYRDGVGDGQLHSVVNFEISQILESIKSLGQDYN-PKVSVVVVKKRISSRFFAMINDKVSNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVYDT----------SGLKPDHMQRLTYKLCHMYYNWQGLIRVPAPCQYAHKLAFLVGQSIHR-----EPNIKLDNYLFYL 821          

HSP 2 Score: 82.8037 bits (203), Expect = 1.255e-74
Identity = 83/307 (27.04%), Postives = 132/307 (43.00%), Query Frame = -1
Query: 1582 RGGLQRRF---AIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED---TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVS--VYRRDQI----------DQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2433
            RGG +R F    +    L       K G  G  + L +N+     + +   Y Y V     ME++ +RT L     Y +++  G    FDG  L    + H  E    +E    + V I++ L       S    Q  NI+F  +   +  ++IGR ++   N         P      N  I  GYSTTI +       +S +L  +  ++VL    V+   V  R +            +LIG  ++TKYNNKTYRI DI  +    +    GD  IS++NY+K +Y +++ +  Q  ++S VK+
Sbjct:   43 RGGHRRDFNDFGVNTRQLMEHVKESKCGTSGSPIQLTANFYRILSRPQWVLYQYHVDFKPPMESRRLRTAL----LYRHAEVIGDARTFDGALLILPRRLHCKETVLYSETKSGEKVLITVTLTNELPPTSPVCIQFYNILFKRL---LEMQQIGRNYYNPKN---------PLNIPEHNLTIWPGYSTTILQYE-----SSIMLCTDVSHKVLRSETVLDFMVNLRQKCGNQRFPDACAKELIGLIVLTKYNNKTYRIDDIAWDHTPKNTFTRGDADISFMNYYKTQYGLDITDVNQVLLVSHVKK 328          
BLAST of SMEDWI-1 vs. Ensembl Medaka
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:100301587])

HSP 1 Score: 182.956 bits (463), Expect = 2.034e-64
Identity = 140/473 (29.60%), Postives = 233/473 (49.26%), Query Frame = -2
Query:  165 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLND----IRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKIN-TKIPDDWKFGEIKFDVPKGTA---HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK------VHMALVFIPDDKV--YAKVKNF-TMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFK----DGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRV 1517
            ++ IP ELCYL G +D  RS+  + ++L    +  P +R++     I D C   G    ++ +K WG+  +   + +  R LAP  IF      +   +  DW   E++  +P  ++   + + +    RN +   + ++ + +  G L +      +      E ED     +R  K        M +V +P ++   Y  VK +  +     +QCV  R  S    +   TVA K  +QM  K+G + W + + +   MIVG+D +H    GKRS+ A V S++   S++ S         E  + L   F  AL  +    N +P R+I+YRDGVGD QL     FE   +++ I+ + ++   P++  VVVKKRIS +FF       +NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ DT          S + P  +Q++TY L H+Y+NW  +I +
Sbjct:  374 AMLIP-ELCYLTGLTDKMRSDFTIMRDLSENTRLSPDKRISRLSGFIEDIC---GNAGVQEELKKWGIGFDNHLLNLSARVLAPERIFQGPRSYDYNPMSGDWS-REMR-GIPIISSPPLNNWIMFSTRRNSNEAQSLLQTLGKVSGPLGLRLQRAVMI-----EYEDHQESLLRALKQNVGPTTQMVVVVLPSNRKDKYDSVKKYLCVDCPTPSQCVLSRTLSR--PQALMTVATKIALQMSCKMGGELWSVEIPLKQLMIVGIDCYHDISAGKRSIGAMVASLNQSMSRWYSKCVLQHKGQELMDGLKMAFTGALKDYLKFNNCLPSRIIVYRDGVGDGQLHSVVNFEISQILESIKSLGQDYN-PKVSVVVVKKRISSRFFAMINDKVSNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVYDT----------SGLKPDHMQRLTYKLCHMYYNWQVSISL 822          

HSP 2 Score: 84.7297 bits (208), Expect = 2.034e-64
Identity = 83/307 (27.04%), Postives = 132/307 (43.00%), Query Frame = -1
Query: 1582 RGGLQRRF---AIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED---TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVS--VYRRDQID----------QLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2433
            RGG +R F    +    L       K G  G  + L +N+     + +   Y Y V     ME++ +RT L     Y +++  G    FDG  L    + H  E    +E    + V I++ L       S    Q  NI+F  +   +  ++IGR ++   N         P      N  I  GYSTTI +  +     S +L  +  ++VL    V+   V  R +            +LIG  ++TKYNNKTYRI DI  +    +    GD  IS++NY+K +Y +++ +  Q  ++S VK+
Sbjct:   73 RGGHRRDFNDFGVNTRQLMEHVKESKCGTSGSPIQLTANFYRILSRPQWVLYQYHVDFKPPMESRRLRTAL----LYRHAEVIGDARTFDGALLILPRRLHCKETVLYSETKSGEKVLITVTLTNELPPTSPVCIQFYNILFKRVLRLLEMQQIGRNYYNPKN---------PLNIPEHNLTIWPGYSTTILQYES-----SIMLCTDVSHKVLRSETVLDFMVNLRQKCGNQRFPDACAKELIGLIVLTKYNNKTYRIDDIAWDHTPKNTFTRGDADISFMNYYKTQYGLDITDVNQVLLVSHVKK 361          
BLAST of SMEDWI-1 vs. Ensembl Medaka
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:100301587])

HSP 1 Score: 182.956 bits (463), Expect = 2.034e-64
Identity = 140/473 (29.60%), Postives = 233/473 (49.26%), Query Frame = -2
Query:  165 SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLND----IRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKIN-TKIPDDWKFGEIKFDVPKGTA---HRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK------VHMALVFIPDDKV--YAKVKNF-TMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHS-KTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFK----DGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRV 1517
            ++ IP ELCYL G +D  RS+  + ++L    +  P +R++     I D C   G    ++ +K WG+  +   + +  R LAP  IF      +   +  DW   E++  +P  ++   + + +    RN +   + ++ + +  G L +      +      E ED     +R  K        M +V +P ++   Y  VK +  +     +QCV  R  S    +   TVA K  +QM  K+G + W + + +   MIVG+D +H    GKRS+ A V S++   S++ S         E  + L   F  AL  +    N +P R+I+YRDGVGD QL     FE   +++ I+ + ++   P++  VVVKKRIS +FF       +NP PGTV+D ++ +P +Y+F++VSQ    G+ SPT+YNV+ DT          S + P  +Q++TY L H+Y+NW  +I +
Sbjct:  374 AMLIP-ELCYLTGLTDKMRSDFTIMRDLSENTRLSPDKRISRLSGFIEDIC---GNAGVQEELKKWGIGFDNHLLNLSARVLAPERIFQGPRSYDYNPMSGDWS-REMR-GIPIISSPPLNNWIMFSTRRNSNEAQSLLQTLGKVSGPLGLRLQRAVMI-----EYEDHQESLLRALKQNVGPTTQMVVVVLPSNRKDKYDSVKKYLCVDCPTPSQCVLSRTLSR--PQALMTVATKIALQMSCKMGGELWSVEIPLKQLMIVGIDCYHDISAGKRSIGAMVASLNQSMSRWYSKCVLQHKGQELMDGLKMAFTGALKDYLKFNNCLPSRIIVYRDGVGDGQLHSVVNFEISQILESIKSLGQDYN-PKVSVVVVKKRISSRFFAMINDKVSNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVYDT----------SGLKPDHMQRLTYKLCHMYYNWQVSISL 822          

HSP 2 Score: 84.7297 bits (208), Expect = 2.034e-64
Identity = 83/307 (27.04%), Postives = 132/307 (43.00%), Query Frame = -1
Query: 1582 RGGLQRRF---AIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDV----VMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDED---TENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVS--VYRRDQID----------QLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKR 2433
            RGG +R F    +    L       K G  G  + L +N+     + +   Y Y V     ME++ +RT L     Y +++  G    FDG  L    + H  E    +E    + V I++ L       S    Q  NI+F  +   +  ++IGR ++   N         P      N  I  GYSTTI +  +     S +L  +  ++VL    V+   V  R +            +LIG  ++TKYNNKTYRI DI  +    +    GD  IS++NY+K +Y +++ +  Q  ++S VK+
Sbjct:   73 RGGHRRDFNDFGVNTRQLMEHVKESKCGTSGSPIQLTANFYRILSRPQWVLYQYHVDFKPPMESRRLRTAL----LYRHAEVIGDARTFDGALLILPRRLHCKETVLYSETKSGEKVLITVTLTNELPPTSPVCIQFYNILFKRVLRLLEMQQIGRNYYNPKN---------PLNIPEHNLTIWPGYSTTILQYES-----SIMLCTDVSHKVLRSETVLDFMVNLRQKCGNQRFPDACAKELIGLIVLTKYNNKTYRIDDIAWDHTPKNTFTRGDADISFMNYYKTQYGLDITDVNQVLLVSHVKK 361          
BLAST of SMEDWI-1 vs. Ensembl Medaka
Match: piwil2 (piwi like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:100301588])

HSP 1 Score: 156.762 bits (395), Expect = 1.654e-51
Identity = 131/534 (24.53%), Postives = 239/534 (44.76%), Query Frame = -2
Query:   54 FAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGK-SKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWK--------FGEIKFDV-----PKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIP----DDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKI--YENQTLPQIIYVVVKKRISVKFFKDGANP----NPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGK-IHRGVTPPAINDRIRERLFYL 1574
               + K  + P G   +   L +P EL +L G  +  +++    K+L   +     +  + I+   K   + +     ++ WG+ +    + I GR L    I        T     W            I  ++     P+ +A +   L+     S F+     +   + R       D  +      +   LT     S+ H+ LV        D +Y+ +K    +   + +Q +  R  S +  ++ + +A K ++Q+ SKLG + W + + +   M+VG+D  H  + K +SV   V S+++  + + S V       E        FL+ L  +    + +P ++++YRDGV D QL   + +E   ++K  E    YE    P+++++VV+KRI+   +   AN       GTV+D  +   ++ +FYL +    +G   PT+Y  L +T          + ++P  LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +H   + PAI  ++ ++LF+L
Sbjct:  533 LVHRPKERSNPGGKVISGHILLVP-ELSFLTGIPEKMKNDYRAMKDLKIHINVSSDQHTHAIKQLLKNISSKEDCTKALEGWGLELGSDVMMITGRMLPFETICLKSSSFATGANVSWSREVVNGASISSIPLNIWVVFYPRRSAEQAVELI-----STFHKVAGPIGLRLQRPITVELRDDRTETYVKSIHSQLT-----SEPHLQLVVCVIEGNRDDLYSAIKKLCCLKCPVPSQVINVRTISQQ--QKLRGIAQKILLQLNSKLGGELWTVGIPLKSLMVVGVDVHHDTSKKHQSVMGFVASVNSSLTHWYSRVTFQTPTEELISGFRACFLSTLQKYYELNHDLPQKIVVYRDGVSDGQLKMVELYEIPQLIKCFETFPNYE----PKLVFIVVQKRINTILYSSSANGFSSVPAGTVLDHTLTNKDWVDFYLTAHDIRQGVGLPTHYVTLYNT----------ANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQFLH---SEPAI--QLSDKLFFL 1034          

HSP 2 Score: 67.3958 bits (163), Expect = 1.654e-51
Identity = 65/289 (22.49%), Postives = 124/289 (42.91%), Query Frame = -1
Query: 1585 EPALQPDT-VTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKD---VEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVV----SVYRRDQ-------IDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGD-KKISYLNYFKQRYNINLKNDKQPFVISRVK 2400
            EP ++ ++   +K G  G  +++ SN+   + K +   Y Y V          +   +   +    G+   FDG  L+   +     + +++   D   +EI+I++      NS+      N+VF  +   +G   +GR  +   N                  ++  GYST I R           L ++  ++VL  ++V+    ++Y++ +         +LIG   IT+YNN+TYRI DI+ +    D   L D  + ++L Y+ + Y I ++   QP ++ R K
Sbjct:  265 EPTVETESKPLNKAGVKGASITIGSNHIPISCKNQA-VYQYHVTFNPNVESMSMRFGMMRDHRSTTGEVIAFDGSILYLPVQLCDVVNLKSVRRTDDEEIEITIKMTKVLPPNSDLCIPFYNVVFRRVMKVIGLRLVGRNHYDPENA---------VILGKQRLQVWPGYSTAIKRMD-----GGLYLAVDVSHKVLRNDSVLDLMNTLYQQTKENFKDACTKELIGSIAITRYNNRTYRIDDIEWDKSPKDSFTLMDGTETTFLEYYSKNYGITVQETNQPLLVHRPK 538          
BLAST of SMEDWI-1 vs. Planmine SMEST
Match: SMESG000036375.1 (SMESG000036375.1)

HSP 1 Score: 1049.65 bits (2713), Expect = 0.000e+0
Identity = 503/504 (99.80%), Postives = 504/504 (100.00%), Query Frame = -2
Query:   54 KKKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1565
            K+KTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL
Sbjct:  305 KEKTENEPEGPTETDQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          

HSP 2 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = -1
Query: 1558 MDSTNVTSDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK 2478
            MDSTNVTSDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK
Sbjct:    1 MDSTNVTSDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEK 307          
BLAST of SMEDWI-1 vs. Planmine SMEST
Match: SMESG000069984.1 (SMESG000069984.1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 294/495 (59.39%), Postives = 381/495 (76.97%), Query Frame = -2
Query:   54 DQSLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYM-KSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQT--LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1523
            D +L+IPGELC+LCGFSD E+SN++LQKNLG VLKREPRERL+DI  +C W     +   M   W + I+ +P+ I GREL P D+ S   KIN K+ DDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY+     +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P AIN+RIR RLFYL
Sbjct:  343 DMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 836          

HSP 2 Score: 303.138 bits (775), Expect = 0.000e+0
Identity = 145/292 (49.66%), Postives = 202/292 (69.18%), Query Frame = -1
Query: 1570 RGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVR 2433
            RGGL+R F I+EP LQP  +T+K G  GR V L+SN+  F++     F MYD V     +  K++L       + N  P  FCFDGRRLFT+ KWH + D +     + ++++RL++T L  +EEYYQMIN++ NN+Q+ +GQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK+RYNI L    QPFV++RVK+ M R
Sbjct:   25 RGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRR 316          
BLAST of SMEDWI-1 vs. Planmine SMEST
Match: SMESG000081970.1 (SMESG000081970.1)

HSP 1 Score: 194.512 bits (493), Expect = 5.461e-60
Identity = 145/516 (28.10%), Postives = 247/516 (47.87%), Query Frame = -2
Query:   54 PEGPTETDQSLS--IPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFC-KWTGAGKSKDYMKSWGMCIEEQPITIRGRELAPVDI-FSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNP-SHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIR-----VSKVHMALVFIPDDKVYAKVKNFT-MSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGK-RSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFFKDGA-------NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 1544
            P+G  E D  L   IP ELC L G +D    +  L + L    +  P++R   + +F        ++K  +  WG+ IE+  + I   ++ P  I F NE  ++     ++K       V  G      +L+  ++  +  N  ++ +  +  R+ + +    I    ++  E+ L +  R     V  V   L  + +D+ Y  +K F  +   + +Q V  +  + ++  +  +VA    +Q+ +KLG + W + + +   M+VGLD +H   G+ RSV A V S +A  +++ S  +  +   E    L    L+ L  +  + N +P  + +YRDGV D QL + +K E +   K+ E  +     P ++Y VV+KRI+ + +           NPNPGT+VD  + + N Y+F+LVSQ   +GT +PT+Y VL D           S  +P  +Q + Y   H+Y+NW GT+RVP P  YAH+LA +VG+  +      + D    RLFYL
Sbjct:  478 PKGSKEVDGGLVYLIP-ELCMLTGLTDDMIKDFRLMRELHEHCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEASVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGKPKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDR-YNAIKKFCYVDCPVPSQVVLAQ--TLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAVVGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDGQLGYVQKTEIEQFFKVFES-FSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTIVDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDN----------SKYTPHQVQLMAYKTCHIYYNWPGTVRVPAPCMYAHKLAYMVGQNLKAEPSNLLCD----RLFYL 974          

HSP 2 Score: 57.7658 bits (138), Expect = 5.461e-60
Identity = 46/176 (26.14%), Postives = 82/176 (46.59%), Query Frame = -1
Query: 1591 NSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVY-------------RRDQIDQLIGRDIITKYNNKTYRISDIK-EMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISR 2076
            N  E   + N++F  I+  +   KIGR +F           E          +I  GY T+I     +N     LL  +  ++V+  ++V  +              +   I+QL+G+ ++T +NN+ YRI+DI    +   E   G +KISY +YFK  Y + +++ +QP ++S+
Sbjct:  306 NFSECPMVYNVLFKRIENSLRMVKIGRDYFYP---------EKKIVLDRRRMEIWPGYVTSI-----QNFDGGLLLQCDVSHKVIRNDSVYDIMMEINKTVNNKGQMQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIRDLEQPMIVSK 467          
BLAST of SMEDWI-1 vs. Planmine SMEST
Match: SMESG000050994.1 (SMESG000050994.1)

HSP 1 Score: 117.087 bits (292), Expect = 2.458e-26
Identity = 102/353 (28.90%), Postives = 162/353 (45.89%), Query Frame = -2
Query:  102 VEDALTDFIRVS-----KVHMALVFIPDDKVYAKVKNF-TMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPT------------MIVGLDTFHSKTGK----RSVQASVFSISAKFSQYISFVNSSKGKNEFH--------ENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF----KDG----ANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGV 1046
            +E   TD IR S     K+ + +  + +D+ Y +VK F  +  G++TQC+     +      R+   D+ +  +  K+     G+N +++P             M+ G+D  H  + +    +SV A V S+    + Y + +     K E          E++  N L  +T ++      P RLI YRDGV + Q     K E  A+    +K+ E    P I Y+VV+KR  ++FF    KDG     N   GTVVD+ I     ++FYL S +  +GT+ P +Y+VL D    N  ++E        LQ  TY L H+Y     ++  P PT+YAH LA   G+   G+
Sbjct:  888 IEKVATDTIRNSEKEKKKLDLLVFVVINDEDYKEVKKFGDVLFGIVTQCMKYATLN------RQKFLDQYLGNIMLKVNGKLGGVNWELSPIRNRLFTPIKDSFMVFGIDVTHPASTRNDLSKSVAAMVGSLDNNATMYSALIRQQLSKKERAIIEIVMEMEDMVYNLL--MTFYKANKQLKPKRLIFYRDGVSEGQFDIVFKHEIIAIQSACQKL-EKDYQPPITYIVVQKRHKIRFFPQNEKDGVGRSGNVPSGTVVDKDITHCREFDFYLCSHEGIQGTSKPAHYHVLFDE--NNWGSDE--------LQSFTYFLCHIYARCTRSVSYPAPTYYAH-LAAFRGRTLIGL 1220          
BLAST of SMEDWI-1 vs. Planmine SMEST
Match: SMESG000051000.1 (SMESG000051000.1)

HSP 1 Score: 110.538 bits (275), Expect = 2.270e-24
Identity = 116/470 (24.68%), Postives = 205/470 (43.62%), Query Frame = -2
Query:  114 ERLNDIRDFCKWTGAGKSKDYMKSWGMCIEEQPITIRGREL-APVDIFSNEVKINTKIPD------DWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSKVHMALVFIPDDKVYAKVKNF-TMSTGLLTQCVTQRNGSNRDDRRRKTVAD---KSVMQMFSKLGYDPWGI-NLKMAPT----MIVGLDTFHSKTG---KRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFN------------TMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKF----FKDGA----NPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKI 1406
            ER ++++         ++  Y++S+ + I  Q I ++GR L  P  +F ++     K+P       + KF +   D  K     FG      N +       ++ +   ++ +    D+     SN+      + I+   + + +V + +D  Y  VK+   +  G++TQC+   N       R+K ++      ++++ +KLG   W I N++ AP     M+ G+D  H        +SV A V SI+   + Y + +     K+      GK+ +  +   ++  +             +P  LI YRDGV + Q       E  A+    EK  +N   P+I Y++V+KR +++F     +D      N  PG V+D  I     ++FYL S +  +GT+ P +Y V++D    N             LQ+ TY L ++ F    +I  P PTHYAH LA   G+I
Sbjct:  469 ERFDNLKKSVVAFKGFRNNKYLQSYNITIIPQMINVKGRILDEPTALFGDK---EEKLPKSKFNIMNKKFKDPFHDPIKWALFAFGERREYGNENELYAIEIELPKAAIKVNVKILKDNTFCYVSNDDIKKSIEKIK-EDLDLLVVVVRNDVEYKLVKDIGDIELGIVTQCICYENLC-----RQKNLSQYMGNLMLKVNAKLGGVNWEIKNIEYAPIKGLFMVFGVDVTHPSNNDGLSKSVAAVVGSINKTATIYSAVIKKQLSKD------GKDAVETVVEMEDMVHRLIKVFYDLNQSKLPDHLIFYRDGVSEGQFEIVFNHEIAAIQYACEKFKKNYK-PKITYIIVQKRHNIRFCPITLEDSVGRCKNVLPGVVIDNDITHSREFDFYLCSHEGIQGTSKPVHYYVILDENRWNSND----------LQEFTYFLCYVCFRCTRSISYPAPTHYAH-LAAFRGRI 911          
The following BLAST results are available for this feature:
BLAST of SMEDWI-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIWIL12.349e-6728.21piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL12.349e-6728.21piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL32.614e-6228.79piwi like RNA-mediated gene silencing 3 [Source:HG... [more]
PIWIL32.614e-6228.79piwi like RNA-mediated gene silencing 3 [Source:HG... [more]
PIWIL31.648e-6028.73piwi like RNA-mediated gene silencing 3 [Source:HG... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prg-17.860e-5927.86Piwi-like protein [Source:UniProtKB/TrEMBL;Acc:P9... [more]
alg-21.124e-2825.45pep chromosome:WBcel235:II:874160:879001:1 gene:WB... [more]
alg-21.693e-2825.45pep chromosome:WBcel235:II:873176:878945:1 gene:WB... [more]
alg-14.016e-2729.38pep chromosome:WBcel235:X:13951262:13956261:1 gene... [more]
alg-14.030e-2729.38pep chromosome:WBcel235:X:13949114:13956261:1 gene... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piwi5.183e-7030.19gene:FBgn0004872 transcript:FBtr0080166[more]
piwi5.183e-7030.19gene:FBgn0004872 transcript:FBtr0340227[more]
aub9.137e-6729.90gene:FBgn0000146 transcript:FBtr0112793[more]
aub1.026e-6629.90gene:FBgn0000146 transcript:FBtr0080165[more]
AGO37.354e-5529.26gene:FBgn0250816 transcript:FBtr0299882[more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piwil11.775e-7530.28piwi-like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil11.775e-7530.28piwi-like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil25.048e-4425.84piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil25.048e-4425.84piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil22.228e-2823.38piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd741.598e-6930.58CD74 molecule [Source:Xenbase;Acc:XB-GENE-922847][more]
cd741.639e-6930.58CD74 molecule [Source:Xenbase;Acc:XB-GENE-922847][more]
piwil38.974e-6929.40piwi-like RNA-mediated gene silencing 3 [Source:NC... [more]
bckdhb5.273e-6729.03branched chain keto acid dehydrogenase E1, beta po... [more]
piwil37.150e-6529.21piwi-like RNA-mediated gene silencing 3 [Source:NC... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Piwil14.513e-6728.06piwi-like RNA-mediated gene silencing 1 [Source:MG... [more]
Piwil43.119e-6325.86piwi-like RNA-mediated gene silencing 4 [Source:MG... [more]
Piwil11.270e-5625.97piwi-like RNA-mediated gene silencing 1 [Source:MG... [more]
Piwil25.151e-5224.32piwi-like RNA-mediated gene silencing 2 [Source:MG... [more]
Piwil46.093e-3025.06piwi-like RNA-mediated gene silencing 4 [Source:MG... [more]
back to top
BLAST of SMEDWI-1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2Q5Y9|PIWI1_SCHMD0.000e+099.80Piwi-like protein 1 OS=Schmidtea mediterranea OX=7... [more]
sp|Q2PC95|PIWIL_DUGJA0.000e+058.55Piwi-like protein OS=Dugesia japonica OX=6161 GN=i... [more]
sp|Q2Q5Y8|PIWI2_SCHMD0.000e+059.27Piwi-like protein 2 OS=Schmidtea mediterranea OX=7... [more]
sp|Q8UVX0|PIWL1_DANRE1.096e-7430.28Piwi-like protein 1 OS=Danio rerio OX=7955 GN=piwi... [more]
sp|A8D8P8|SIWI_BOMMO1.110e-7329.29Piwi-like protein Siwi OS=Bombyx mori OX=7091 GN=S... [more]
back to top
BLAST of SMEDWI-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|196215117.006e-17489.68tr|D2Z0D8|D2Z0D8_DUGJA DjPiwiA OS=Dugesia japonica... [more]
gnl|BL_ORD_ID|230802410.000e+075.25tr|T1E104|T1E104_9PLAT PIWI-1 OS=Dendrocoelum lact... [more]
gnl|BL_ORD_ID|212640993.223e-1269.68tr|G9B7B7|G9B7B7_9PLAT Piwi A (Fragment) OS=Phagoc... [more]
gnl|BL_ORD_ID|188240020.000e+062.07tr|G9B7C2|G9B7C2_9PLAT Piwi B (Fragment) OS=Seidli... [more]
gnl|BL_ORD_ID|196280370.000e+059.20tr|D2Z0D9|D2Z0D9_DUGJA DjPiwiB OS=Dugesia japonica... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piwil12.047e-7531.30piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil22.535e-5223.28piwi like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil26.356e-5224.02piwi like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil21.724e-4724.02piwi like RNA-mediated gene silencing 2 [Source:NC... [more]
ago23.803e-2528.87argonaute RISC catalytic component 2 [Source:NCBI ... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
piwil25.191e-6128.74piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil12.581e-5028.49piwi-like RNA-mediated gene silencing 1 [Source:NC... [more]
ago23.162e-2531.97argonaute RISC catalytic component 2 [Source:ZFIN;... [more]
ENSPMAT00000009610.14.232e-925.12pep scaffold:Pmarinus_7.0:GL477777:44890:66775:1 g... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMEDWI-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO499312.794e-6728.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340271.668e-6227.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464311.086e-2630.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281241.512e-624.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMEDWI-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piwil12.803e-7631.30piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil11.255e-7431.70piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil12.034e-6429.60piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil12.034e-6429.60piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil21.654e-5124.53piwi like RNA-mediated gene silencing 2 [Source:NC... [more]
back to top
BLAST of SMEDWI-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036375.10.000e+099.80SMESG000036375.1[more]
SMESG000069984.10.000e+059.39SMESG000069984.1[more]
SMESG000081970.15.461e-6028.10SMESG000081970.1[more]
SMESG000050994.12.458e-2628.90SMESG000050994.1[more]
SMESG000051000.12.270e-2424.68SMESG000051000.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007406
GenBankQ2Q5Y9
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007406 ID=SMED30007406|Name=SMEDWI-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2730bp
AATCGAATACATAAAAATTTATTTGACACCAAATACAAAGAGACATTAAT
CTACAAGTAAAATAAGCGTTCGCGAATTCTGTCATTTATCGCTGGAGGAG
TAACACCACGATGAATCTTGCCAACGAGTTCAGCCAAACGATGGGCATAA
TGCGTTGGAACAGGAACTCGGATTGTTCCCATCCAGTTAAAATACAAATG
TGTTAACGAATAAGTTATTTGCTGCAATACACTCGGAGACATAACTGAAA
CCTCATTTGTTTTCTTGTTTGTAAACTTAGTGTCCATAAGAACATTATAA
TTCGTAGGAGATGCTGTACCTTTAGTTGTTTTCTGAGACACCAAGTAAAA
TTCATAGAAATTGGGTTTCACTATTTTCTCATCAACCACAGTACCAGGAT
TTGGATTAGCCCCATCTTTGAAAAATTTAACACTAATTCTCTTCTTAACC
ACAACATAAATAATTTGGGGCAAAGTTTGATTTTCGTAAATTTTCTCTAT
CATTTTCATAACAGCATCAGTTTCGAACTTTTTGGTAAATGCTAACTGTG
AATCTCCAACACCGTCACGATAAATAATCAAACGAAGAGGCATAGTGTTA
AATTTGTTTTGGAATGTTGTAAGGGCCGTTAGGAAGTTTTTGCCCAAATT
TTCGTGAAATTCATTTTTACCTTTAGATGAATTGACAAAACTGATATACT
GAGAAAATTTGGCACTAATTGAAAATACGGATGCTTGAACAGATCTTTTA
CCGGTTTTGCTATGAAAAGTATCCAATCCTACAATCATAGTCGGTGCCAT
TTTAAGATTAATACCCCATGGGTCGTATCCTAATTTAGAAAACATTTGCA
TAACTGATTTATCTGCAACCGTTTTACGACGTCGATCATCTCTATTACTT
CCGTTTCTCTGCGTCACACACTGAGTCAATAGACCTGTAGACATTGTAAA
ATTCTTTACTTTTGCGTAAACTTTATCATCAGGAATGAACACTAATGCCA
TATGTACCTTGCTTACACGAATAAAATCTGTTAAAGCGTCTTCAACTTCA
TTGGATCGACATGAAGATATACTGTCCATTGTGTAATTGATTCTTAATCT
TCCTATTTCTCTTTTAACATCTTCAATAAAATTGTTGAAGTGACTAGGGT
TTCGATCAACAACCAGTACACCAAAACGATGAGCTGTGCCTTTAGGAACG
TCAAATTTAATTTCCCCAAACTTCCAATCATCAGGGATTTTAGTATTAAT
TTTAACTTCGTTTGAAAATATATCAACTGGAGCCAATTCACGACCACGAA
TCGTAATCGGTTGTTCTTCAATACACATCCCCCAGCTCTTCATATAATCT
TTTGATTTCCCAGCTCCGGTCCACTTACAAAAATCTCTTATGTCATTTAA
TCGTTCTCTAGGCTCACGTTTCAATACGGTTCCTAAATTCTTTTGCAAAT
TTATATTACTTCTTTCACTATCCGAAAATCCACATAAATAGCATAATTCA
CCTGGAATTGATAAACTTTGATCTGTTTCTGTAGGTCCTTCAGGTTCATT
TTCAGTTTTTTTCTTTTGGGCGAACCATCGATCGCTTGACTCGCGATATA
ACAAATGGTTGTTTGTCATTTTTCAAATTAATGTTATACCGTTGCTTGAA
ATAATTCAAATAGGATATCTTTTTATCGCCTAGCTGAACCTCGTCATTAA
CATCCATTTCTTTAATATCTGAAATTCTATACGTCTTGTTATTATACTTG
GTAATTATGTCCCTTCCTATTAATTGATCAATTTGATCTCGTCGATACAC
TGATACTACATTGTTTTCATTTAGAACACGATTAATTCTTTCAAGATAAA
GTAAAGTCGAAGCAGTTCCATTTTCATTTGTTCCTCTTGTAATTGTAGTA
GAATACCCTCCTAATATCTTGAAATTGTCCATTTTAAAAAAGCTAGGTCC
TTCTCGAATACCACCACTTTCACAATTTGATCCCAGAAAAAATTGTCTAC
CAATTTTTTCTTGTCCCATAAATATTTGAATATTATTAAATACAATATTT
ATCATCTGATAATATTCTTCAGAATTTTTTAAAAACGTCGTCAGCAATCG
TATGGAAATTTCAACATCTTTGATAACTAAGTTTTCTGTATCTTCATCTG
AGTGCCACTTAGAAGTCGTAAATAATCTTCTGCCATCAAAACAAAATGGT
TGACCATTATTTTTGCTGTTTGCATAAGCTAATAATAACTCTAGCTTAGT
ACGGATACTTTTATTCTCCATAACTACATCATACATGTAAAATGGTCCTT
CGACTTTAATATTAAAGTTAGCGTAGTTAGACTTGAGACTAACTACTCTT
CCATCTTTCCCTATTTTGTCTGTAACTGTATCAGGCTGTAAAGCAGGTTC
AATAATTGCGAATCTTCTTTGGAGACCTCCTCTTCTTGGTCTTAAATTGG
GATCACTTGTAACATTAGTTGAATCCATTTCGTAAATTTGAGTAAAAATG
TTAAAACAAAGACTTCGGTTTAAATAAACAAAATATACTATGTAAAACGA
TAAATATAATTGCTTTAATGGTTTATGATTTGTATTATATAATAATAATA
ATTTAATTTCCCTGTGAATATTATATTAAAATATAGTAAAAATTACTCGT
AAATGTGTGTTAAAGTAATAGGATTAAATTAAAATAAACATTTTACGAAA
TAAGTTCTAGTCAATTATGAAGTCTTTTCT
back to top

protein sequence of SMED30007406-orf-1

>SMED30007406-orf-1 ID=SMED30007406-orf-1|Name=SMED30007406-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=309bp
MDSTNVTSDPNLRPRRGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKS
NYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQPFCFDGR
RLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNI
QIFMGQEKIGRQFFLGSNCESGGIREGPSFFKMDNFKILGGYSTTITRGT
NENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTY
RISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRS
MVRPKEKN*
back to top

protein sequence of SMED30007406-orf-2

>SMED30007406-orf-2 ID=SMED30007406-orf-2|Name=SMED30007406-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=523bp
MTNNHLLYRESSDRWFAQKKKTENEPEGPTETDQSLSIPGELCYLCGFSD
SERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYMKSWGMCI
EEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFG
VLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFI
RVSKVHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKT
VADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFS
ISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIY
RDGVGDSQLAFTKKFETDAVMKMIEKIYENQTLPQIIYVVVKKRISVKFF
KDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFT
NKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVG
KIHRGVTPPAINDRIRERLFYL*
back to top
Aliases
The feature 'SMEDWI-1' has the following synonyms
Synonym
piwi-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000074oocyte
PLANA:0000208testis
PLANA:0000420parapharyngeal region
PLANA:0002013Category 1 cell
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0004517blastomere
Vocabulary: INTERPRO
TermDefinition
IPR036085PAZ_dom_sf
IPR003165Piwi
IPR012337RNaseH-like_sf
IPR003100PAZ_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005515protein binding
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000005Stage 5
PLANA:0000003Stage 3
PLANA:0000008Stage 8
PLANA:0000004Stage 4
PLANA:0000007Stage 7
PLANA:0000006Stage 6
PLANA:0000002Stage 2
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003100PAZ domainSMARTSM00949PAZ_2_a_3coord: 207..307
e-value: 8.9E-4
score: 11.6
IPR003100PAZ domainPFAMPF02170PAZcoord: 221..297
e-value: 2.4E-11
score: 43.6
IPR003100PAZ domainPROSITEPS50821PAZcoord: 241..296
score: 12.095
NoneNo IPR availableGENE3DG3DSA:2.170.260.10coord: 209..308
e-value: 1.4E-15
score: 59.2
NoneNo IPR availablePANTHERPTHR22891:SF145PROTEIN AUBERGINE-RELATEDcoord: 31..304
NoneNo IPR availablePANTHERPTHR22891EUKARYOTIC TRANSLATION INITIATION FACTOR 2Ccoord: 31..304
IPR036085PAZ domain superfamilySUPERFAMILYSSF101690PAZ domaincoord: 86..301