Protein phosphatase 1 regulatory subunit 42

Overview
NameProtein phosphatase 1 regulatory subunit 42
Smed IDSMED30007403
Length (bp)1204
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein phosphatase 1 regulatory subunit 42 (SMED30007403) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein phosphatase 1 regulatory subunit 42 (SMED30007403) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein phosphatase 1 regulatory subunit 42 (SMED30007403) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein phosphatase 1 regulatory subunit 42 (SMED30007403) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007403

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30007403h1SMcG0019598 dd_Smed_v4_7268_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007403h1SMcG0019598 dd_Smed_v4_7268_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007403h1SMcG0019598 dd_Smed_v4_7268_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007403h1SMcG0019598 dd_Smed_v4_7268_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30007403h1SMcG0019599 Contig53605uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30007403h1SMcG0019599 Contig53605newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30007403h1SMcG0019598 Contig53605uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30007403h1SMcG0019598 Contig53605newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30007403h1SMcG0019598 dd_Smed_v4_7268_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Human
Match: PPP1R42 (protein phosphatase 1 regulatory subunit 42 [Source:HGNC Symbol;Acc:HGNC:33732])

HSP 1 Score: 192.971 bits (489), Expect = 6.868e-58
Identity = 109/251 (43.43%), Postives = 172/251 (68.53%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDA 821
            MV+L ++++ ++++ +   + +E+  Q L K+TH+   +K +D+I  ++ LCKNL+VLYLYDN +S++ +L+   +LTH+Y+QNN I+ I++L+ L  L KLY+G N I  +EGL     L+EL++E Q L  GEKLLFDPRT+  ++ SL ++N+S NN+D I  L  L+NL QL A DN++  +K+   +L+    L +++L  NP+C   KYRD +I+   SLE LDGK++ +  RQFL+ WKA+KDA
Sbjct:    1 MVRLTLDLIARNSNLK--PRKEETISQCLKKITHINFSDKNIDAI-EDLSLCKNLSVLYLYDNCISQITNLNYATNLTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAVIEGLEGLGELRELHVENQRLPLGEKLLFDPRTLHSLAKSLCILNISNNNIDDITDLELLENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKPKYRDRLILVSKSLEFLDGKEIKNIERQFLMNWKASKDA 248          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Human
Match: PPP1R42 (protein phosphatase 1 regulatory subunit 42 [Source:HGNC Symbol;Acc:HGNC:33732])

HSP 1 Score: 157.532 bits (397), Expect = 2.382e-45
Identity = 94/228 (41.23%), Postives = 153/228 (67.11%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLES 752
            MV+L ++++ ++++ +   + +E+  Q L K+TH+   +K +D+I  ++ LCKNL+VLYLYDN +S++ +L+   +LTH+Y+QNN I+ I++L+ L  L KLY+G N I  +EGL     L+EL++E Q L  GEKLLFDPRT+  ++ SL ++N+S NN+D I  L  L+NL QL A DN++  +K+   +L+    L +++L  NP+C   KYRD +I+   SL +
Sbjct:    1 MVRLTLDLIARNSNLK--PRKEETISQCLKKITHINFSDKNIDAI-EDLSLCKNLSVLYLYDNCISQITNLNYATNLTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAVIEGLEGLGELRELHVENQRLPLGEKLLFDPRTLHSLAKSLCILNISNNNIDDITDLELLENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKPKYRDRLILVSKSLGT 225          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Human
Match: LRRC9 (leucine rich repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:19848])

HSP 1 Score: 60.8474 bits (146), Expect = 2.898e-9
Identity = 52/170 (30.59%), Postives = 77/170 (45.29%), Query Frame = 3
Query:  213 IGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDL 722
            + L  NLT L +   ++ E+  L  C  L  +++    I +I+ LQ+  NL KLY+  NKI  +E L                   EKL+            L V+ ++ N + +IE L+ LKNLK L+   N I+ I      L +   L RL L  N ICS K+  +L
Sbjct:   50 LSLFPNLTSLTIVAQDIKEISGLEPCLQLKELWIAECCIEKIEGLQECRNLEKLYLYFNKISKIENL-------------------EKLI-----------KLKVLWLNHNTIKNIEGLQTLKNLKDLNLAGNLINSI---GRCLDSNEQLERLNLSGNQICSFKELTNL 186          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Human
Match: LRRC9 (leucine rich repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:19848])

HSP 1 Score: 60.4622 bits (145), Expect = 3.862e-9
Identity = 52/170 (30.59%), Postives = 77/170 (45.29%), Query Frame = 3
Query:  213 IGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDL 722
            + L  NLT L +   ++ E+  L  C  L  +++    I +I+ LQ+  NL KLY+  NKI  +E L                   EKL+            L V+ ++ N + +IE L+ LKNLK L+   N I+ I      L +   L RL L  N ICS K+  +L
Sbjct:   50 LSLFPNLTSLTIVAQDIKEISGLEPCLQLKELWIAECCIEKIEGLQECRNLEKLYLYFNKISKIENL-------------------EKLI-----------KLKVLWLNHNTIKNIEGLQTLKNLKDLNLAGNLINSI---GRCLDSNEQLERLNLSGNQICSFKELTNL 186          

HSP 2 Score: 53.5286 bits (127), Expect = 6.305e-7
Identity = 49/166 (29.52%), Postives = 78/166 (46.99%), Query Frame = 3
Query:  294 SLTHIYVQNNNITRIDHLQ--DLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSR 785
            SL  +++  N I  +  LQ   L NL  L++  N+I  VEGL    +LQEL +++  +       F   +      SL  +++  N +  +  L+ L  L++L    NKI DI E    L   + L  L +  NPIC    +R ++I  + +L+ LDG  V    R
Sbjct: 1203 SLEVLHLGYNGICNLIQLQLNRLRNLKFLFLQGNEISQVEGLDNLVVLQELVVDHNRIRSFNDSAFAKPS------SLLALHLEENRLRELGKLQSLVKLEKLFLGYNKIQDITELEK-LDVISTLRELTVYGNPICRKMLHRHMLIFRLPNLQMLDGSPVNSDDR 1361          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Human
Match: PPP1R7 (protein phosphatase 1 regulatory subunit 7 [Source:HGNC Symbol;Acc:HGNC:9295])

HSP 1 Score: 58.9214 bits (141), Expect = 4.438e-9
Identity = 46/176 (26.14%), Postives = 84/176 (47.73%), Query Frame = 3
Query:  228 NLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDN------KIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTV 737
            NL  L+L  N ++++ +L A  +LT + +Q+N +T+I+ LQ+L NL +LY+ HN I  +EGL  N                                L++++++ N +  IE +  L  L++    DN       +D++K   ++ +   YL R  LQ +P     +YR  V++ +
Sbjct:  150 NLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNN------------------------------KLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETV--YLERNPLQKDP-----QYRRKVMLAL 288          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Celegans
Match: sds-22 (Protein phosphatase 1 regulatory subunit SDS22 homolog [Source:UniProtKB/Swiss-Prot;Acc:P45969])

HSP 1 Score: 58.5362 bits (140), Expect = 2.478e-9
Identity = 54/170 (31.76%), Postives = 82/170 (48.24%), Query Frame = 3
Query:  159 KVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKL--------LF----DPRTIMGIS--MSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDI 626
            K+  L + N  L SIS  I     LT L LY+N L+E+  L +  +L  + +  N I +I+ L  L  L  LY+  NKI  +E L   T L+ L +    +   E +        LF      R + G+     LSV+++ GN +  IE +  L NLK+L+ +D  + DI
Sbjct:   59 KIEELRMRNNLLVSISPTISSLVTLTSLDLYENQLTEISHLESLVNLVSLDLSYNRIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLSVLSLPGNRIVKIENVEQLNNLKELYLSDQGLQDI 228          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 57.7658 bits (138), Expect = 4.572e-9
Identity = 55/175 (31.43%), Postives = 83/175 (47.43%), Query Frame = 3
Query:  231 LTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQN-----------LLPGEKLLFDP---RTIMGIS--MSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLK 707
            LT L L DN + ++ +L    +L  + V  N IT+I+ L +L NL +L++ HNKI  +EGL  NT ++  Y+E+ +           L+  E+L       R I G+     L  +++ GN +  IE L  L  LK +    N I  I      LS    L  L+L  N I  L+
Sbjct:   73 LTRLNLNDNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEELHLVHNKIITIEGLETNTAMK--YLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKIDG----LSGLTNLKSLDLNDNIIEKLE 241          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Celegans
Match: C06A8.6 (pep chromosome:WBcel235:II:7772499:7773914:1 gene:WBGene00015516.1 transcript:C06A8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A8.6)

HSP 1 Score: 50.447 bits (119), Expect = 1.224e-6
Identity = 46/203 (22.66%), Postives = 90/203 (44.33%), Query Frame = 3
Query:  231 LTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGL-HMNTM---------------------LQELYIEYQNLLPGEKLLFDPRTIMGIS--MSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDD--IKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDG 761
            L  L+   N ++++  L     L ++ + +N I +I++L +   L +L++G N+I  +E + H+  +                     L+E+Y+    +          + + GI   + L +++ + N ++ +E +  LK L    A  NK+D+  I +    L   N ++   L  NPI S+  YR  VI  +  +  LDG
Sbjct:  122 LKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIENLDNNLKLDRLFLGANQIRLIENVDHLKKLTVLSLPANAITVVDNISGLHNLKEIYLAQNGI----------KYVCGIDEHLPLEILDFNQNRLEKVENIHQLKTLTDFWARGNKLDNWSIMDELVELPQLNSVY---LDFNPIASVDTYRGKVIHLLQQITRLDG 311          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Fly
Match: sds22 (gene:FBgn0028992 transcript:FBtr0083436)

HSP 1 Score: 56.225 bits (134), Expect = 1.584e-8
Identity = 45/153 (29.41%), Postives = 78/153 (50.98%), Query Frame = 3
Query:  231 LTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPN 689
            L VL +  N L+++ +L     L  +Y  +N IT+I++L  L NLT L +G NK+  +E + M   L++L++    +   E L           ++L ++++  N +  IE L  L NL++L+ ++N +    ET   LS    L  L+L  N
Sbjct:  107 LEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENL--------DTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGV----ETIENLSENTKLETLDLAKN 247          

HSP 2 Score: 49.2914 bits (116), Expect = 3.491e-6
Identity = 32/96 (33.33%), Postives = 54/96 (56.25%), Query Frame = 3
Query:  153 LMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQEL 440
            L  +T L L + +L  I   I +  NL  L+L  N ++++ +L    +L  + +Q N I +I++L+ LANL +LY+  N +  +E L  NT L+ L
Sbjct:  148 LTNLTMLELGDNKLKKIEN-IEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETL 242          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Fly
Match: dtr (gene:FBgn0023090 transcript:FBtr0081516)

HSP 1 Score: 52.7582 bits (125), Expect = 4.462e-7
Identity = 58/209 (27.75%), Postives = 89/209 (42.58%), Query Frame = 3
Query:  231 LTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPL---KNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICS-LKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEEN 845
            L  L+L  N +SE+  L     L  +++QNN IT+I++L     L  L +  N I  ++ +  N            +LP                 L+ + +S N +   E L  L   K L  L  ++N+IDDI     I      L  L LQ NP+ S L +YR  +I+    L  LD + V    R     WK  +D  + +++EN
Sbjct:   58 LKCLWLECNAISEIQGLEKLSKLKCLFLQNNLITKIENLDPCRELDTLNLSSNHIRKIQNIGTN------------VLP----------------VLNTLTISSNYLKDSESLSDLIQCKTLSVLDLSNNRIDDIL-IVKIFEQMLNLKVLVLQGNPVVSRLPQYRKTLILACKELTYLDSRPVFPRDRACAEAWK--RDGYEGERKEN 235          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Fly
Match: CG14185 (gene:FBgn0036936 transcript:FBtr0074818)

HSP 1 Score: 51.2174 bits (121), Expect = 9.257e-7
Identity = 28/83 (33.73%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  516 SLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGK 764
            ++ V+   GN +  ++PL  L +L+ L A +N+I ++    + L     L  +ELQ NP+C L  YR L+  +V +L+ LDG+
Sbjct:  190 AIRVLIADGNMIQRVDPLAELVHLRVLKARNNRISELG-LLSFLGMCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGR 271          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Zebrafish
Match: ppp1r42 (protein phosphatase 1, regulatory subunit 42 [Source:NCBI gene;Acc:431749])

HSP 1 Score: 211.846 bits (538), Expect = 3.442e-65
Identity = 112/252 (44.44%), Postives = 165/252 (65.48%), Query Frame = 3
Query:  144 EQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSS 899
            +QYL K+THL   +K ++ I  ++ +C+NLTVLYLYDN +S++ +L    +LTH+Y+QNNNI+ I++L  L  L+KL++G N I  VEGL     L+EL++E Q L  GEKL FDP +I  +S +L ++N+S NN+D +  L PL+ +  L A DN++ DI+E  T+ S +  L  L+L  NP+C   KYRD +I     L+ LDGK + + SRQFL+ WKA+KDA  KK E+ K   + V   AN++  S+
Sbjct:   25 QQYLRKLTHLNFSDKNIEEID-DLSVCRNLTVLYLYDNQISQICNLGFASNLTHLYMQNNNISCIENLSSLHKLSKLFLGGNSITVVEGLEELKSLKELHVEGQKLPCGEKLAFDPHSISSLSETLCILNISKNNIDELWDLAPLRKMTHLFAADNQLHDIQELETVFSQWFKLRLLDLSRNPVCHKPKYRDRLITVCKFLDDLDGKQINELSRQFLINWKASKDA-KKKPEDGKDNKLQV---ANQLSTSA 271          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Zebrafish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 56.9954 bits (136), Expect = 2.289e-8
Identity = 52/177 (29.38%), Postives = 78/177 (44.07%), Query Frame = 3
Query:  258 NLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQ 788
            N+ ++  L +  SLT + + NN I RI+ L++L NLT L +  NKI  +EGL     LQ+                           LS+ N   N +  IE L  L+ L+ L   +N I  + E    L  F  L  L L  NPIC   +Y+  V   +  L  LD + + + +R+
Sbjct:   45 NILKIYHLWSFSSLTKLQLDNNAIERIEGLENLTNLTWLDLSFNKIEVIEGLQTLVKLQD---------------------------LSLFN---NRISVIENLDTLQRLQVLSLGNNSIAQL-ENVIYLRRFQSLRTLNLAGNPICEEDRYKTFVSAYLPELVYLDYRLLDEQTRE 190          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Zebrafish
Match: lrrc9 (leucine rich repeat containing 9 [Source:ZFIN;Acc:ZDB-GENE-080917-56])

HSP 1 Score: 54.6842 bits (130), Expect = 4.656e-8
Identity = 59/205 (28.78%), Postives = 97/205 (47.32%), Query Frame = 3
Query:  198 SISREIGL--CKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQ-----PNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQF 791
            SIS   GL  C  L  L++ +  L+E+  L  C  L  +++ +NNI +I +L+ L NL  L++  N+I  ++GL     L+E+                       +++ + I   G+++D      P  NL+ L+ + NKI   KE  T L+    L  L L+     PNP+C L  Y   V+  + +L+ LD  D+  +SRQ 
Sbjct:   68 SISSIQGLEYCPLLRELWVVECKLNEISGLHNCLHLEKLFLYDNNIHQITNLEMLVNLCVLWLNKNQISDIQGLDSLVNLEEM-----------------------NLADNAIETLGHSLD------PNCNLQNLNLSGNKISSFKE-LTHLARLPRLRYLSLKDPQCIPNPVCLLYNYYIHVLYHMPNLQLLDTYDM--SSRQL 240          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Zebrafish
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 53.9138 bits (128), Expect = 1.409e-7
Identity = 55/203 (27.09%), Postives = 105/203 (51.72%), Query Frame = 3
Query:  153 LMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDG 761
            L KV  L+L + ++ SI+  +    +L +L L  N +  + +L +  SL  +++  N IT++ +L  L NLT L I  N+I  +EGL     L+ELY+ +  +   E L  + +        LS ++++ N +  IE +  L +LK+    DN+I++  +   + +A   L  + L+ NP+    +YR  +++ + S+  +D 
Sbjct:  148 LTKVKKLFLLHNKIASIAN-LDHLTSLQMLELGSNRIRVIENLDSLSSLESLFLGTNKITQLQNLDGLHNLTVLSIQSNRITKLEGLQNLVNLRELYLSHNGIEVMEGLENNKK--------LSTLDIAANRIKKIENISHLTDLKEFWMNDNQIENWADLDELKNA-KGLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA 340          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Zebrafish
Match: lrrc9 (leucine rich repeat containing 9 [Source:ZFIN;Acc:ZDB-GENE-080917-56])

HSP 1 Score: 53.5286 bits (127), Expect = 2.237e-7
Identity = 54/205 (26.34%), Postives = 94/205 (45.85%), Query Frame = 3
Query:  219 LCKNLTVLYLYDNNLSEMPDL--SACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVT--DTSRQFLLKWKANKDA 821
            L  +L VL+L  N +S + +L  S   +L  +++Q N+I+++D L  L  L +L +  N+I  +                +N   G+ +L D             +++  N +  +  L+PL  L++L    NKI DI E    L     L  L +  NP+     +R  VI+ +S+L+ LDG  V+  + +R  LL  +A   +
Sbjct:  163 LMSSLEVLHLGHNGISNLINLQISRLTNLRALFLQGNDISQVDGLDGLQKLRELVLDRNRIKSLS---------------ENSFCGQAVLLD-------------LHLRENRIRELNHLQPLTGLRRLFLDMNKIQDISELEK-LETLPSLLELSVMGNPVTRRSLHRPPVILHLSTLQVLDGVTVSLEERTRAELLNNEAQSSS 338          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Xenopus
Match: tbcb (tubulin folding cofactor B [Source:Xenbase;Acc:XB-GENE-489743])

HSP 1 Score: 205.682 bits (522), Expect = 2.080e-63
Identity = 111/246 (45.12%), Postives = 170/246 (69.11%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIR-KPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKW 803
            MV+L +++++K+++  ++R + DE   Q+L ++THL   NK +D +  ++ +C+NLTVLYLYDN+++++ +L +  +LTH+Y+QNN I+ I++L  L  L KLY+G N +  VEGL     L+EL+IE Q L PGEKLLFDPRT+  + +SLSV+N+S NN+D +  L  L NL Q  A DN+I +IK+   +LS +  L R++L  N +C   KYRD VI+   +LE LDGK++ + +RQFLL W
Sbjct:    1 MVRLTVDLIMKNSN--ILRNRKDEPLAQHLRRITHLNFSNKNIDEVE-DLTMCRNLTVLYLYDNHINQIKNLGS--NLTHLYLQNNCISCIENLSGLKRLEKLYLGGNCLTVVEGLEGLGELRELHIENQRLPPGEKLLFDPRTLHFLRLSLSVLNISNNNIDELNDLAILVNLTQFVAADNQIKEIKDLELVLSKWTKLWRMDLSGNSVCLKPKYRDKVIIISKTLEILDGKEIKEMARQFLLNW 241          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Xenopus
Match: tbcb (tubulin folding cofactor B [Source:Xenbase;Acc:XB-GENE-489743])

HSP 1 Score: 206.453 bits (524), Expect = 8.640e-63
Identity = 111/246 (45.12%), Postives = 170/246 (69.11%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIR-KPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKW 803
            MV+L +++++K+++  ++R + DE   Q+L ++THL   NK +D +  ++ +C+NLTVLYLYDN+++++ +L +  +LTH+Y+QNN I+ I++L  L  L KLY+G N +  VEGL     L+EL+IE Q L PGEKLLFDPRT+  + +SLSV+N+S NN+D +  L  L NL Q  A DN+I +IK+   +LS +  L R++L  N +C   KYRD VI+   +LE LDGK++ + +RQFLL W
Sbjct:    1 MVRLTVDLIMKNSN--ILRNRKDEPLAQHLRRITHLNFSNKNIDEVE-DLTMCRNLTVLYLYDNHINQIKNLGS--NLTHLYLQNNCISCIENLSGLKRLEKLYLGGNCLTVVEGLEGLGELRELHIENQRLPPGEKLLFDPRTLHFLRLSLSVLNISNNNIDELNDLAILVNLTQFVAADNQIKEIKDLELVLSKWTKLWRMDLSGNSVCLKPKYRDKVIIISKTLEILDGKEIKEMARQFLLNW 241          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Xenopus
Match: lrrc9 (leucine rich repeat containing 9 [Source:NCBI gene;Acc:780204])

HSP 1 Score: 68.5514 bits (166), Expect = 8.920e-12
Identity = 59/191 (30.89%), Postives = 95/191 (49.74%), Query Frame = 3
Query:  228 NLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISM--SLSVINVSGNNMDSI-EPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQ-----PNPICSLKKYRDLVIVTVSSLESLDGKDVTD 776
            NLT L L   N+  +  L +C  L  +++   ++++I  L   A+L KLY+ HN+I  +EGL     L+ L++    +            I G+ M  +L  +N++ N + SI E L P   L++L+ + NKI   KE  T L+    L  L L+     PNP+C L  Y   V+  +  L+ LD  DV++
Sbjct:   48 NLTQLILVGQNIHCIAGLESCHFLKELWITECHLSKIQGLHHCADLQKLYLYHNEISVIEGLENLLKLEVLWLNNNQI----------NVIEGLDMMQNLKELNLANNLIHSIGESLDPNVQLERLNLSGNKISSFKEL-TNLARLPSLMDLGLKDPQYSPNPVCLLCNYAIHVLYHIPQLQRLDTYDVSE 227          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Xenopus
Match: lrrc9 (leucine rich repeat containing 9 [Source:NCBI gene;Acc:780204])

HSP 1 Score: 68.5514 bits (166), Expect = 9.582e-12
Identity = 59/191 (30.89%), Postives = 95/191 (49.74%), Query Frame = 3
Query:  228 NLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISM--SLSVINVSGNNMDSI-EPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQ-----PNPICSLKKYRDLVIVTVSSLESLDGKDVTD 776
            NLT L L   N+  +  L +C  L  +++   ++++I  L   A+L KLY+ HN+I  +EGL     L+ L++    +            I G+ M  +L  +N++ N + SI E L P   L++L+ + NKI   KE  T L+    L  L L+     PNP+C L  Y   V+  +  L+ LD  DV++
Sbjct:   55 NLTQLILVGQNIHCIAGLESCHFLKELWITECHLSKIQGLHHCADLQKLYLYHNEISVIEGLENLLKLEVLWLNNNQI----------NVIEGLDMMQNLKELNLANNLIHSIGESLDPNVQLERLNLSGNKISSFKEL-TNLARLPSLMDLGLKDPQYSPNPVCLLCNYAIHVLYHIPQLQRLDTYDVSE 234          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Xenopus
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:448394])

HSP 1 Score: 62.003 bits (149), Expect = 5.334e-10
Identity = 51/207 (24.64%), Postives = 101/207 (48.79%), Query Frame = 3
Query:  147 QYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMS--LSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDG 761
            + L  +  LYL N ++  I    G    L +L L  N L  + +L + + L  +++  N IT++ +L+ L NLT L +  N++  +EGL     L+ELY+    +          + I G+  +  L+ ++++ N +  IE ++ L  L++    DN +++  +    LS    L  + L+ NP+    +YR  +++ + S+  +D 
Sbjct:  168 ESLSHLQRLYLVNNKISRIEN-FGTLTQLRLLELGSNRLRVIENLDSLRELDSLFLGKNKITKLQNLETLTNLTVLSVQSNRLTKIEGLQNLVNLRELYLSDNGI----------QVIEGLENNNKLTTLDLASNRIKRIENIKHLSELQEFWMNDNLVENWSDLEE-LSGAPGLQTVYLERNPLQKDAQYRRKIMLALPSVRQIDA 362          

HSP 2 Score: 51.2174 bits (121), Expect = 1.828e-6
Identity = 54/200 (27.00%), Postives = 100/200 (50.00%), Query Frame = 3
Query:  231 LTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYI---------------EYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIK------ETATILSAFNYLHRLELQPNPICSLKKY--RDLVIVTVSSLESLDG 761
            LT L LYDN + ++ +L   + L  + +  N + RI+ L+ L++L +LY+ +NKI  +E     T L+ L +               E  +L  G+  +   + +  ++ +L+V++V  N +  IE L+ L NL++L+ +DN I  I+      +  T+  A N + R+E     +  L+++   D ++   S LE L G
Sbjct:  129 LTELDLYDNQIRKIGNLETLRDLQILDLSFNLLRRIEGLESLSHLQRLYLVNNKISRIENFGTLTQLRLLELGSNRLRVIENLDSLRELDSLFLGKNKITKLQNLETLT-NLTVLSVQSNRLTKIEGLQNLVNLRELYLSDNGIQVIEGLENNNKLTTLDLASNRIKRIE-NIKHLSELQEFWMNDNLVENWSDLEELSG 326          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Mouse
Match: Ppp1r42 (protein phosphatase 1, regulatory subunit 42 [Source:MGI Symbol;Acc:MGI:1921138])

HSP 1 Score: 189.504 bits (480), Expect = 2.814e-57
Identity = 115/272 (42.28%), Postives = 178/272 (65.44%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDA--IDKKKEENKSKNVPVYLTA 878
            MV+L ++++ K+++ +   + +E+  Q L K+TH+   ++ +DSI  ++ LC+NL+VLYLYDN +S++ +L+   +LTH+Y+QNN I+ I++L  L  L KLY+G N I  +EGL     L+EL++E Q L  GEKLLFDPRT+  ++ SLS +N+S NN+D I+ L  L+NL  L A DN++  +K+   +L     L +++L  NP+C   KYRD +I+T  SLE LDGK++ D  RQFL+ WKA+KDA  I KK+          Y++ 
Sbjct:    1 MVRLTVDLIAKNSNLKP--RKEETLAQCLKKITHINFSDRNIDSID-DLSLCRNLSVLYLYDNRISQVTNLNYTTNLTHLYLQNNCISCIENLSSLKKLEKLYLGGNYIAVIEGLEGLEELRELHVESQRLPLGEKLLFDPRTLRSLAKSLSTLNISNNNIDDIKDLEILENLNHLIAVDNQLMHVKDLELLLKKLMKLWKMDLNGNPVCLKPKYRDKLILTSKSLEFLDGKEIKDMERQFLMNWKASKDAKKISKKRRSRSEDASNSYISG 269          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Mouse
Match: Ppp1r42 (protein phosphatase 1, regulatory subunit 42 [Source:MGI Symbol;Acc:MGI:1921138])

HSP 1 Score: 189.119 bits (479), Expect = 5.154e-56
Identity = 114/258 (44.19%), Postives = 175/258 (67.83%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDA--IDKKK 836
            MV+L ++++ K+++ +   + +E+  Q L K+TH+   ++ +DSI  ++ LC+NL+VLYLYDN +S++ +L+   +LTH+Y+QNN I+ I++L  L  L KLY+G N I  +EGL     L+EL++E Q L  GEKLLFDPRT+  ++ SLS +N+S NN+D I+ L  L+NL  L A DN++  +K+   +L     L +++L  NP+C   KYRD +I+T  SLE LDGK++ D  RQFL+ WKA+KDA  I KK+
Sbjct:    1 MVRLTVDLIAKNSNLKP--RKEETLAQCLKKITHINFSDRNIDSID-DLSLCRNLSVLYLYDNRISQVTNLNYTTNLTHLYLQNNCISCIENLSSLKKLEKLYLGGNYIAVIEGLEGLEELRELHVESQRLPLGEKLLFDPRTLRSLAKSLSTLNISNNNIDDIKDLEILENLNHLIAVDNQLMHVKDLELLLKKLMKLWKMDLNGNPVCLKPKYRDKLILTSKSLEFLDGKEIKDMERQFLMNWKASKDAKKISKKR 255          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Mouse
Match: Ppp1r42 (protein phosphatase 1, regulatory subunit 42 [Source:MGI Symbol;Acc:MGI:1921138])

HSP 1 Score: 105.531 bits (262), Expect = 7.001e-27
Identity = 63/148 (42.57%), Postives = 103/148 (69.59%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGIS 512
            MV+L ++++ K+++ +   + +E+  Q L K+TH+   ++ +DSI  ++ LC+NL+VLYLYDN +S++ +L+   +LTH+Y+QNN I+ I++L  L  L KLY+G N I  +EGL     L+EL++E Q L  GEKLLFDPRT+  ++
Sbjct:    1 MVRLTVDLIAKNSNLK--PRKEETLAQCLKKITHINFSDRNIDSID-DLSLCRNLSVLYLYDNRISQVTNLNYTTNLTHLYLQNNCISCIENLSSLKKLEKLYLGGNYIAVIEGLEGLEELRELHVESQRLPLGEKLLFDPRTLRSLA 145          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Mouse
Match: Ppp1r42 (protein phosphatase 1, regulatory subunit 42 [Source:MGI Symbol;Acc:MGI:1921138])

HSP 1 Score: 65.4698 bits (158), Expect = 4.168e-13
Identity = 29/53 (54.72%), Postives = 39/53 (73.58%), Query Frame = 3
Query:  663 LHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDA 821
            L +++L  NP+C   KYRD +I+T  SLE LDGK++ D  RQFL+ WKA+KDA
Sbjct:    7 LWKMDLNGNPVCLKPKYRDKLILTSKSLEFLDGKEIKDMERQFLMNWKASKDA 59          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Mouse
Match: Ppp1r42 (protein phosphatase 1, regulatory subunit 42 [Source:MGI Symbol;Acc:MGI:1921138])

HSP 1 Score: 64.3142 bits (155), Expect = 1.397e-12
Identity = 31/57 (54.39%), Postives = 41/57 (71.93%), Query Frame = 3
Query:  672 LELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDA--IDKKK 836
            ++L  NP+C   KYRD +I+T  SLE LDGK++ D  RQFL+ WKA+KDA  I KK+
Sbjct:   19 MDLNGNPVCLKPKYRDKLILTSKSLEFLDGKEIKDMERQFLMNWKASKDAKKISKKR 75          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. UniProt/SwissProt
Match: sp|Q5PPX0|PPR42_XENLA (Protein phosphatase 1 regulatory subunit 42 OS=Xenopus laevis OX=8355 GN=ppp1r42 PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 4.449e-66
Identity = 117/260 (45.00%), Postives = 182/260 (70.00%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIR-KPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEEN 845
            MV+L +++++K+++  V+R + DES  ++L ++THL   NK +D +  ++ +C+NLTVLYLYDNN++++ +L +  +LTH+Y+QNN I+ I++L  L  L KLY+G N +  VEGL     L+EL+IE Q L PGEKLLFDPRT+  + +SLSV+N+S NN+D ++ L  L+NL Q  A DN++ +IK+   +LS +  L R++L  NP+C   KYR+ V +   +LE LDGK++ + +RQFLL WKA++ +  KK  EN
Sbjct:    1 MVRLTVDLVMKNSN--VLRNRKDESLARHLRRITHLNFSNKNIDEVE-DLTMCRNLTVLYLYDNNINQIKNLGS--NLTHLYLQNNCISCIENLSGLKRLEKLYLGGNCLTVVEGLEGLRELRELHIENQRLPPGEKLLFDPRTLHFLGISLSVLNISNNNIDELKDLAVLENLTQFVAADNQLKEIKDLEFVLSKWTKLCRMDLSGNPVCLKPKYREKVTIISKTLEILDGKEIKEMARQFLLNWKASRISKKKKNLEN 255          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. UniProt/SwissProt
Match: sp|Q6GQN5|PPR42_DANRE (Protein phosphatase 1 regulatory subunit 42 OS=Danio rerio OX=7955 GN=ppp1r42 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.598e-64
Identity = 112/252 (44.44%), Postives = 165/252 (65.48%), Query Frame = 3
Query:  144 EQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSS 899
            +QYL K+THL   +K ++ I  ++ +C+NLTVLYLYDN +S++ +L    +LTH+Y+QNNNI+ I++L  L  L+KL++G N I  VEGL     L+EL++E Q L  GEKL FDP +I  +S +L ++N+S NN+D +  L PL+ +  L A DN++ DI+E  T+ S +  L  L+L  NP+C   KYRD +I     L+ LDGK + + SRQFL+ WKA+KDA  KK E+ K   + V   AN++  S+
Sbjct:   25 QQYLRKLTHLNFSDKNIEEID-DLSVCRNLTVLYLYDNQISQICNLGFASNLTHLYMQNNNISCIENLSSLHKLSKLFLGGNSITVVEGLEELKSLKELHVEGQKLPCGEKLAFDPHSISSLSETLCILNISKNNIDELWDLAPLRKMTHLFAADNQLHDIQELETVFSQWFKLRLLDLSRNPVCHKPKYRDRLITVCKFLDDLDGKQINELSRQFLINWKASKDA-KKKPEDGKDNKLQV---ANQLSTSA 271          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. UniProt/SwissProt
Match: sp|Q4R803|PPR42_MACFA (Protein phosphatase 1 regulatory subunit 42 OS=Macaca fascicularis OX=9541 GN=PPP1R42 PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 6.565e-62
Identity = 110/251 (43.82%), Postives = 172/251 (68.53%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDA 821
            MV+L ++++ ++++ +   + +E+  Q L K+TH+   +K +D+I  ++ LCKNL+VLYLYDN +S++ +L+   +LTH+Y+QNN I  I++L+ L  L KLY+G N I  +EGL     L+EL++E Q L  GEKLLFDPRT+  ++ SLS++N+S NN+D I  L  L+NL QL A DN++  +K+   +L+    L +++L  NP+C   KYRD +I+   SLE LDGK++ +  RQFL+ WKA+KDA
Sbjct:    1 MVRLTLDLIARNSNLK--PRKEETISQCLKKITHINFSDKNIDAI-EDLSLCKNLSVLYLYDNCISQITNLNYATNLTHLYLQNNCIPCIENLRSLKKLEKLYLGGNYIAVIEGLEGLGELRELHVENQRLPLGEKLLFDPRTLHSLAKSLSILNISNNNIDDIRDLEILENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKPKYRDRLILVSKSLEFLDGKEIKNIERQFLMNWKASKDA 248          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. UniProt/SwissProt
Match: sp|Q7Z4L9|PPR42_HUMAN (Protein phosphatase 1 regulatory subunit 42 OS=Homo sapiens OX=9606 GN=PPP1R42 PE=2 SV=3)

HSP 1 Score: 192.971 bits (489), Expect = 3.298e-57
Identity = 109/251 (43.43%), Postives = 172/251 (68.53%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDA 821
            MV+L ++++ ++++ +   + +E+  Q L K+TH+   +K +D+I  ++ LCKNL+VLYLYDN +S++ +L+   +LTH+Y+QNN I+ I++L+ L  L KLY+G N I  +EGL     L+EL++E Q L  GEKLLFDPRT+  ++ SL ++N+S NN+D I  L  L+NL QL A DN++  +K+   +L+    L +++L  NP+C   KYRD +I+   SLE LDGK++ +  RQFL+ WKA+KDA
Sbjct:    1 MVRLTLDLIARNSNLK--PRKEETISQCLKKITHINFSDKNIDAI-EDLSLCKNLSVLYLYDNCISQITNLNYATNLTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAVIEGLEGLGELRELHVENQRLPLGEKLLFDPRTLHSLAKSLCILNISNNNIDDITDLELLENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKPKYRDRLILVSKSLEFLDGKEIKNIERQFLMNWKASKDA 248          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. UniProt/SwissProt
Match: sp|Q8R1Z4|PPR42_MOUSE (Protein phosphatase 1 regulatory subunit 42 OS=Mus musculus OX=10090 GN=Ppp1r42 PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 3.605e-55
Identity = 114/258 (44.19%), Postives = 175/258 (67.83%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDA--IDKKK 836
            MV+L ++++ K+++ +   + +E+  Q L K+TH+   ++ +DSI  ++ LC+NL+VLYLYDN +S++ +L+   +LTH+Y+QNN I+ I++L  L  L KLY+G N I  +EGL     L+EL++E Q L  GEKLLFDPRT+  ++ SLS +N+S NN+D I+ L  L+NL  L A DN++  +K+   +L     L +++L  NP+C   KYRD +I+T  SLE LDGK++ D  RQFL+ WKA+KDA  I KK+
Sbjct:    1 MVRLTVDLIAKNSNLKP--RKEETLAQCLKKITHINFSDRNIDSID-DLSLCRNLSVLYLYDNRISQVTNLNYTTNLTHLYLQNNCISCIENLSSLKKLEKLYLGGNYIAVIEGLEGLEELRELHVESQRLPLGEKLLFDPRTLRSLAKSLSTLNISNNNIDDIKDLEILENLNHLIAVDNQLMHVKDLELLLKKLMKLWKMDLNGNPVCLKPKYRDKLILTSKSLEFLDGKEIKDMERQFLMNWKASKDAKKISKKR 255          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. TrEMBL
Match: A0A2R2MU10 (protein phosphatase 1 regulatory subunit 42 OS=Lingula unguis OX=7574 GN=LOC106168157 PE=4 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 7.953e-83
Identity = 136/262 (51.91%), Postives = 187/262 (71.37%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSK 854
            MVKL M+++ + TSG   +K DES + YL ++THLYLE++ +D I  ++ +C+NLTVLYLYDN L ++P L   Q+LTH+Y+QNN+ITR+++L  L  LTKLY+G N I  VEGL    MLQE +IE QNL PGEKLLFDPR++  +SM L V+NVSGNN+DSI  L  L+ L Q+ A DN ++D++E   +L+A+  L RLEL  NP+C   KYRD VIV    LE LDGK+++D +RQFL  W+A+K+    K+ +N S+
Sbjct:    1 MVKLTMDMIARCTSGYTKKKRDESMQHYLKRLTHLYLEDRNIDDIGDDLAMCRNLTVLYLYDNKLPKVPVLLQNQNLTHLYLQNNHITRMENLAPLRRLTKLYLGGNSITVVEGLEKLDMLQEFHIENQNLPPGEKLLFDPRSLKTLSMCLQVLNVSGNNLDSIRELECLRELTQIMANDNNLNDMRELGHLLTAWRSLWRLELIGNPMCHKSKYRDRVIVMAHRLEILDGKEISDNARQFLENWQASKE----KRRDNLSR 258          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. TrEMBL
Match: A0A210R0A2 (Protein phosphatase 1 regulatory subunit 42 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08621 PE=4 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 9.076e-83
Identity = 138/303 (45.54%), Postives = 197/303 (65.02%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNP---QTRNIGTGRYSGNFIRPFSV 968
            MVKL ++++ + TSG   +K DES +QYL ++THLYLE++ +D +  +IG+C+NLTVLYLYDN L+ +P L    +LT +Y+QNN+I ++++L  L  L KLY+G N I  +EGL     LQEL++E Q L PGEKLLFDPR++ GI++SL V+NVSGN +DSI  +  L+N+ Q  A DN++ D+K+ A     +  L RLEL  NP+C   KYRD +IV   +LE LDGK++T+TSRQFL KW ANK+   KK++E   ++    L     R S   P    TR + + +  G  +  F  
Sbjct:    1 MVKLTLDLIARGTSGYTKKKRDESMQQYLKRLTHLYLEDRSIDDVGDDIGMCRNLTVLYLYDNQLNRIPSLHHNMNLTMLYLQNNDICKVENLAPLTRLQKLYLGGNCITVLEGLDKMDKLQELHVENQRLPPGEKLLFDPRSLRGIALSLQVLNVSGNGLDSIRDMIGLRNVSQFMANDNELSDMKDLAHNFGNWPVLWRLELMGNPVCHKAKYRDRIIVMAKTLEVLDGKEITETSRQFLRKWHANKETQKKKRDEIYQRSAYTDLGDGHQRSSELPPVKDPTRPVKSSQIPGYMMPGFEA 303          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. TrEMBL
Match: R7VI33 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_90529 PE=4 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 2.907e-82
Identity = 131/265 (49.43%), Postives = 184/265 (69.43%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVP 863
            MV+L M+++ + TSG   +K DE  + YL ++THLYLE K +D I  ++  C+NLTVLYLYDN LS +P+L+   +LTH+Y+QNN I++++ L  L  L+KLYIG+N I  +EGL   T +QEL++E Q L  GEKLLFDPR++  +S SL V+NV+GN +DS++ L  L  L Q    DN++ DIKE A  L++  +L RL+L  NP+C+  KYRD VI+   SLE LDGK++TDT+RQFL  W+ANK+A+ K+KE       P
Sbjct:    1 MVRLTMDLISRGTSGYTKKKRDEDIQHYLKRLTHLYLEGKFIDEIGDDLSSCRNLTVLYLYDNKLSHIPNLNQNFNLTHLYLQNNFISKMESLSGLPKLSKLYIGNNNITVIEGLDKLTCIQELHVENQKLPLGEKLLFDPRSLSALSRSLQVLNVTGNRLDSLQDLFSLTELMQFSVADNQLSDIKELAHFLTSNRHLWRLDLSGNPVCNKSKYRDRVIIMSPSLEVLDGKEITDTARQFLTSWQANKEAVKKRKESAVHSGGP 265          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. TrEMBL
Match: A0A2C9JM05 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106059566 PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 3.423e-79
Identity = 137/295 (46.44%), Postives = 196/295 (66.44%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSK-----NVPVYLTANEMRFSSSNPQTRNIGTGRY 938
            MVKL++ ++ ++TSG   +K DE+  Q++ ++TH+YLENK +D +   + LC+NLTVLYLYDN+L+ +P L+    LTH+Y+QNNNI+ I+HL  L +L KL+IG N I  VEGL     LQEL+IE Q L  GE+LLFDPRT+  +  +L V+NVSGN++ S+  L+ L NL  L A +N+++D+KE   +L  + +L +L+L  NP+C   KY+D VIV   +LE LDGK +TDT+RQFL+ W+AN+D   KK EE + +     + P   T  E+    S P TR  G G Y
Sbjct:    1 MVKLSLELIARATSGYTKKKKDETLPQFVGRLTHIYLENKNIDDVGDCLSLCRNLTVLYLYDNHLNNIPCLANSSGLTHLYLQNNNISIIEHLSSLQHLQKLFIGGNTITVVEGLEKLDKLQELHIENQRLPIGEQLLFDPRTLQALGTNLQVLNVSGNHLTSLSDLKQLPNLTHLMAAENELNDMKELTQLLVLWTFLTKLDLSGNPLCQRTKYKDRVIVLGKNLEMLDGKSITDTARQFLVNWQANRDENRKKLEEIRIREDSFASFPNTYTGTELPPLKSIP-TRLKGVGGY 294          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. TrEMBL
Match: A0A2C9JLY8 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106059566 PE=4 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 4.370e-79
Identity = 137/295 (46.44%), Postives = 196/295 (66.44%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSK-----NVPVYLTANEMRFSSSNPQTRNIGTGRY 938
            MVKL++ ++ ++TSG   +K DE+  Q++ ++TH+YLENK +D +   + LC+NLTVLYLYDN+L+ +P L+    LTH+Y+QNNNI+ I+HL  L +L KL+IG N I  VEGL     LQEL+IE Q L  GE+LLFDPRT+  +  +L V+NVSGN++ S+  L+ L NL  L A +N+++D+KE   +L  + +L +L+L  NP+C   KY+D VIV   +LE LDGK +TDT+RQFL+ W+AN+D   KK EE + +     + P   T  E+    S P TR  G G Y
Sbjct:    1 MVKLSLELIARATSGYTKKKKDETLPQFVGRLTHIYLENKNIDDVGDCLSLCRNLTVLYLYDNHLNNIPCLANSSGLTHLYLQNNNISIIEHLSSLQHLQKLFIGGNTITVVEGLEKLDKLQELHIENQRLPIGEQLLFDPRTLQALGTNLQVLNVSGNHLTSLSDLKQLPNLTHLMAAENELNDMKELTQLLVLWTFLTKLDLSGNPLCQRTKYKDRVIVLGKNLEMLDGKSITDTARQFLVNWQANRDENRKKLEEIRIREDSFASFPNTYTGTELPPLKSIP-TRLKGVGGY 294          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Cavefish
Match: ppp1r42 (protein phosphatase 1 regulatory subunit 42 [Source:NCBI gene;Acc:103038876])

HSP 1 Score: 223.787 bits (569), Expect = 1.010e-69
Identity = 126/284 (44.37%), Postives = 184/284 (64.79%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRN 920
            MV+L M+++ KS+S    RK + S  QYL K+THL   NK +D I  ++ +C+NLTVLYLYDN ++++ +LS   +LTH+Y+QNN IT I++L  L +L+KL++G N I  VEGL     L+EL+IE Q L PGEKL+FDP TI+ +S SLSV+N++ NN+D I  L  L NL  L+A DN++ D++E   + S +  L+R++L+ NP+C   KYRD +I     LE LDGK++ + SRQFL+ WKA+K+A  K   E        Y  + +      +P  +N
Sbjct:    1 MVRLTMDLIAKSSSHLKNRK-NCSLPQYLKKLTHLNFSNKNIDDID-DLSMCRNLTVLYLYDNQITQICNLSFAANLTHLYLQNNQITHIENLSFLQSLSKLFLGGNSITVVEGLEQLKELRELHIESQRLPPGEKLIFDPCTILALSGSLSVLNINNNNIDEIHDLAVLNNLTHLYAADNQLQDMQELELVFSQWPQLNRMDLRGNPVCHKPKYRDRLITICRKLEDLDGKEINELSRQFLINWKASKEAKRKALSERIMTREITYPLSADFHLGPQHPSAQN 282          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Cavefish
Match: ppp1r42 (protein phosphatase 1 regulatory subunit 42 [Source:NCBI gene;Acc:103038876])

HSP 1 Score: 223.402 bits (568), Expect = 1.078e-69
Identity = 126/284 (44.37%), Postives = 184/284 (64.79%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRN 920
            MV+L M+++ KS+S    RK + S  QYL K+THL   NK +D I  ++ +C+NLTVLYLYDN ++++ +LS   +LTH+Y+QNN IT I++L  L +L+KL++G N I  VEGL     L+EL+IE Q L PGEKL+FDP TI+ +S SLSV+N++ NN+D I  L  L NL  L+A DN++ D++E   + S +  L+R++L+ NP+C   KYRD +I     LE LDGK++ + SRQFL+ WKA+K+A  K   E        Y  + +      +P  +N
Sbjct:    1 MVRLTMDLIAKSSSHLKNRK-NCSLPQYLKKLTHLNFSNKNIDDID-DLSMCRNLTVLYLYDNQITQICNLSFAANLTHLYLQNNQITHIENLSFLQSLSKLFLGGNSITVVEGLEQLKELRELHIESQRLPPGEKLIFDPCTILALSGSLSVLNINNNNIDEIHDLAVLNNLTHLYAADNQLQDMQELELVFSQWPQLNRMDLRGNPVCHKPKYRDRLITICRKLEDLDGKEINELSRQFLINWKASKEAKRKALSERIMTREITYPLSADFHLGPQHPSAQN 282          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Cavefish
Match: LRRC9 (leucine-rich repeat-containing protein 9-like [Source:NCBI gene;Acc:103026999])

HSP 1 Score: 67.3958 bits (163), Expect = 1.195e-11
Identity = 59/202 (29.21%), Postives = 99/202 (49.01%), Query Frame = 3
Query:  198 SISREIGL--CKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLEL-----QPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTS 782
            SI++  GL  C +L  L++ +  + E+  L  C  L  +++ +NNI++I  L+ L NL  L++ +N I  +EGL M   L+EL                       +++ ++I   GN++D         NL++L+ + NKI   KE  T L+  + L  L L     +PNP+C L  Y   ++  V +L+ LD  DVT  +
Sbjct:   68 SITQIQGLENCPSLRELWVVECQIEEISGLEKCLQLLKLFLYDNNISKISSLELLTNLQVLWLNNNIISEIEGLSMLGNLREL-----------------------NLADNLIESIGNSLDQN------TNLQKLNLSGNKISSFKEL-THLTRLSKLRELGLKDPQSRPNPVCMLCNYFTHILYHVPTLQRLDSYDVTSKA 239          

HSP 2 Score: 53.1434 bits (126), Expect = 4.231e-7
Identity = 47/166 (28.31%), Postives = 78/166 (46.99%), Query Frame = 3
Query:  294 SLTHIYVQNNNITRIDHLQ--DLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSV----INVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVT 773
            SL  +++  N I+ +  LQ   L NL  L++  N++  VEGL     LQEL ++   L          R +   S S       +++S N +  +  L  L  L+ LH  +NK+ D+ E    L A   L +L +  NP+     +R +V++ +  L+ LDG  +T
Sbjct: 1202 SLEVLHLGYNGISNLSELQLSRLTNLKSLFLQGNEMVQVEGLEGLRRLQELVLDRNRL----------RCVSANSFSAQAALLELHMSDNRLRDLSHLHTLSQLRSLHLDNNKVQDLSELEK-LDALPSLIKLSVLGNPVARRCLHRPVVVLRLPGLQVLDGISIT 1356          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Cavefish
Match: LRRC9 (leucine-rich repeat-containing protein 9-like [Source:NCBI gene;Acc:103026999])

HSP 1 Score: 67.3958 bits (163), Expect = 1.242e-11
Identity = 59/202 (29.21%), Postives = 99/202 (49.01%), Query Frame = 3
Query:  198 SISREIGL--CKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLEL-----QPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTS 782
            SI++  GL  C +L  L++ +  + E+  L  C  L  +++ +NNI++I  L+ L NL  L++ +N I  +EGL M   L+EL                       +++ ++I   GN++D         NL++L+ + NKI   KE  T L+  + L  L L     +PNP+C L  Y   ++  V +L+ LD  DVT  +
Sbjct:   68 SITQIQGLENCPSLRELWVVECQIEEISGLEKCLQLLKLFLYDNNISKISSLELLTNLQVLWLNNNIISEIEGLSMLGNLREL-----------------------NLADNLIESIGNSLDQN------TNLQKLNLSGNKISSFKEL-THLTRLSKLRELGLKDPQSRPNPVCMLCNYFTHILYHVPTLQRLDSYDVTSKA 239          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Cavefish
Match: LRRC9 (leucine-rich repeat-containing protein 9-like [Source:NCBI gene;Acc:103026999])

HSP 1 Score: 67.3958 bits (163), Expect = 1.313e-11
Identity = 59/202 (29.21%), Postives = 99/202 (49.01%), Query Frame = 3
Query:  198 SISREIGL--CKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLEL-----QPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTS 782
            SI++  GL  C +L  L++ +  + E+  L  C  L  +++ +NNI++I  L+ L NL  L++ +N I  +EGL M   L+EL                       +++ ++I   GN++D         NL++L+ + NKI   KE  T L+  + L  L L     +PNP+C L  Y   ++  V +L+ LD  DVT  +
Sbjct:   68 SITQIQGLENCPSLRELWVVECQIEEISGLEKCLQLLKLFLYDNNISKISSLELLTNLQVLWLNNNIISEIEGLSMLGNLREL-----------------------NLADNLIESIGNSLDQN------TNLQKLNLSGNKISSFKEL-THLTRLSKLRELGLKDPQSRPNPVCMLCNYFTHILYHVPTLQRLDSYDVTSKA 239          

HSP 2 Score: 52.7582 bits (125), Expect = 5.014e-7
Identity = 47/166 (28.31%), Postives = 78/166 (46.99%), Query Frame = 3
Query:  294 SLTHIYVQNNNITRIDHLQ--DLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSV----INVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVT 773
            SL  +++  N I+ +  LQ   L NL  L++  N++  VEGL     LQEL ++   L          R +   S S       +++S N +  +  L  L  L+ LH  +NK+ D+ E    L A   L +L +  NP+     +R +V++ +  L+ LDG  +T
Sbjct: 1202 SLEVLHLGYNGISNLSELQLSRLTNLKSLFLQGNEMVQVEGLEGLRRLQELVLDRNRL----------RCVSANSFSAQAALLELHMSDNRLRDLSHLHTLSQLRSLHLDNNKVQDLSELEK-LDALPSLIKLSVLGNPVARRCLHRPVVVLRLPGLQVLDGISIT 1356          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Sea Lamprey
Match: ppp1r42 (protein phosphatase 1, regulatory subunit 42 [Source:NCBI gene;Acc:431749])

HSP 1 Score: 206.068 bits (523), Expect = 6.575e-65
Identity = 98/211 (46.45%), Postives = 148/211 (70.14%), Query Frame = 3
Query:  210 EIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEE 842
            ++  C+NL VLYLYDN LS MP+L+    LTH+Y+QNN + R++ L  L +L+KLY+G N I  VEG+ M + L EL++E Q+L PGEKLLFDPR +  ++ SL V+NVSGN ++ ++ L  L ++ Q  A +N++ D+++ A +L+ +  + RLEL  NP C   KYRD VI+  +SL+ LDGK++ +++RQFLL WKA+++A  K  E+
Sbjct:    2 DLSACRNLAVLYLYDNRLSRMPNLAFASHLTHLYLQNNALERMEGLATLRHLSKLYLGGNSISVVEGVEMLSELTELHLENQHLPPGEKLLFDPRCLSTLAGSLCVLNVSGNGLEELQELTCLSHMMQFMACENQLTDLQDLADVLTCWPKVWRLELLGNPFCQKPKYRDRVIMMSASLDILDGKEIKESARQFLLNWKASREAKRKAHEQ 212          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006793.1 (pep scaffold:Pmarinus_7.0:GL478186:28720:41038:-1 gene:ENSPMAG00000006137.1 transcript:ENSPMAT00000006793.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 4.960e-11
Identity = 49/195 (25.13%), Postives = 80/195 (41.03%), Query Frame = 3
Query:  207 REIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLEL----QPNPICSLKKYRDLVIVTVSSLESLDGKDVTDT 779
            R++ L   L  + L+ N ++ +  L     L H+ + +N + RI+ L  LA L  L +  N +  V+GL     +  L + Y                        + ++ G+ +  +    P   L  L A  N++ D+      L   + L  L L    Q NP+C +  YR+ V   V SL+SLDG D   T
Sbjct:    5 RDVPLHSRLRAVNLHCNQIARLEGLGRLPQLAHLDLSSNRLERIEGLASLACLRTLNLSCNHLTSVQGLQGLACMHWLNVSYNR----------------------ITDLVGSGLRDLHG--PDYQLSHLEAHGNRLADVDALVAALGGLHCLSVLVLRKDGQANPVCRVTGYRERVFEAVLSLQSLDGHDALGT 175          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Sea Lamprey
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 60.077 bits (144), Expect = 2.671e-10
Identity = 44/183 (24.04%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  213 IGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDG 761
            I   KNL  L++  N ++++ +L +  +LT + +Q+N IT+I+ L  L NL +LY+ HN I  +EGL  N                                L+ ++++ N +  IE +  L  L++    DN+I +  +   + +A   L  + L+ NP+    +YR  +++ +  +  +D 
Sbjct:  184 IETLKNLDSLFIGKNKITKLQNLDSLTNLTVLSIQSNRITKIEGLSSLVNLQELYLSHNGIEVIEGLENNK------------------------------KLTTLDIAANRVRRIENVGHLTELQEFWMNDNQISNWNDVDELKNARG-LQTVYLERNPLQRDPQYRRKIMLALPWVRQIDA 335          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Sea Lamprey
Match: LRRC9 (leucine rich repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:19848])

HSP 1 Score: 58.5362 bits (140), Expect = 1.443e-9
Identity = 51/194 (26.29%), Postives = 92/194 (47.42%), Query Frame = 3
Query:  225 KNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFD--PRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICS-LKKYRDLVIVTVSSLESLDGKDV----TDTSR 785
            + +T L L    L+ +  L   +SL      +N + R+D L+    L +L + HN++  + GLH  T L  L I+   L+  E    +  PR        L+ ++ + N + S+  L+   +L +L+   N +   ++   I      L  L+L  NP+ S +++YR  VI  + +L++LDG  V     D++R
Sbjct:  350 RKVTSLCLDGLGLTRLAGLERMESLRWASFCHNELCRLDGLEGCLQLAELSVDHNRLGTLHGLHHMTKLVTLSIDCNELVGLEDAGLEGMPR--------LARLSAASNRLASLAGLQRCSSLAELYVASNHLASSRDVYRI-KGLTSLVILDLHGNPLASTMEQYRLFVIFHLPALKALDGNAVEVAECDSAR 534          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Sea Lamprey
Match: LRRC9 (leucine rich repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:19848])

HSP 1 Score: 58.151 bits (139), Expect = 1.835e-9
Identity = 53/205 (25.85%), Postives = 96/205 (46.83%), Query Frame = 3
Query:  177 LENKQLDSISREIGL----CKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFD--PRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICS-LKKYRDLVIVTVSSLESLDGKDV 770
            LE++++  + R   L       +T L L    L+ +  L   +SL      +N + R+D L+    L +L + HN++  + GLH  T L  L I+   L+  E    +  PR        L+ ++ + N + S+  L+   +L +L+   N +   ++   I      L  L+L  NP+ S +++YR  VI  + +L++LDG  V
Sbjct:  317 LESRRMGRVERTGDLQPTWYSQVTSLCLDGLGLTRLAGLERMESLRWASFCHNELCRLDGLEGCLQLAELSVDHNRLGTLHGLHHMTKLVTLSIDCNELVGLEDAGLEGMPR--------LARLSAASNRLASLAGLQRCSSLAELYVASNHLASSRDVYRI-KGLTSLVILDLHGNPLASTMEQYRLFVIFHLPALKALDGNAV 512          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Nematostella
Match: EDO47417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLZ8])

HSP 1 Score: 237.654 bits (605), Expect = 1.354e-76
Identity = 121/259 (46.72%), Postives = 180/259 (69.50%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEEN 845
            M ++ M +L KS      +K DES++ YL ++THLYL  K +D I   + +CKNL+VLYLYDNN+S++ +L    +LTH+Y+QNN I+RI+ L     L+KLY+G N I  +EGL     L+EL++E Q+L PGEKLLFDPRT+  +S  L V+N+S NN+DSI+ L+ L N+ Q     N + D+KE + +++A+ YL RLE+  NP+C  KKYRD +IV  +SL  LDGK++  T+++FL+ WKANKDA  ++++++
Sbjct:    1 MGRITMEMLSKSHH-HTKKKRDESNQHYLKRLTHLYLAEKGIDEID-NLSMCKNLSVLYLYDNNISKIKNLGFAGNLTHLYLQNNKISRIEGLDHCRRLSKLYLGGNSITVIEGLDKLENLRELHMEKQHLPPGEKLLFDPRTLQALSKCLCVLNISENNIDSIDELQCLTNMTQFFTEHNLLADMKELSRVMAAWPYLWRLEVSGNPLCQKKKYRDRIIVMSNSLVMLDGKEINATAKRFLMNWKANKDARKRQRKQH 257          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 60.077 bits (144), Expect = 3.369e-10
Identity = 46/156 (29.49%), Postives = 84/156 (53.85%), Query Frame = 3
Query:  228 NLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPI 695
            NL +L L  N +  + +L++   L  +Y+  N I RI+ L+ L  LT + +G NKI  +EGL   T L+ L++       G+  + + + + G+  SL V+++  N +  ++ L  L +L++L+ + N I++IK     L +   L+ L+L  N I
Sbjct:   94 NLRILDLSFNVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLESLFV-------GKNKITELQNLSGLC-SLKVLSIQSNRIVELKGLEHLDSLEELYISHNGIEEIKG----LESLTKLNTLDLASNRI 237          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Nematostella
Match: EDO35299 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLU3])

HSP 1 Score: 57.7658 bits (138), Expect = 2.483e-9
Identity = 56/197 (28.43%), Postives = 91/197 (46.19%), Query Frame = 3
Query:  183 NKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVT 773
            + Q+ SI + + L  NL  L L+ N++S++  L   Q+L H+ + +N I+ I+ L  L  L  L +  N+I+ VEGL     L +L + Y N +     L D   + G   SL+ + + GN + S+E           H   + I  I      L  +        + N +C++  YRD V+  +  L  LDG D T
Sbjct:   21 DSQITSI-KSLKLHSNLVTLNLHSNHISKIEGLQHLQNLRHLDLSSNQISHIEGLTSLGYLRVLNLSCNRIYLVEGLENLRKLTKLDLSY-NFIENVSGLKD---LHGNGYSLTTLYLHGNRIASLE-----------HFISSVIGCISLKELTLQMYG-------EGNHVCNVSGYRDGVLSAMPGLAVLDGYDRT 194          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Nematostella
Match: EDO31770 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ7])

HSP 1 Score: 54.6842 bits (130), Expect = 3.561e-8
Identity = 36/94 (38.30%), Postives = 55/94 (58.51%), Query Frame = 3
Query:  162 VTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFV-EGLHMNTMLQEL 440
            +T L +    L  +S  I  C NL  +Y YDN++S++ +LS+   LT +++ NNNI  I+ L+ LA LT L +  NKI  + + L  NT L+ L
Sbjct:  109 LTELCVSESSLKELSG-IDKCTNLKKVYFYDNHISKIENLSSLTRLTVLWLNNNNIQAIEGLESLAQLTDLNLASNKITSIGDTLQRNTHLEVL 201          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Nematostella
Match: EDO45823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU3])

HSP 1 Score: 51.2174 bits (121), Expect = 1.482e-7
Identity = 44/163 (26.99%), Postives = 72/163 (44.17%), Query Frame = 3
Query:  300 THIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQ 788
            TH+ +   N+  ID+L+ L N+T LY+ HN I ++E L     LQ+L                           + + ++ N +  ++ L+ L  LK L  +DN I +   T    S    L  L LQ NP    + YR  ++  +  L+ LDG  +T+  R+
Sbjct:   14 THVRLDRENLKCIDNLECLGNVTNLYLQHNNIEYIENLET---LQQL---------------------------NFLTLASNKISEVKNLKCLNKLKFLDLSDNNITEFS-TDEFPSE---LLILNLQGNPCLQSENYRSCILKALPHLKQLDGATITNKDRR 142          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Medaka
Match: ppp1r42 (protein phosphatase 1 regulatory subunit 42 [Source:NCBI gene;Acc:101155473])

HSP 1 Score: 183.341 bits (464), Expect = 5.706e-55
Identity = 108/257 (42.02%), Postives = 170/257 (66.15%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKE 839
            MV L ++++ KS   +  ++   S  QYL  +THL+  NK ++ I  ++ +C NL+VLYLYDNN++++ +L    ++TH+Y+QNNNIT ID+L +L  L+ LY+G N+I  VEGL     L+EL++E Q L PGEKLLFD RT++ ++ +L ++N++ NN+D I  L  LKNL+   A  NK+  I+E   +L  +  L  L+L+ NP+C   KYRD +I    SLE  DG+ V++ +R+FLL WK ++  +++KK+
Sbjct:    1 MVSLTVDLISKSNHFK--KQRGISFAQYLKTLTHLHFSNKNIEEIG-DLSVCGNLSVLYLYDNNITQIRNLDFASNVTHLYMQNNNITHIDNLHNLRKLSNLYLGGNRIAAVEGLEQLHHLKELHLENQRLGPGEKLLFDSRTLLSLAETLCILNINNNNIDDITELSVLKNLQHFSAALNKLQSIEEIEEVLRLWPQLLLLDLRGNPVCKELKYRDRLITACKSLEMFDGRKVSEATRRFLL-WKKSRKHLEEKKQ 253          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Medaka
Match: ppp1r42 (protein phosphatase 1 regulatory subunit 42 [Source:NCBI gene;Acc:101155473])

HSP 1 Score: 182.57 bits (462), Expect = 1.283e-54
Identity = 108/257 (42.02%), Postives = 170/257 (66.15%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKE 839
            MV L ++++ KS   +  ++   S  QYL  +THL+  NK ++ I  ++ +C NL+VLYLYDNN++++ +L    ++TH+Y+QNNNIT ID+L +L  L+ LY+G N+I  VEGL     L+EL++E Q L PGEKLLFD RT++ ++ +L ++N++ NN+D I  L  LKNL+   A  NK+  I+E   +L  +  L  L+L+ NP+C   KYRD +I    SLE  DG+ V++ +R+FLL WK ++  +++KK+
Sbjct:    1 MVSLTVDLISKSNHFK--KQRGISFAQYLKTLTHLHFSNKNIEEIG-DLSVCGNLSVLYLYDNNITQIRNLDFASNVTHLYMQNNNITHIDNLHNLRKLSNLYLGGNRIAAVEGLEQLHHLKELHLENQRLGPGEKLLFDSRTLLSLAETLCILNINNNNIDDITELSVLKNLQHFSAALNKLQSIEEIEEVLRLWPQLLLLDLRGNPVCKELKYRDRLITACKSLEMFDGRKVSEATRRFLL-WKKSRKHLEEKKQ 253          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Medaka
Match: LRRC9 (leucine-rich repeat-containing protein 9 [Source:NCBI gene;Acc:101159959])

HSP 1 Score: 65.4698 bits (158), Expect = 5.882e-11
Identity = 61/211 (28.91%), Postives = 99/211 (46.92%), Query Frame = 3
Query:  150 YLMKVTHLYLENKQLDSISREIGL--CKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTD 776
            +  ++ HL + ++ ++ I    GL  C  L  +++    L E+  L  CQ L  +Y+ NN I  I +L    NL  L++ +N I  ++GL M   L+EL +   NL+       DP      ++SL ++N+SGN + S + L  L +L +L          KE A        L      PNP+C L  Y   V+  +  L+ LD  +V+D
Sbjct:   93 FFPRLCHLTIVDQTIEHIE---GLENCPLLQQIWIVQCRLREISGLQNCQKLEKLYLYNNQICEIQNLDLQVNLEVLWLNNNCITKIQGLDMLQNLKELNLA-DNLIEKIGNSLDP------NVSLEILNLSGNQISSFKELAQLAHLPRL----------KELA--------LKDPMSTPNPVCLLCNYATHVLYHIPGLQQLDSYNVSD 275          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 57.7658 bits (138), Expect = 7.515e-9
Identity = 45/179 (25.14%), Postives = 89/179 (49.72%), Query Frame = 3
Query:  231 LTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGI--SMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDG 761
            L +L L  N +  + +L    SLT +++  N I ++ +L  L NL+ L I  N+I  +EGL     L+ELY+ +  +            I G+  +  L+ ++++ N +  IE +  L  L++    DN+I++  +   + +A   L  + L+ NP+    +YR  +++ + S+  +D 
Sbjct:  174 LEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGI----------EVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNA-KSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA 341          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 57.7658 bits (138), Expect = 7.533e-9
Identity = 48/183 (26.23%), Postives = 90/183 (49.18%), Query Frame = 3
Query:  231 LTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKI------DDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDG 761
            L +L L  N +  + +L    SLT +++  N I ++ +L  L NL+ L I  N+I  +EGL     L+ELY+ +  +   E L  + +        L+ ++++ N +  IE +  L  L++    DN+I      D++K   ++ +   YL R  LQ +P     +YR  +++ + S+  +D 
Sbjct:  213 LEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKK--------LTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNAKSLETV--YLERNPLQKDP-----QYRRKIMLALPSVRQIDA 380          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Planmine SMEST
Match: SMESG000014888.1 (SMESG000014888.1)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 301/303 (99.34%), Postives = 301/303 (99.34%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRYSGNFIRPFSVSSK 977
            MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSA NYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRY GNFIRPFSVSSK
Sbjct:    1 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSALNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRYPGNFIRPFSVSSK 303          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Planmine SMEST
Match: SMESG000014888.1 (SMESG000014888.1)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 296/298 (99.33%), Postives = 296/298 (99.33%), Query Frame = 3
Query:   84 MNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRYSGNFIRPFSVSSK 977
            MNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSA NYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRY GNFIRPFSVSSK
Sbjct:    1 MNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSALNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRYPGNFIRPFSVSSK 298          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Planmine SMEST
Match: SMESG000014888.1 (SMESG000014888.1)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 291/295 (98.64%), Postives = 291/295 (98.64%), Query Frame = 3
Query:   69 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRYSGNFI 953
            MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSA NYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRY G  I
Sbjct:    1 MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSALNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRYPGKEI 295          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Planmine SMEST
Match: SMESG000014888.1 (SMESG000014888.1)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 286/290 (98.62%), Postives = 286/290 (98.62%), Query Frame = 3
Query:   84 MNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRYSGNFI 953
            MNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSA NYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRY G  I
Sbjct:    1 MNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSALNYLHRLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKDAIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRYPGKEI 290          
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Planmine SMEST
Match: SMESG000026105.1 (SMESG000026105.1)

HSP 1 Score: 54.299 bits (129), Expect = 5.784e-8
Identity = 50/168 (29.76%), Postives = 80/168 (47.62%), Query Frame = 3
Query:  228 NLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLHRLELQPNPICSLKKYRDLVIV 731
            NL++L L  N +  + ++     LT +Y  NN I  I++L  L N+  L +G N I  +E L   T L +LY+    +   E L F          +L+V+++ GN +  I+ L  L NL+QL+ + N I  I+     L     L  L+L  N I  ++    L I+
Sbjct:   92 NLSILDLSFNRIKLIENIDKLIKLTKLYFVNNKIRTIENLNSLVNIEMLELGSNSIKRIENLDSLTKLDQLYLGKNKISKLENLDF--------MKNLTVLSIQGNRITQIDGLDNLINLEQLYLSHNGISKIEN----LGNLTKLTTLDLSSNRISKVENLSHLKIL 247          

HSP 2 Score: 50.0618 bits (118), Expect = 1.394e-6
Identity = 41/146 (28.08%), Postives = 67/146 (45.89%), Query Frame = 3
Query:  186 KQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMSLSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDD 623
            + LDS+++       L  LYL  N +S++ +L   ++LT + +Q N IT+ID L +L NL +LY+ HN I  +E L                              G    L+ +++S N +  +E L  LK L++    DN + D
Sbjct:  151 ENLDSLTK-------LDQLYLGKNKISKLENLDFMKNLTVLSIQGNRITQIDGLDNLINLEQLYLSHNGISKIENL------------------------------GNLTKLTTLDLSSNRISKVENLSHLKILEEFWFNDNNLAD 259          

HSP 3 Score: 48.9062 bits (115), Expect = 3.323e-6
Identity = 32/103 (31.07%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  153 LMKVTHLYLENKQLDSISREIGLCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLTKLYIGHNKIHFVEGLHMNTMLQELYIEYQNL 461
            L K+  LYL   ++  +   +   KNLTVL +  N ++++  L    +L  +Y+ +N I++I++L +L  LT L +  N+I  VE L    +L+E +    NL
Sbjct:  156 LTKLDQLYLGKNKISKLEN-LDFMKNLTVLSIQGNRITQIDGLDNLINLEQLYLSHNGISKIENLGNLTKLTTLDLSSNRISKVENLSHLKILEEFWFNDNNL 257          
The following BLAST results are available for this feature:
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1R426.868e-5843.43protein phosphatase 1 regulatory subunit 42 [Sourc... [more]
PPP1R422.382e-4541.23protein phosphatase 1 regulatory subunit 42 [Sourc... [more]
LRRC92.898e-930.59leucine rich repeat containing 9 [Source:HGNC Symb... [more]
LRRC93.862e-930.59leucine rich repeat containing 9 [Source:HGNC Symb... [more]
PPP1R74.438e-926.14protein phosphatase 1 regulatory subunit 7 [Source... [more]
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sds-222.478e-931.76Protein phosphatase 1 regulatory subunit SDS22 hom... [more]
K10D2.84.572e-931.43pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
C06A8.61.224e-622.66pep chromosome:WBcel235:II:7772499:7773914:1 gene:... [more]
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sds221.584e-829.41gene:FBgn0028992 transcript:FBtr0083436[more]
dtr4.462e-727.75gene:FBgn0023090 transcript:FBtr0081516[more]
CG141859.257e-733.73gene:FBgn0036936 transcript:FBtr0074818[more]
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r423.442e-6544.44protein phosphatase 1, regulatory subunit 42 [Sour... [more]
drc32.289e-829.38dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
lrrc94.656e-828.78leucine rich repeat containing 9 [Source:ZFIN;Acc:... [more]
ppp1r71.409e-727.09protein phosphatase 1, regulatory (inhibitor) subu... [more]
lrrc92.237e-726.34leucine rich repeat containing 9 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbcb2.080e-6345.12tubulin folding cofactor B [Source:Xenbase;Acc:XB-... [more]
tbcb8.640e-6345.12tubulin folding cofactor B [Source:Xenbase;Acc:XB-... [more]
lrrc98.920e-1230.89leucine rich repeat containing 9 [Source:NCBI gene... [more]
lrrc99.582e-1230.89leucine rich repeat containing 9 [Source:NCBI gene... [more]
ppp1r75.334e-1024.64protein phosphatase 1 regulatory subunit 7 [Source... [more]
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp1r422.814e-5742.28protein phosphatase 1, regulatory subunit 42 [Sour... [more]
Ppp1r425.154e-5644.19protein phosphatase 1, regulatory subunit 42 [Sour... [more]
Ppp1r427.001e-2742.57protein phosphatase 1, regulatory subunit 42 [Sour... [more]
Ppp1r424.168e-1354.72protein phosphatase 1, regulatory subunit 42 [Sour... [more]
Ppp1r421.397e-1254.39protein phosphatase 1, regulatory subunit 42 [Sour... [more]
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5PPX0|PPR42_XENLA4.449e-6645.00Protein phosphatase 1 regulatory subunit 42 OS=Xen... [more]
sp|Q6GQN5|PPR42_DANRE2.598e-6444.44Protein phosphatase 1 regulatory subunit 42 OS=Dan... [more]
sp|Q4R803|PPR42_MACFA6.565e-6243.82Protein phosphatase 1 regulatory subunit 42 OS=Mac... [more]
sp|Q7Z4L9|PPR42_HUMAN3.298e-5743.43Protein phosphatase 1 regulatory subunit 42 OS=Hom... [more]
sp|Q8R1Z4|PPR42_MOUSE3.605e-5544.19Protein phosphatase 1 regulatory subunit 42 OS=Mus... [more]
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MU107.953e-8351.91protein phosphatase 1 regulatory subunit 42 OS=Lin... [more]
A0A210R0A29.076e-8345.54Protein phosphatase 1 regulatory subunit 42 OS=Miz... [more]
R7VI332.907e-8249.43Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2C9JM053.423e-7946.44Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9JLY84.370e-7946.44Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r421.010e-6944.37protein phosphatase 1 regulatory subunit 42 [Sourc... [more]
ppp1r421.078e-6944.37protein phosphatase 1 regulatory subunit 42 [Sourc... [more]
LRRC91.195e-1129.21leucine-rich repeat-containing protein 9-like [Sou... [more]
LRRC91.242e-1129.21leucine-rich repeat-containing protein 9-like [Sou... [more]
LRRC91.313e-1129.21leucine-rich repeat-containing protein 9-like [Sou... [more]
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r426.575e-6546.45protein phosphatase 1, regulatory subunit 42 [Sour... [more]
ENSPMAT00000006793.14.960e-1125.13pep scaffold:Pmarinus_7.0:GL478186:28720:41038:-1 ... [more]
ppp1r72.671e-1024.04protein phosphatase 1, regulatory (inhibitor) subu... [more]
LRRC91.443e-926.29leucine rich repeat containing 9 [Source:HGNC Symb... [more]
LRRC91.835e-925.85leucine rich repeat containing 9 [Source:HGNC Symb... [more]
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474171.354e-7646.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449373.369e-1029.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352992.483e-928.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317703.561e-838.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458231.482e-726.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r425.706e-5542.02protein phosphatase 1 regulatory subunit 42 [Sourc... [more]
ppp1r421.283e-5442.02protein phosphatase 1 regulatory subunit 42 [Sourc... [more]
LRRC95.882e-1128.91leucine-rich repeat-containing protein 9 [Source:N... [more]
ppp1r77.515e-925.14protein phosphatase 1 regulatory subunit 7 [Source... [more]
ppp1r77.533e-926.23protein phosphatase 1 regulatory subunit 7 [Source... [more]
back to top
BLAST of Protein phosphatase 1 regulatory subunit 42 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014888.10.000e+099.34SMESG000014888.1[more]
SMESG000014888.10.000e+099.33SMESG000014888.1[more]
SMESG000014888.10.000e+098.64SMESG000014888.1[more]
SMESG000014888.10.000e+098.62SMESG000014888.1[more]
SMESG000026105.15.784e-829.76SMESG000026105.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007403 ID=SMED30007403|Name=Protein phosphatase 1 regulatory subunit 42|organism=Schmidtea mediterranea sexual|type=transcript|length=1204bp
CTAGTACAATTATAAGCGCCTTTATCAAAATTCGAACGTATTAATTAAAT
AAATTATAATTATTTAAAATGGTTAAGCTTAATATGAATATTTTAATTAA
AAGCACTAGTGGCAGAGTGATTAGAAAACCGGATGAATCTCACGAACAAT
ATCTAATGAAAGTTACTCATTTGTATTTGGAAAATAAACAACTGGATTCG
ATTAGTAGAGAAATTGGATTGTGTAAAAATTTAACAGTTTTATATCTTTA
CGACAATAATTTGTCAGAGATGCCAGATTTAAGCGCTTGTCAATCGCTTA
CTCATATCTATGTTCAGAACAATAACATCACTAGAATTGATCATTTGCAA
GATTTAGCAAATCTTACTAAATTATACATTGGACACAATAAAATCCATTT
TGTTGAAGGCTTGCACATGAATACGATGTTACAGGAATTATATATTGAAT
ACCAAAATTTATTACCGGGAGAGAAATTGTTGTTCGATCCGAGAACGATT
ATGGGAATCTCAATGTCATTGTCAGTCATCAATGTCAGCGGCAACAACAT
GGACAGTATTGAACCGCTGAGGCCATTGAAAAATCTGAAGCAATTGCACG
CAACCGACAATAAAATTGATGACATCAAGGAAACGGCAACGATTCTCTCT
GCATTTAATTATCTGCACCGGCTGGAGTTGCAGCCGAATCCGATTTGCTC
CTTGAAGAAATATCGAGATTTAGTAATTGTCACTGTTTCTTCATTGGAGT
CACTCGATGGAAAAGATGTTACAGACACCTCTCGACAGTTCCTATTGAAA
TGGAAAGCCAATAAAGATGCAATCGACAAGAAGAAAGAGGAGAACAAATC
AAAGAATGTTCCAGTCTATTTGACAGCAAATGAAATGAGATTTTCATCCT
CCAATCCTCAGACTCGCAACATTGGGACGGGGAGGTATTCTGGGAATTTC
ATTCGGCCGTTTTCCGTGTCCTCCAAATGACCTTTTACCGGTGTGGCAGC
TGCTGATTTATTTTTTTTCTTTTAAGGTTGCTAATAGATGAAATAGTATA
TCACTATTTACTGGATTTTGTTTAAATATTCAATTATTTATATCACCTTA
TTTTTGGCATTTAGGAATTTGTGTAATATTCTTATTGGACTGTGTCAATA
TGTCAGATTTGGCCTGGAATAATGAGTTTAAAATATATTTTATCTTGTGG
AAGG
back to top

protein sequence of SMED30007403-orf-1

>SMED30007403-orf-1 ID=SMED30007403-orf-1|Name=SMED30007403-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=304bp
MVKLNMNILIKSTSGRVIRKPDESHEQYLMKVTHLYLENKQLDSISREIG
LCKNLTVLYLYDNNLSEMPDLSACQSLTHIYVQNNNITRIDHLQDLANLT
KLYIGHNKIHFVEGLHMNTMLQELYIEYQNLLPGEKLLFDPRTIMGISMS
LSVINVSGNNMDSIEPLRPLKNLKQLHATDNKIDDIKETATILSAFNYLH
RLELQPNPICSLKKYRDLVIVTVSSLESLDGKDVTDTSRQFLLKWKANKD
AIDKKKEENKSKNVPVYLTANEMRFSSSNPQTRNIGTGRYSGNFIRPFSV
SSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002056medial muscle cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR025875Leu-rich_rpt_4
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding
GO:0015631tubulin binding
GO:0070840dynein complex binding
Vocabulary: cellular component
TermDefinition
GO:0002177manchette
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0015630microtubule cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 96..117
e-value: 0.083
score: 22.0
coord: 52..73
e-value: 40.0
score: 10.6
coord: 74..95
e-value: 76.0
score: 8.4
coord: 170..191
e-value: 200.0
score: 5.0
NoneNo IPR availablePANTHERPTHR45973FAMILY NOT NAMEDcoord: 1..261
NoneNo IPR availablePANTHERPTHR45973:SF3PROTEIN PHOSPHATASE 1 REGULATORY SUBUNIT 42coord: 1..261
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 29..230
IPR025875Leucine rich repeat 4PFAMPF12799LRR_4coord: 75..111
e-value: 4.1E-7
score: 30.2
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 11..141
e-value: 1.3E-22
score: 81.6
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 142..240
e-value: 2.3E-18
score: 67.9
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 172..193
score: 6.372
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 54..75
score: 8.559
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 76..97
score: 7.835
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 98..119
score: 6.726
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 198..219
score: 5.856
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 31..52
score: 5.425
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 150..171
score: 7.458