Heterogeneous nuclear ribonucleoprotein L

Overview
NameHeterogeneous nuclear ribonucleoprotein L
Smed IDSMED30007400
Length (bp)2234
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heterogeneous nuclear ribonucleoprotein L (SMED30007400) t-SNE clustered cells

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein L (SMED30007400) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heterogeneous nuclear ribonucleoprotein L (SMED30007400) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein L (SMED30007400) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007400

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007400h1SMcG0013767 SmedASXL_013608SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Human
Match: HNRNPL (heterogeneous nuclear ribonucleoprotein L [Source:HGNC Symbol;Acc:HGNC:5045])

HSP 1 Score: 107.457 bits (267), Expect = 4.513e-29
Identity = 54/128 (42.19%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY L  + +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ++ +    +P I P ++   L +G+ ++KDFS   NNRF        N+I  P+  LHFFNAP
Sbjct:  383 VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYG-LEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP 509          

HSP 2 Score: 41.9726 bits (97), Expect = 4.513e-29
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   L   E +   +  + GV RP ++ +F+ K++  +   GL E+    D+L  L  LNH  +  P+    + LKL FS  +
Sbjct:  505 FFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSE--RSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ 586          

HSP 3 Score: 104.76 bits (260), Expect = 8.998e-23
Identity = 59/177 (33.33%), Postives = 97/177 (54.80%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L +  +++G ++ +  +      L+EF +   A   V  +     YI  H   + YS SQ I+   +     S N +L   + N  Y IT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:  113 VVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 286          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Human
Match: HNRNPL (heterogeneous nuclear ribonucleoprotein L [Source:HGNC Symbol;Acc:HGNC:5045])

HSP 1 Score: 107.457 bits (267), Expect = 4.513e-29
Identity = 54/128 (42.19%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY L  + +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ++ +    +P I P ++   L +G+ ++KDFS   NNRF        N+I  P+  LHFFNAP
Sbjct:  383 VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYG-LEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP 509          

HSP 2 Score: 41.9726 bits (97), Expect = 4.513e-29
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   L   E +   +  + GV RP ++ +F+ K++  +   GL E+    D+L  L  LNH  +  P+    + LKL FS  +
Sbjct:  505 FFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSE--RSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ 586          

HSP 3 Score: 104.76 bits (260), Expect = 8.998e-23
Identity = 59/177 (33.33%), Postives = 97/177 (54.80%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L +  +++G ++ +  +      L+EF +   A   V  +     YI  H   + YS SQ I+   +     S N +L   + N  Y IT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:  113 VVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 286          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Human
Match: HNRNPL (heterogeneous nuclear ribonucleoprotein L [Source:HGNC Symbol;Acc:HGNC:5045])

HSP 1 Score: 107.071 bits (266), Expect = 6.082e-29
Identity = 54/128 (42.19%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY L  + +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ++ +    +P I P ++   L +G+ ++KDFS   NNRF        N+I  P+  LHFFNAP
Sbjct:  324 VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYG-LEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP 450          

HSP 2 Score: 41.9726 bits (97), Expect = 6.082e-29
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   L   E +   +  + GV RP ++ +F+ K++  +   GL E+    D+L  L  LNH  +  P+    + LKL FS  +
Sbjct:  446 FFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSE--RSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ 527          

HSP 3 Score: 104.375 bits (259), Expect = 9.227e-23
Identity = 59/177 (33.33%), Postives = 97/177 (54.80%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L +  +++G ++ +  +      L+EF +   A   V  +     YI  H   + YS SQ I+   +     S N +L   + N  Y IT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:   54 VVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 227          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Human
Match: HNRNPL (heterogeneous nuclear ribonucleoprotein L [Source:HGNC Symbol;Acc:HGNC:5045])

HSP 1 Score: 107.071 bits (266), Expect = 6.082e-29
Identity = 54/128 (42.19%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY L  + +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ++ +    +P I P ++   L +G+ ++KDFS   NNRF        N+I  P+  LHFFNAP
Sbjct:  324 VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYG-LEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP 450          

HSP 2 Score: 41.9726 bits (97), Expect = 6.082e-29
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   L   E +   +  + GV RP ++ +F+ K++  +   GL E+    D+L  L  LNH  +  P+    + LKL FS  +
Sbjct:  446 FFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSE--RSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ 527          

HSP 3 Score: 104.375 bits (259), Expect = 9.227e-23
Identity = 59/177 (33.33%), Postives = 97/177 (54.80%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L +  +++G ++ +  +      L+EF +   A   V  +     YI  H   + YS SQ I+   +     S N +L   + N  Y IT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:   54 VVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 227          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Human
Match: HNRNPL (heterogeneous nuclear ribonucleoprotein L [Source:HGNC Symbol;Acc:HGNC:5045])

HSP 1 Score: 107.071 bits (266), Expect = 7.554e-29
Identity = 54/128 (42.19%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY L  + +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ++ +    +P I P ++   L +G+ ++KDFS   NNRF        N+I  P+  LHFFNAP
Sbjct:  250 VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYG-LEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP 376          

HSP 2 Score: 41.5874 bits (96), Expect = 7.554e-29
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   L   E +   +  + GV RP ++ +F+ K++  +   GL E+    D+L  L  LNH  +  P+    + LKL FS  +
Sbjct:  372 FFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSE--RSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ 453          

HSP 3 Score: 97.8265 bits (242), Expect = 8.563e-21
Identity = 55/150 (36.67%), Postives = 83/150 (55.33%), Query Frame = 2
Query:  173 CLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
             L+EF +   A   V  +     YI  H   + YS SQ I+   +     S N +L   + N  Y IT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:    7 ALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 153          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Celegans
Match: hrpl-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) L homolog [Source:UniProtKB/TrEMBL;Acc:Q95QR5])

HSP 1 Score: 98.5969 bits (244), Expect = 4.946e-22
Identity = 87/302 (28.81%), Postives = 131/302 (43.38%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESG----VVFMVYNLPFT-ICVDHLFNIFCLYGNVSKV 979
            V+E++L +    +G V     + +    L+EF +   A   V  +      +        YS SQ I  +  +S      +L + V N +YPI  D+I QI    GK+LR+ +  K    +V+ LVEF+ +  AK+AK A++G DIYSGCC+L V+++K   V V R D +  DFT    ++     P     +    + +QA  PS Y           Y+      P HP                   + + D     +   +G     V M+Y L    I  D LFNI C YGNV +V
Sbjct:   43 VTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIEGAKACVNFATSNQINVGGQGALFNYSTSQCIERMGFESAT-PNKVLVVTVLNAQYPIDADVIYQISNAQGKVLRVAVMHK--PTVVQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAKPDRVRVQRQDKDQRDFTLPDNRR-----PYEDDRNHYDRHDYQA--PSSYGYSSRGGGHSDYYGGDRGGPPHP----------------PPSRYRDDYEDRGYAQPAGGGPGCVMMIYGLEHGKINCDMLFNILCQYGNVLRV 318          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Celegans
Match: hrpl-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) L homolog [Source:UniProtKB/TrEMBL;Acc:Q95QR5])

HSP 1 Score: 95.9005 bits (237), Expect = 2.580e-20
Identity = 59/176 (33.52%), Postives = 91/176 (51.70%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V+E++L +    +G V     + +    L+EF +   A   V  +      +        YS SQ I  +  +S      +L + V N +YPI  D+I QI    GK+LR+ +  K    +V+ LVEF+ +  AK+AK A++G DIYSGCC+L V+++K   V V R D +  DFT
Sbjct:   43 VTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIEGAKACVNFATSNQINVGGQGALFNYSTSQCIERMGFESAT-PNKVLVVTVLNAQYPIDADVIYQISNAQGKVLRVAVMHK--PTVVQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAKPDRVRVQRQDKDQRDFT 215          

HSP 2 Score: 84.3445 bits (207), Expect = 1.116e-16
Identity = 44/130 (33.85%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  887 GVVFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            G V M+Y L    I  D LFNI C YGNV ++ F+  +  T ++++G+       + +     LFG  +      +  +   +    LP+G+P+FKD+SS  N RF        N+I+ P  TLH+FNAP
Sbjct:  307 GCVMMIYGLEHGKINCDMLFNILCQYGNVLRISFMRTKTETGIIELGTPEERQNVLDFLQGSALFGLTLEFKPSHQECVHHLRDPFLLPDGSPSFKDYSSSRNQRFSTPELAAKNRIIFPTNTLHWFNAP 436          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Celegans
Match: hrpl-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) L homolog [Source:UniProtKB/TrEMBL;Acc:Q95QR5])

HSP 1 Score: 95.9005 bits (237), Expect = 2.580e-20
Identity = 59/176 (33.52%), Postives = 91/176 (51.70%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V+E++L +    +G V     + +    L+EF +   A   V  +      +        YS SQ I  +  +S      +L + V N +YPI  D+I QI    GK+LR+ +  K    +V+ LVEF+ +  AK+AK A++G DIYSGCC+L V+++K   V V R D +  DFT
Sbjct:   43 VTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIEGAKACVNFATSNQINVGGQGALFNYSTSQCIERMGFESAT-PNKVLVVTVLNAQYPIDADVIYQISNAQGKVLRVAVMHK--PTVVQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAKPDRVRVQRQDKDQRDFT 215          

HSP 2 Score: 84.3445 bits (207), Expect = 1.116e-16
Identity = 44/130 (33.85%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  887 GVVFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            G V M+Y L    I  D LFNI C YGNV ++ F+  +  T ++++G+       + +     LFG  +      +  +   +    LP+G+P+FKD+SS  N RF        N+I+ P  TLH+FNAP
Sbjct:  307 GCVMMIYGLEHGKINCDMLFNILCQYGNVLRISFMRTKTETGIIELGTPEERQNVLDFLQGSALFGLTLEFKPSHQECVHHLRDPFLLPDGSPSFKDYSSSRNQRFSTPELAAKNRIIFPTNTLHWFNAP 436          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 90.5077 bits (223), Expect = 1.452e-18
Identity = 58/207 (28.02%), Postives = 106/207 (51.21%), Query Frame = 2
Query:   77 DIPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSINSID-NKSLDHSTNILNINVSNVK-------------------YPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQG 637
            +IP  + + EL ++  QYG V+    L   S   +E+ E  +A   V      P  I    +  +YS+      D NK++  + ++ N +VSN +                   +P+++D++ Q+  ++GK+LRI    KN  N  + LV+  + + A+ AK+ L  +++Y+GCC+L + YSK+S++ V  N+D+S D+T   +  G
Sbjct:  127 NIPPDLVDVELMQLCIQYGPVSNYMMLKGKSQAFVEYEEEASAAAFVSGMTAVPIQIRGRTLFAQYSTHRELKFDKNKAISDTESVANGSVSNFEVGTQQQPNSVLRTIIENMMFPVSLDVLYQLFTRYGKVLRIITFNKN--NTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKLSTLNVKYNNDKSRDYTNPNLPAG 331          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 82.0333 bits (201), Expect = 3.275e-16
Identity = 36/118 (30.51%), Postives = 74/118 (62.71%), Query Frame = 2
Query:  284 SINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQG 637
            S+++ +  +     ++L   + N+ +P+++D++ Q+  ++GK+LRI    KN  N  + LV+  + + A+ AK+ L  +++Y+GCC+L + YSK+S++ V  N+D+S D+T   +  G
Sbjct:   54 SVSNFEVGTQQQPNSVLRTIIENMMFPVSLDVLYQLFTRYGKVLRIITFNKN--NTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKLSTLNVKYNNDKSRDYTNPNLPAG 169          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Fly
Match: sm (gene:FBgn0003435 transcript:FBtr0301609)

HSP 1 Score: 177.178 bits (448), Expect = 6.138e-48
Identity = 113/334 (33.83%), Postives = 169/334 (50.60%), Query Frame = 2
Query:  326 NILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRND-DESWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIES--------------GVVFMVYNLPF-TICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIE--FLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            +IL   + N  YPITVD++ +IC   G++LRI I KKN    V+ +VEFD +  A  A+E L+G DIY+GCC+L + Y+K   + V +N+ D SWD+T S   + + KPP+ G  ++                                    PFG P          K + I P   + + A V+                G V MVY L   T   D LFN+ CLYGNV++++FL  + GTAMVQMG   +V+ C+Q+ N+  + G   ++      + F S+ I    LP+ +P+FK+++   NNRFL+    + N+I  P++ LHFFN P
Sbjct:   81 HILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNG---VQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLS-TGEILPKPPLLGPGAA----------------------------------FPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPV-GTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTP 375          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Fly
Match: sm (gene:FBgn0003435 transcript:FBtr0304655)

HSP 1 Score: 176.792 bits (447), Expect = 1.123e-47
Identity = 114/345 (33.04%), Postives = 171/345 (49.57%), Query Frame = 2
Query:  326 NILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRND-DESWDFTKSQVKQ-----------GILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIES--------------GVVFMVYNLPF-TICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIE--FLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            +IL   + N  YPITVD++ +IC   G++LRI I KKN    V+ +VEFD +  A  A+E L+G DIY+GCC+L + Y+K   + V +N+ D SWD+T S VK+            + +PP+ G  ++                                    PFG P          K + I P   + + A V+                G V MVY L   T   D LFN+ CLYGNV++++FL  + GTAMVQMG   +V+ C+Q+ N+  + G   ++      + F S+ I    LP+ +P+FK+++   NNRFL+    + N+I  P++ LHFFN P
Sbjct:   81 HILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNG---VQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLYEPPLLGPGAA----------------------------------FPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPV-GTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTP 387          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Fly
Match: sm (gene:FBgn0003435 transcript:FBtr0100232)

HSP 1 Score: 175.252 bits (443), Expect = 2.922e-47
Identity = 112/334 (33.53%), Postives = 167/334 (50.00%), Query Frame = 2
Query:  326 NILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRND-DESWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIES--------------GVVFMVYNLPF-TICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIE--FLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            +IL   + N  YPITVD++ +IC   G++LRI I KKN    V+ +VEFD +  A  A+E L+G DIY+GCC+L + Y+K   + V +N+ D SWD+T S       +PP+ G  ++                                    PFG P          K + I P   + + A V+                G V MVY L   T   D LFN+ CLYGNV++++FL  + GTAMVQMG   +V+ C+Q+ N+  + G   ++      + F S+ I    LP+ +P+FK+++   NNRFL+    + N+I  P++ LHFFN P
Sbjct:   81 HILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNG---VQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLS------TEPPLLGPGAA----------------------------------FPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPV-GTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTP 370          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Fly
Match: sm (gene:FBgn0003435 transcript:FBtr0086492)

HSP 1 Score: 175.252 bits (443), Expect = 2.922e-47
Identity = 112/334 (33.53%), Postives = 167/334 (50.00%), Query Frame = 2
Query:  326 NILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRND-DESWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIES--------------GVVFMVYNLPF-TICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIE--FLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            +IL   + N  YPITVD++ +IC   G++LRI I KKN    V+ +VEFD +  A  A+E L+G DIY+GCC+L + Y+K   + V +N+ D SWD+T S       +PP+ G  ++                                    PFG P          K + I P   + + A V+                G V MVY L   T   D LFN+ CLYGNV++++FL  + GTAMVQMG   +V+ C+Q+ N+  + G   ++      + F S+ I    LP+ +P+FK+++   NNRFL+    + N+I  P++ LHFFN P
Sbjct:   81 HILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNG---VQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLS------TEPPLLGPGAA----------------------------------FPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPV-GTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTP 370          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Fly
Match: sm (gene:FBgn0003435 transcript:FBtr0308796)

HSP 1 Score: 175.252 bits (443), Expect = 4.337e-47
Identity = 113/334 (33.83%), Postives = 168/334 (50.30%), Query Frame = 2
Query:  326 NILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRND-DESWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIES--------------GVVFMVYNLPF-TICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIE--FLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            +IL   + N  YPITVD++ +IC   G++LRI I KKN    V+ +VEFD +  A  A+E L+G DIY+GCC+L + Y+K   + V +N+ D SWD+T S  K  +   P N  +  +   +   G                           PFG P          K + I P   + + A V+                G V MVY L   T   D LFN+ CLYGNV++++FL  + GTAMVQMG   +V+ C+Q+ N+  + G   ++      + F S+ I    LP+ +P+FK+++   NNRFL+    + N+I  P++ LHFFN P
Sbjct:   81 HILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNG---VQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGKS-LFSIPENVVMLESQPPLLGPGAA-----------------------FPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPV-GTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTP 386          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Zebrafish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 127.487 bits (319), Expect = 1.578e-30
Identity = 114/455 (25.05%), Postives = 195/455 (42.86%), Query Frame = 2
Query:   80 IPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSS-------------------QSINSI--------------DNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQ------------------GILKPPVNGSVS-SNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINK-DAFVIESGVVFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTP---AFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            +P+ VSE+E+  +   +G V  +  L   +   IE +    A T+V        ++ +  + ++YS+                   Q++N++              D   +   + +L I V N+ YP++++++ QI  KFG +L+I    KN  N  + L+++     A  AK AL G++IY+GCC+L V++SK++S+ V  N+D+S DFT+  +                    GI+  P  G+   +  I   QAG      P                  + P   P           +S +  ++ I+      I S  V +V NL P +I    LF +F +YG+V +V+ L N+   A++QM   +     + + N + L+G+ +R V  SK      +T++    G       KDFS    +RF      N   I  P+ TLH  N P
Sbjct:   36 VPIEVSEAEVVSLGVPFGKVTNLLMLKGKNQAFIEMASEEAAMTMVNYYTTATPHVRNQPVYIQYSNHRELKTDNLPNQGRAQAALQAVNAVHTGNMSLSGTATASDGGMMPGQSPVLRIIVENLYYPVSLEVLHQIFSKFGTVLKIITFTKN--NQFQALLQYADPMNAHHAKVALDGQNIYNGCCTLRVEFSKLTSLNVKYNNDKSRDFTRLDLPSGDGQPTLDPTMQTAFGAPGIISSPYPGAAGFAPAIGFPQAGLSMQAMPGA----------------LGPLTIP-----------SSAMTGRMAIHGMTPTAIHS--VLLVSNLNPDSISPHELFILFGVYGDVHRVKILFNKKENALIQMADATQAQLAMSHLNGQRLYGKVIR-VTISK-----HQTVQLPREGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIP 453          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Zebrafish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 127.487 bits (319), Expect = 1.578e-30
Identity = 114/455 (25.05%), Postives = 195/455 (42.86%), Query Frame = 2
Query:   80 IPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSS-------------------QSINSI--------------DNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQ------------------GILKPPVNGSVS-SNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINK-DAFVIESGVVFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTP---AFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            +P+ VSE+E+  +   +G V  +  L   +   IE +    A T+V        ++ +  + ++YS+                   Q++N++              D   +   + +L I V N+ YP++++++ QI  KFG +L+I    KN  N  + L+++     A  AK AL G++IY+GCC+L V++SK++S+ V  N+D+S DFT+  +                    GI+  P  G+   +  I   QAG      P                  + P   P           +S +  ++ I+      I S  V +V NL P +I    LF +F +YG+V +V+ L N+   A++QM   +     + + N + L+G+ +R V  SK      +T++    G       KDFS    +RF      N   I  P+ TLH  N P
Sbjct:   36 VPIEVSEAEVVSLGVPFGKVTNLLMLKGKNQAFIEMASEEAAMTMVNYYTTATPHVRNQPVYIQYSNHRELKTDNLPNQGRAQAALQAVNAVHTGNMSLSGTATASDGGMMPGQSPVLRIIVENLYYPVSLEVLHQIFSKFGTVLKIITFTKN--NQFQALLQYADPMNAHHAKVALDGQNIYNGCCTLRVEFSKLTSLNVKYNNDKSRDFTRLDLPSGDGQPTLDPTMQTAFGAPGIISSPYPGAAGFAPAIGFPQAGLSMQAMPGA----------------LGPLTIP-----------SSAMTGRMAIHGMTPTAIHS--VLLVSNLNPDSISPHELFILFGVYGDVHRVKILFNKKENALIQMADATQAQLAMSHLNGQRLYGKVIR-VTISK-----HQTVQLPREGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIP 453          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Zebrafish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 127.102 bits (318), Expect = 2.020e-30
Identity = 114/455 (25.05%), Postives = 195/455 (42.86%), Query Frame = 2
Query:   80 IPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSS-------------------QSINSI--------------DNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQ------------------GILKPPVNGSVS-SNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINK-DAFVIESGVVFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTP---AFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            +P+ VSE+E+  +   +G V  +  L   +   IE +    A T+V        ++ +  + ++YS+                   Q++N++              D   +   + +L I V N+ YP++++++ QI  KFG +L+I    KN  N  + L+++     A  AK AL G++IY+GCC+L V++SK++S+ V  N+D+S DFT+  +                    GI+  P  G+   +  I   QAG      P                  + P   P           +S +  ++ I+      I S  V +V NL P +I    LF +F +YG+V +V+ L N+   A++QM   +     + + N + L+G+ +R V  SK      +T++    G       KDFS    +RF      N   I  P+ TLH  N P
Sbjct:   28 VPIEVSEAEVVSLGVPFGKVTNLLMLKGKNQAFIEMASEEAAMTMVNYYTTATPHVRNQPVYIQYSNHRELKTDNLPNQGRAQAALQAVNAVHTGNMSLSGTATASDGGMMPGQSPVLRIIVENLYYPVSLEVLHQIFSKFGTVLKIITFTKN--NQFQALLQYADPMNAHHAKVALDGQNIYNGCCTLRVEFSKLTSLNVKYNNDKSRDFTRLDLPSGDGQPTLDPTMQTAFGAPGIISSPYPGAAGFAPAIGFPQAGLSMQAMPGA----------------LGPLTIP-----------SSAMTGRMAIHGMTPTAIHS--VLLVSNLNPDSISPHELFILFGVYGDVHRVKILFNKKENALIQMADATQAQLAMSHLNGQRLYGKVIR-VTISK-----HQTVQLPREGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIP 445          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Zebrafish
Match: hnrnpl2 (heterogeneous nuclear ribonucleoprotein L2 [Source:ZFIN;Acc:ZDB-GENE-040426-2707])

HSP 1 Score: 110.538 bits (275), Expect = 1.453e-29
Identity = 57/127 (44.88%), Postives = 77/127 (60.63%), Query Frame = 2
Query:  893 VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNA 1270
            V MVY L P  I  D +FNIFCLYGNV +V+F+ ++PG AMV+MG   +VD  I + N+  LF Q++ L    +  I P ++ E L +GT +FKD+    NNRF        N+I  P+  LHFFNA
Sbjct:  290 VIMVYGLDPVKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAISHLNNNFLFNQKLNLCVSKQQAIMPGQSYE-LDDGTNSFKDYHGSRNNRFATPEQAAKNRIQHPSNVLHFFNA 415          

HSP 2 Score: 40.0466 bits (92), Expect = 1.453e-29
Identity = 25/68 (36.76%), Postives = 36/68 (52.94%), Query Frame = 1
Query: 1318 GVPRPLNIIIFNNK-NDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSAREPKN 1518
            GV  P NI IF  K N   +   GL E+  + D++ AL+++NH  +  P+    F LKL FS  +  N
Sbjct:  432 GVKNPSNIKIFVAKGNSPDRSSSGLLEWESVNDAMEALAMINHNQMKNPNGPYPFTLKLCFSTAQHAN 499          

HSP 3 Score: 109.768 bits (273), Expect = 8.884e-25
Identity = 59/177 (33.33%), Postives = 101/177 (57.06%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V ES++ +  +++G+++ +  +      L+E+ + N +   V  +     YI  H   + YS SQ I+   +     S N +L + + N  YPIT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:   53 VLESDIVEALQEFGTISYVVLMPKKRQALVEYEDMNGSCNAVTYANDNQIYIAGHPAFVNYSTSQKISRPGDPDDARSVNNVLLLTIMNPIYPITSDVLYTICNNCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 226          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Zebrafish
Match: hnrnpl2 (heterogeneous nuclear ribonucleoprotein L2 [Source:ZFIN;Acc:ZDB-GENE-040426-2707])

HSP 1 Score: 110.538 bits (275), Expect = 1.657e-29
Identity = 57/127 (44.88%), Postives = 77/127 (60.63%), Query Frame = 2
Query:  893 VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNA 1270
            V MVY L P  I  D +FNIFCLYGNV +V+F+ ++PG AMV+MG   +VD  I + N+  LF Q++ L    +  I P ++ E L +GT +FKD+    NNRF        N+I  P+  LHFFNA
Sbjct:  313 VIMVYGLDPVKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAISHLNNNFLFNQKLNLCVSKQQAIMPGQSYE-LDDGTNSFKDYHGSRNNRFATPEQAAKNRIQHPSNVLHFFNA 438          

HSP 2 Score: 40.0466 bits (92), Expect = 1.657e-29
Identity = 25/68 (36.76%), Postives = 36/68 (52.94%), Query Frame = 1
Query: 1318 GVPRPLNIIIFNNK-NDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSAREPKN 1518
            GV  P NI IF  K N   +   GL E+  + D++ AL+++NH  +  P+    F LKL FS  +  N
Sbjct:  455 GVKNPSNIKIFVAKGNSPDRSSSGLLEWESVNDAMEALAMINHNQMKNPNGPYPFTLKLCFSTAQHAN 522          

HSP 3 Score: 110.153 bits (274), Expect = 8.868e-25
Identity = 59/177 (33.33%), Postives = 101/177 (57.06%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V ES++ +  +++G+++ +  +      L+E+ + N +   V  +     YI  H   + YS SQ I+   +     S N +L + + N  YPIT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:   53 VLESDIVEALQEFGTISYVVLMPKKRQALVEYEDMNGSCNAVTYANDNQIYIAGHPAFVNYSTSQKISRPGDPDDARSVNNVLLLTIMNPIYPITSDVLYTICNNCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 226          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Xenopus
Match: admp (anti-dorsalizing morphogenic protein [Source:Xenbase;Acc:XB-GENE-485379])

HSP 1 Score: 178.718 bits (452), Expect = 6.928e-48
Identity = 129/412 (31.31%), Postives = 201/412 (48.79%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSINSIDNKSLDHST---NILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKN---LDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVK-QG-----ILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGV-----VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V E++L +  +++G+++ +  +      L+EF +   A   V  +     Y+  H   + YS+    S    + D S    N+L   + N  Y IT D++  IC   G + RI I +KN   +  +    + FD +  A+ AK +L+G DIYSGCC+L ++Y+K S + V +ND ++WD+T   +  QG        PP+ G   +       AG    Y      PPP  Y +     P  P G P         +  S+  P+          E G      V MVY L P  +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ++ +    +  I P ++   L +G+ +FK FS   NNRF +      N+I +P+  LHFFNAP
Sbjct:   29 VVEADLAEALQEFGTISYVVVMPKKRQALVEFEDILGACNAVNYAADNQIYVAGHPAFVNYSTSQKISRPTDTGDDSRGVNNVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQVGIVSLTFLTFDSMQSAQRAKASLNGADIYSGCCTLKIEYAKPSRLNVFKNDQDTWDYTNPALSGQGNPNKRQRNPPLLGDHPAE-YGGPHAGYHGHYHEEAYGPPPPHYESRRMGPP--PVGAPR--------RGPSRYAPQYGHPPPPPPPEYGPHADSPVLMVYGLDPSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLSVCVSKQQSIVPGQSYG-LEDGSCSFKVFSGSRNNRFTSPEQAAKNRIQQPSSVLHFFNAP 428          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Xenopus
Match: admp (anti-dorsalizing morphogenic protein [Source:Xenbase;Acc:XB-GENE-485379])

HSP 1 Score: 175.252 bits (443), Expect = 1.130e-46
Identity = 125/406 (30.79%), Postives = 196/406 (48.28%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSINSIDNKSLDHST---NILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKN---LDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGV-----VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V E++L +  +++G+++ +  +      L+EF +   A   V  +     Y+  H   + YS+    S    + D S    N+L   + N  Y IT D++  IC   G + RI I +KN   +  +    + FD +  A+ AK +L+G DIYSGCC+L ++Y+K S + V +ND ++WD+T          P ++G            G    Y      PPP  Y +     P  P G P         +  S+  P+          E G      V MVY L P  +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ++ +    +  I P ++   L +G+ +FK FS   NNRF +      N+I +P+  LHFFNAP
Sbjct:   62 VVEADLAEALQEFGTISYVVVMPKKRQALVEFEDILGACNAVNYAADNQIYVAGHPAFVNYSTSQKISRPTDTGDDSRGVNNVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQVGIVSLTFLTFDSMQSAQRAKASLNGADIYSGCCTLKIEYAKPSRLNVFKNDQDTWDYTN---------PALSGQ-----------GYHGHYHEEAYGPPPPHYESRRMGPP--PVGAPR--------RGPSRYAPQYGHPPPPPPPEYGPHADSPVLMVYGLDPSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLSVCVSKQQSIVPGQSYG-LEDGSCSFKVFSGSRNNRFTSPEQAAKNRIQQPSSVLHFFNAP 436          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Xenopus
Match: admp (anti-dorsalizing morphogenic protein [Source:Xenbase;Acc:XB-GENE-485379])

HSP 1 Score: 175.252 bits (443), Expect = 1.196e-46
Identity = 129/420 (30.71%), Postives = 201/420 (47.86%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSINSIDNKSLDHST---NILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKN---LDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVK-QG-------------ILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGV-----VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V E++L +  +++G+++ +  +      L+EF +   A   V  +     Y+  H   + YS+    S    + D S    N+L   + N  Y IT D++  IC   G + RI I +KN   +  +    + FD +  A+ AK +L+G DIYSGCC+L ++Y+K S + V +ND ++WD+T   +  QG                PP+ G   +       AG    Y      PPP  Y +     P  P G P         +  S+  P+          E G      V MVY L P  +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ++ +    +  I P ++   L +G+ +FK FS   NNRF +      N+I +P+  LHFFNAP
Sbjct:   35 VVEADLAEALQEFGTISYVVVMPKKRQALVEFEDILGACNAVNYAADNQIYVAGHPAFVNYSTSQKISRPTDTGDDSRGVNNVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQVGIVSLTFLTFDSMQSAQRAKASLNGADIYSGCCTLKIEYAKPSRLNVFKNDQDTWDYTNPALSGQGNSLGDAAGNPNKRQRNPPLLGDHPAE-YGGPHAGYHGHYHEEAYGPPPPHYESRRMGPP--PVGAPR--------RGPSRYAPQYGHPPPPPPPEYGPHADSPVLMVYGLDPSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLSVCVSKQQSIVPGQSYG-LEDGSCSFKVFSGSRNNRFTSPEQAAKNRIQQPSSVLHFFNAP 442          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Xenopus
Match: admp (anti-dorsalizing morphogenic protein [Source:Xenbase;Acc:XB-GENE-485379])

HSP 1 Score: 174.096 bits (440), Expect = 6.443e-46
Identity = 132/435 (30.34%), Postives = 204/435 (46.90%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSINSIDNKSLDHST---NILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKN---LDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVK-QGILK---------PPVNGS-----------VSSNTINMF--------QAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGV-----VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V E++L +  +++G+++ +  +      L+EF +   A   V  +     Y+  H   + YS+    S    + D S    N+L   + N  Y IT D++  IC   G + RI I +KN   +  +    + FD +  A+ AK +L+G DIYSGCC+L ++Y+K S + V +ND ++WD+T   +  QG            PP+ G              SN +  F         AG    Y      PPP  Y +     P  P G P         +  S+  P+          E G      V MVY L P  +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ++ +    +  I P ++   L +G+ +FK FS   NNRF +      N+I +P+  LHFFNAP
Sbjct:   62 VVEADLAEALQEFGTISYVVVMPKKRQALVEFEDILGACNAVNYAADNQIYVAGHPAFVNYSTSQKISRPTDTGDDSRGVNNVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQVGIVSLTFLTFDSMQSAQRAKASLNGADIYSGCCTLKIEYAKPSRLNVFKNDQDTWDYTNPALSGQGDAAGNPNKRQRNPPLLGDHPAEYGKIYNLCCSNRLYFFLLFFVGGPHAGYHGHYHEEAYGPPPPHYESRRMGPP--PVGAPR--------RGPSRYAPQYGHPPPPPPPEYGPHADSPVLMVYGLDPSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLSVCVSKQQSIVPGQSYG-LEDGSCSFKVFSGSRNNRFTSPEQAAKNRIQQPSSVLHFFNAP 485          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Xenopus
Match: taco1 (translational activator of mitochondrially encoded cytochrome c oxidase I [Source:Xenbase;Acc:XB-GENE-986962])

HSP 1 Score: 125.176 bits (313), Expect = 1.141e-29
Identity = 108/438 (24.66%), Postives = 187/438 (42.69%), Query Frame = 2
Query:   80 IPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQ--------------------------------SINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKPPVNGSVSS-----NTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEI-FPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAPY 1276
            IP  V+ESE+  +   +G V  +  L   S   +E +    A ++V      P ++ S  + ++YS+                                 S+   +   L   + +L I V N+ YP+T++++ QI  KFG +++I    KN  N  + L+++     A  AK AL G++IY+ CC+L +++SK++S+ V  N+D+S DFT+  +  G  +P ++ ++++       I+   AG     P I                P      P +          S I  ++ I      I    V +V NL P  I    LF +F +YG+V +V+ L N+   A+VQM   +     + + N + L G+ +R+       +  P +  E         KD+++   +RF      N   I  P+ TLH  N PY
Sbjct:   35 IPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMVNYYTPVPPHVRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVNTLQSGGLTLTSVPGGEGLVLSGQSPVLRIIVENLFYPVTLEVLHQIFSKFGTVIKIITFTKN--NQFQALLQYADPMNAHHAKVALDGQNIYNACCTLRIEFSKLTSLNVKYNNDKSRDFTRLDLPTGDGQPSLDTTMAAAFGAPGIISSPYAGAAGFAPAIGF--------------PQAGLSVPGVPGLGPLALTTSAITGRMAI-PGMTAIPGHSVLLVSNLNPDAILPHGLFILFGVYGDVQRVKILFNKKENALVQMTDATQAQLAMSHLNGQRLHGRVLRITLSKHQSVQLPREGHE----DQGLTKDYTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPY 451          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Mouse
Match: Hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:MGI Symbol;Acc:MGI:104816])

HSP 1 Score: 108.997 bits (271), Expect = 1.092e-29
Identity = 55/128 (42.97%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY L  + +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ+M +    +P I P ++   L +G+ ++KDFS   NNRF        N+I  P+  LHFFNAP
Sbjct:  380 VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYG-LEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP 506          

HSP 2 Score: 41.9726 bits (97), Expect = 1.092e-29
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   L   E +   +  + GV RP ++ +F+ K++  +   GL E+    D+L  L  LNH  +  P+    + LKL FS  +
Sbjct:  502 FFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSE--RSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ 583          

HSP 3 Score: 105.145 bits (261), Expect = 5.834e-23
Identity = 59/177 (33.33%), Postives = 97/177 (54.80%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L +  +++G ++ +  +      L+EF +   A   V  +     YI  H   + YS SQ I+   +     S N +L   + N  Y IT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:  110 VVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 283          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Mouse
Match: Hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:MGI Symbol;Acc:MGI:104816])

HSP 1 Score: 108.997 bits (271), Expect = 1.092e-29
Identity = 55/128 (42.97%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY L  + +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ+M +    +P I P ++   L +G+ ++KDFS   NNRF        N+I  P+  LHFFNAP
Sbjct:  380 VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYG-LEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP 506          

HSP 2 Score: 41.9726 bits (97), Expect = 1.092e-29
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   L   E +   +  + GV RP ++ +F+ K++  +   GL E+    D+L  L  LNH  +  P+    + LKL FS  +
Sbjct:  502 FFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSE--RSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ 583          

HSP 3 Score: 105.145 bits (261), Expect = 5.834e-23
Identity = 59/177 (33.33%), Postives = 97/177 (54.80%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L +  +++G ++ +  +      L+EF +   A   V  +     YI  H   + YS SQ I+   +     S N +L   + N  Y IT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:  110 VVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 283          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Mouse
Match: Hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:MGI Symbol;Acc:MGI:104816])

HSP 1 Score: 108.612 bits (270), Expect = 1.746e-29
Identity = 55/128 (42.97%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY L  + +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ+M +    +P I P ++   L +G+ ++KDFS   NNRF        N+I  P+  LHFFNAP
Sbjct:  409 VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYG-LEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP 535          

HSP 2 Score: 41.5874 bits (96), Expect = 1.746e-29
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   L   E +   +  + GV RP ++ +F+ K++  +   GL E+    D+L  L  LNH  +  P+    + LKL FS  +
Sbjct:  531 FFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSE--RSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ 612          

HSP 3 Score: 105.531 bits (262), Expect = 4.815e-23
Identity = 59/177 (33.33%), Postives = 97/177 (54.80%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L +  +++G ++ +  +      L+EF +   A   V  +     YI  H   + YS SQ I+   +     S N +L   + N  Y IT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:  102 VVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 275          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Mouse
Match: Hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:MGI Symbol;Acc:MGI:104816])

HSP 1 Score: 108.612 bits (270), Expect = 1.783e-29
Identity = 55/128 (42.97%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY L  + +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ+M +    +P I P ++   L +G+ ++KDFS   NNRF        N+I  P+  LHFFNAP
Sbjct:  250 VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYG-LEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP 376          

HSP 2 Score: 41.9726 bits (97), Expect = 1.783e-29
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   L   E +   +  + GV RP ++ +F+ K++  +   GL E+    D+L  L  LNH  +  P+    + LKL FS  +
Sbjct:  372 FFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSE--RSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ 453          

HSP 3 Score: 97.8265 bits (242), Expect = 5.722e-21
Identity = 55/150 (36.67%), Postives = 83/150 (55.33%), Query Frame = 2
Query:  173 CLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
             L+EF +   A   V  +     YI  H   + YS SQ I+   +     S N +L   + N  Y IT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:    7 ALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 153          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Mouse
Match: Ptbp3 (polypyrimidine tract binding protein 3 [Source:MGI Symbol;Acc:MGI:1923334])

HSP 1 Score: 117.087 bits (292), Expect = 4.236e-27
Identity = 106/436 (24.31%), Postives = 185/436 (42.43%), Query Frame = 2
Query:   80 IPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSINSIDNKS--------------------------------LDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQG----ILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEI-FPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            IP  V+E+E+  +   +G V  +  L   S   +E +    A T++        ++ S  + ++YS+      DN                                  L   + +L I + N+ YP+T++++ QI  KFG +L+I    KN  N  + L+++     A+ AK AL G++IY+ CC+L + +SK++S+ V  N+D+S DFT+  +  G     L+PP+  +  +  I        + + P   +P       P     + P               +S +  ++ I   A  +    V +V NL P  I    LF +F +YG+V +V+ + N+   A+VQM   S     + + + + L+G+ +R        +  P +  E         KDFS+   +RF      N   I  P+ TLH  N P
Sbjct:   34 IPCDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSPVLRIIIENLFYPVTLEVLHQIFSKFGTVLKIITFTKN--NQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAAAFGAPGIMSSPYAGAAGFAPAIAFPQAAGLSVPAVPGALGPLTL-----------TSSAVSGRMAI-PGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQE----DQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIP 451          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. UniProt/SwissProt
Match: sp|Q8R081|HNRPL_MOUSE (Heterogeneous nuclear ribonucleoprotein L OS=Mus musculus OX=10090 GN=Hnrnpl PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 6.638e-29
Identity = 55/128 (42.97%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY L  + +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ+M +    +P I P ++   L +G+ ++KDFS   NNRF        N+I  P+  LHFFNAP
Sbjct:  380 VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYG-LEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP 506          

HSP 2 Score: 41.9726 bits (97), Expect = 6.638e-29
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   L   E +   +  + GV RP ++ +F+ K++  +   GL E+    D+L  L  LNH  +  P+    + LKL FS  +
Sbjct:  502 FFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSE--RSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ 583          

HSP 3 Score: 105.145 bits (261), Expect = 4.081e-22
Identity = 59/177 (33.33%), Postives = 97/177 (54.80%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L +  +++G ++ +  +      L+EF +   A   V  +     YI  H   + YS SQ I+   +     S N +L   + N  Y IT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:  110 VVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 283          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. UniProt/SwissProt
Match: sp|F1LQ48|HNRPL_RAT (Heterogeneous nuclear ribonucleoprotein L OS=Rattus norvegicus OX=10116 GN=Hnrnpl PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.143e-28
Identity = 55/128 (42.97%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY L  + +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ+M +    +P I P ++   L +G+ ++KDFS   NNRF        N+I  P+  LHFFNAP
Sbjct:  417 VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYG-LEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP 543          

HSP 2 Score: 41.5874 bits (96), Expect = 1.143e-28
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   L   E +   +  + GV RP ++ +F+ K++  +   GL E+    D+L  L  LNH  +  P+    + LKL FS  +
Sbjct:  539 FFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSE--RSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ 620          

HSP 3 Score: 105.531 bits (262), Expect = 3.498e-22
Identity = 59/177 (33.33%), Postives = 97/177 (54.80%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L +  +++G ++ +  +      L+EF +   A   V  +     YI  H   + YS SQ I+   +     S N +L   + N  Y IT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:  110 VVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 283          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. UniProt/SwissProt
Match: sp|P14866|HNRPL_HUMAN (Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 1.987e-28
Identity = 54/128 (42.19%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY L  + +  D +FN+FCLYGNV KV+F+ ++PG AMV+M    +VD  I + N+  +FGQ++ +    +P I P ++   L +G+ ++KDFS   NNRF        N+I  P+  LHFFNAP
Sbjct:  383 VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYG-LEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAP 509          

HSP 2 Score: 41.9726 bits (97), Expect = 1.987e-28
Identity = 25/84 (29.76%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   L   E +   +  + GV RP ++ +F+ K++  +   GL E+    D+L  L  LNH  +  P+    + LKL FS  +
Sbjct:  505 FFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSE--RSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQ 586          

HSP 3 Score: 104.76 bits (260), Expect = 4.321e-22
Identity = 59/177 (33.33%), Postives = 97/177 (54.80%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L +  +++G ++ +  +      L+EF +   A   V  +     YI  H   + YS SQ I+   +     S N +L   + N  Y IT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:  113 VVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 286          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. UniProt/SwissProt
Match: sp|Q9Z118|PTBP3_RAT (Polypyrimidine tract-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ptbp3 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.263e-27
Identity = 108/436 (24.77%), Postives = 187/436 (42.89%), Query Frame = 2
Query:   80 IPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSINSIDNK---------------------SLDHSTN-----------ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQG----ILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEI-FPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            IP  V+E+E+  +   +G V  +  L   S   +E +    A T++        ++ S  + ++YS+      DN                      SL  +T+           +L I + N+ YP+T++++ QI  KFG +L+I    KN  N  + L+++     A+ AK AL G++IY+ CC+L + +SK++S+ V  N+D+S DFT+  +  G     L+PP+  +  +  I        + + P   +P             + P               +S +  ++ I   A  I    V +V NL P  I    LF +F +YG+V +V+ + N+   A+VQM   S     + + + + L+G+ +R        +  P +  E         KDFS+   +RF      N   I  P+ TLH  N P
Sbjct:   37 IPCDVTEAEVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATSNEGTLLPGQSPVLRIIIENLFYPVTLEVLHQIFSKFGTVLKIITFTKN--NQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAAAFGAPGIMSSPYAGAAGFAPAIAFPQAAGLSVSAVPGALGPLTL-----------TSSAVSGRMAI-PGASGIPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQIAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQE----DQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIP 454          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. UniProt/SwissProt
Match: sp|O95758|PTBP3_HUMAN (Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3 PE=1 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 2.882e-26
Identity = 109/437 (24.94%), Postives = 192/437 (43.94%), Query Frame = 2
Query:   80 IPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQN-SKIKPFYIESHKIKLEYSSQ-------------------SINSIDNKSLDHSTN-------------ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQG----ILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEI-FPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            IP  V+E+E+  +   +G V  +  L   S   +E +    A T+V   + I P ++ S  + ++YS+                    +++++ + SL  S               +L I + N+ YP+T++++ QI  KFG +L+I    KN  N  + L+++     A  AK AL G++IY+ CC+L + +SK++S+ V  N+D+S DFT+  +  G     L+PP+  +  +  I        + + P   +P       P     + P               +S +  ++ I   A  I    V +V NL P  I    LF +F +YG+V +V+ + N+   A+VQM   +     + + + + L+G+ +R        +  P +  E         KDFS+   +RF      N   I  P+ TLH  N P
Sbjct:   66 IPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPITP-HLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSPVLRIIIENLFYPVTLEVLHQIFSKFGTVLKIITFTKN--NQFQALLQYADPVNAHYAKMALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPTGDGQPSLEPPMAAAFGAPGIISSPYAGAAGFAPAIGFPQATGLSVPAVPGALGPLTI-----------TSSAVTGRMAI-PGASGIPGNSVLLVTNLNPDLITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADANQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQE----DQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIP 483          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. TrEMBL
Match: A4V6K3 (HnRNP L protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 2.596e-174
Identity = 241/308 (78.25%), Postives = 269/308 (87.34%), Query Frame = 2
Query:  356 KYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILK-PPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNLPFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAPY 1276
            KYPITVDIIKQICLKFGK+L+IFIGKKN DN+VECLVEF+KISEAK+AKEALHGEDIYSGCCSLDVKYSKMS+VPV +NDDESWDF+KSQVKQGILK PP NGSVSSN +N+F               PP   +N +PV P+H F C NL+YNY ++QKNSK K KLDINKDAFV+E GVVFMVYNLPF ICVDHLFN+FCLYGNV+K++F  NQPGTAMVQMGSK++V+TCIQYYN+K LFGQEM L+KC+KPEIFPSK IEFLPNGTP FKDFS+DANNRFLNDHGINSNKILEPNRTLHFFNAPY
Sbjct:    3 KYPITVDIIKQICLKFGKLLKIFIGKKNQDNVVECLVEFEKISEAKAAKEALHGEDIYSGCCSLDVKYSKMSNVPVFKNDDESWDFSKSQVKQGILKVPPSNGSVSSNNVNVFTP-TNPQLYSPVYNFPPPMSYNHMPVPPIHGFPCHNLIYNYPSIQKNSKSKSKLDINKDAFVVEIGVVFMVYNLPFNICVDHLFNLFCLYGNVNKIKF-TNQPGTAMVQMGSKAAVETCIQYYNNKTLFGQEMHLMKCNKPEIFPSKNIEFLPNGTPVFKDFSADANNRFLNDHGINSNKILEPNRTLHFFNAPY 308          

HSP 2 Score: 176.792 bits (447), Expect = 2.596e-174
Identity = 117/235 (49.79%), Postives = 142/235 (60.43%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSAREPKNVTQTYGDNKRSISVRENDESN--PSKRVKSEKKEELCKDEIKQELGAEIDIGLCSSKEINE--TQPDEKDLIT----NNGWHGEISQTAEESQLGGYVIHCKVKSENIDCVIET----PEEIGEIDPHQERIDINFNHSLRQSNVSCT 1926
            FF     F E DL+NMI+QSGVPRP+NIIIF+NKNDHVKKCIGLFEFHRLEDSL+ALSVLNHKPIIIPDTNQVFH+KLTFSAREPKNV   + D KR  S RE  E +   SK+ K E K+EL  D +K+E            KE+    TQPD  D  +     NGW G  +    +        H  + +E IDC  E+     ++   I+P + +I+        QSN S T
Sbjct:  303 FFNAPYTFAEIDLNNMIIQSGVPRPINIIIFSNKNDHVKKCIGLFEFHRLEDSLIALSVLNHKPIIIPDTNQVFHMKLTFSAREPKNVNPGHVDIKRCQSFRETPEIDQISSKKSKFEIKDEL--DNMKKE------------KEVVTVVTQPDNLDRSSLSPGENGWCGLNNNLDND-------FHGSILNEKIDCKRESFANNQQQSINIEPDENKIN-------NQSNCSLT 509          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. TrEMBL
Match: A0A3S5AMB8 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS33948 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 3.138e-58
Identity = 133/437 (30.43%), Postives = 225/437 (51.49%), Query Frame = 2
Query:   17 HQNLDKKFNIKNNNQ------TILATDIPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQ----------SINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEF-LPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            H  L++K N   + +       I   ++P    E +L + F+ YG +  I  L N    L+EF +  +A ++V  S  +   + + ++K+ +S+           S    +  ++    N+L + + N +YPITVD+I QI  + G++LRI I +K+    V+ +VEF  + EAK+AK  L+G DIYSGCC+L V++++ + + V +ND ++WDF       GI    ++G  + NT ++                        + V P       ++  + N       + P+++ +  A +  S  V MVYNL  T +  D LFN+ CLYGNV +++FL  + G+AMVQ+G  +SVD  I       LF   +++V+ SK ++       F LP+GTP+FKD++    NR++N      N++  P+RTLHF+N+P
Sbjct:    6 HMALNRKRNRPEDWEELEPSPVIHIRELPEHTLEIDLQRTFEVYGRIRDITMLPNKCQALVEFHDIASAESVVLRSAEEVITVANRRVKVNFSTSKRIVQRASASSSGGSEGPTISSENNVLLLTIYNSQYPITVDVINQITSRHGRVLRIVIFRKSG---VQAMVEFRSVEEAKTAKRHLNGADIYSGCCTLKVEFARPTRLSVTKNDQDTWDFENPMPSPGIGVTVMDGR-AQNTASLLGGYPRFDGARAAVSNIYGLPGGSVSVNPPGAQMVGSITMSGNPAGGGVGLPPQME-HMTAGLHGSTPVVMVYNLDLTRMNCDRLFNLLCLYGNVWRIKFLKTKEGSAMVQLGDSASVDRVIANLTGVTLFDNRLQVVRQSKQQVILDVPQPFDLPDGTPSFKDYTGSRENRYINPEQAGKNRVYPPSRTLHFWNSP 437          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. TrEMBL
Match: A0A3S5BVH4 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS13646 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.907e-54
Identity = 129/417 (30.94%), Postives = 207/417 (49.64%), Query Frame = 2
Query:   77 DIPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-----------SQSINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKPPVNGSVSSNTINM-----FQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEF-LPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            ++P    E +L + F+ YG +  I  L      L+EF + ++A  ++  S  +   + + ++K+ +S           S S NS+D        NIL + + N +YPITVD+I QI  + G++LRI I +K+    V+ +VEF  I EAK+AK  L+G DIYSGCC+L V+Y++ S + V +ND ++WDF       G     ++G   +N   +     F +G  ++          +          M+  G P        +    +  P L      +   +  V MVYNL  T +  D LFNI CL+GNV +++FL  + G+AMVQMG  +SVD  I       LFG  ++    ++ ++       F LP+ + +FKD++    NR++N      N+I   +RTLHF+N P
Sbjct:   26 ELPEHTLEIDLQRAFEVYGRIRDITMLPTKCQALLEFHDISSAEAVIMRSAEEVVTVANRRVKVNFSTSKRIMQRTSASASDNSVDGPVASAENNILLLTIYNPQYPITVDVINQITSRHGRVLRIVIFRKSG---VQAMVEFQTIDEAKTAKRHLNGADIYSGCCTLKVEYARPSRLSVSKNDQDTWDFENPMPSSGAGGSVLDGRNQNNASLLGGYPRFDSGRNTIANIYGMPSGAVGITAAGTQV-MNAMGVPGASVTAGGMPIQVEHAPNL------YHGSNTSVLMVYNLDLTRMNCDRLFNILCLFGNVWRIKFLRTKEGSAMVQMGDSASVDRAIPSLAGLTLFGNRLQASLSTRQQVLLDVPQPFDLPDSSSSFKDYTGSRENRYINPEMALKNRIYPASRTLHFWNCP 432          

HSP 2 Score: 40.4318 bits (93), Expect = 1.907e-54
Identity = 23/82 (28.05%), Postives = 41/82 (50.00%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSA 1503
            F+ C   F  +D+ ++ + +G   P   + F+   +  K   GL E++   D+L  L + NH  +  P+    F +KL+FSA
Sbjct:  428 FWNCPPNFSATDMRHVFVNNGAVPPEQFLAFSKGGE--KSSSGLVEWNNRGDALDGLVLCNHTVVPYPEGRFPFMMKLSFSA 507          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. TrEMBL
Match: A0A401SLC6 (Uncharacterized protein (Fragment) OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0009650 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.285e-53
Identity = 130/405 (32.10%), Postives = 205/405 (50.62%), Query Frame = 2
Query:   89 TVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDN-KSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQV-------KQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            +V E++L K   ++G ++ +  L N    L+EF +  +A   V  +K +   I  H     +S SQ I      +   H  N+L +++ N  YPIT D++  +C   G +LRI I KKN    ++ LVEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ESWD+T   +       +QG  +P + G   S T   +Q    ++   +                PMH +  P                       D   +  G V MVY L P  +  + +FN+ CLYGN+ KV+F+ + P  AMV+MG + SV+  I + N   +FG+++ L    +  I PS++ E + +GT ++K+F++  NNRF N      N+I  P+  LHFFNAP
Sbjct:   43 SVIEADLVKGVDRFGLISYVMMLPNKRQALVEFQDLRSAQKCVAYAKRRIVNIAGHPAFFNFSTSQRITRPGGPEDPKHVNNVLFLSIQNPLYPITTDVLYTVCNACGPVLRIVIFKKN---GIQALVEFDSVQSAQKAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDSESWDYTNPDLTARDERRRQG--QPALLGDHPS-TYGGYQTSPLALAHRMDPRSSSSR--------PMHLYSAP-----------------------DFEFVPQGKVIMVYGLNPHKMNCEKIFNLLCLYGNIEKVKFMKSMPDAAMVEMGDEFSVERAITHLNGVEMFGKKLNLCVSKQASIVPSQSYELV-DGTDSYKEFTNSRNNRFTNPGQAAKNRIQPPSNVLHFFNAP 409          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. TrEMBL
Match: A0A4Z2CYV4 (Heterogeneous nuclear ribonucleoprotein L isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_006372 PE=4 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 9.657e-53
Identity = 127/411 (30.90%), Postives = 201/411 (48.91%), Query Frame = 2
Query:   77 DIPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSI-------NSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKPPVNGSVSSNTINM---FQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLD-INKDAFVIESGVVFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            ++P    E +L ++F+Q+GS+  I  + +    LIEF + N+A   V           +H++K+ YS+          N   +  L   + +L + V N +YPITVD+I QI  K G++LRI I +K     ++ +VEF    EA++AK  L+G DIYSGCC+L V++++ + + V RND +SWDF        +L  P+N +     I++   F+                  YH+            P   +           +  LD +N   +   +  V MVYN+    +  D LFN+ CLYGNV +++FL  + G+AM QMG   SVD  I   +   L G  + +    +  I        LP+GTP+FKD+S    NR++N    + N+I  P+ TLH++N P
Sbjct:   25 ELPEHTLELDLIRVFEQFGSIRDIAMIPHKGQALIEFDDINSAERAVARCSENAVMFANHRLKVNYSTSKRVIHRPLENDNQHPELPPESRVLILTVYNAQYPITVDVIHQITAKHGRVLRIVILRKTR---IQAMVEFKNTEEARTAKRHLNGADIYSGCCTLKVEFARPTRLTVTRNDQDSWDFENPL----LLSSPLNEADGRGDISLLGRFERSRARHESSRSVNGGAFGYHDGFMKQNAVGISVPPASFLDQLALNYHVSRRGLDGLNGQPYTRAATPVIMVYNMDMDHMNCDRLFNLLCLYGNVVRIKFLRTKEGSAMAQMGDNLSVDRVITNLSEVPLMGNALSIRPSKQQLILDVPKPYELPDGTPSFKDYSGCRENRYINPDKASKNRIYPPSNTLHYWNCP 428          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Cavefish
Match: hnrnpl2 (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:103041983])

HSP 1 Score: 183.341 bits (464), Expect = 3.397e-50
Identity = 124/396 (31.31%), Postives = 192/396 (48.48%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNA 1270
            V E++L +  +++G+++ +  +      L+E+ + + +   V  +     YI  +   + YS SQ I+   +     S N +L   + N  YPIT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T             N ++SS   +    G        Y       Y        M   G P                P       A       V MVY L P  I  D +FNIFCLYGNV +V+F+ ++PG AMV+MG   +VD  I + N+  LF Q++ +    +  I P ++ E L +G+ +FKDF    NNRF +      N+I  P+  LHFFNA
Sbjct:   53 VLEADLVEALQEFGTISYVVLMPKKRQALVEYEDMSGSCNAVTYANDNQIYIAGNPAFVNYSTSQKISRPGDPDDSRSVNNVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT-------------NPNLSSQGADADGNGGDPGGYHGYQDDSYGGYEGRRMAPSM---GGPRRGGASQRYGGQYGAPPPPPGEYSAHA--ESPVMMVYGLEPTKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAICHLNNHFLFNQKLNVCVSKQQAIMPGQSYE-LDDGSNSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNA 426          

HSP 2 Score: 36.1946 bits (82), Expect = 3.397e-50
Identity = 27/94 (28.72%), Postives = 44/94 (46.81%), Query Frame = 1
Query: 1246 SNTSFFQCSLPFLESDL-SNMIMQSGVPRPLNIIIFNNKNDHV--KKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSAREPKN 1518
            SN   F  + P    D+ S +  + GV  P N+  F  K      +   GL E+  + D++ AL+++NH  +  P+    + LKL FS  +  N
Sbjct:  418 SNVLHFFNAAPEAAGDVFSEICEELGVKSPSNVKNFAAKGGASSERSSSGLLEWESVNDAMEALAMMNHYQMKNPNGPYPYTLKLCFSTAQHAN 511          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Cavefish
Match: hnrnpl2 (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:103041983])

HSP 1 Score: 182.956 bits (463), Expect = 6.533e-50
Identity = 123/396 (31.06%), Postives = 195/396 (49.24%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNA 1270
            V E++L +  +++G+++ +  +      L+E+ + + +   V  +     YI  +   + YS SQ I+   +     S N +L   + N  YPIT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T   +    + P  N +       +     P               +    + P    G P                P       A   ES V+ MVY L P  I  D +FNIFCLYGNV +V+F+ ++PG AMV+MG   +VD  I + N+  LF Q++ +    +  I P ++ E L +G+ +FKDF    NNRF +      N+I  P+  LHFFNA
Sbjct:   53 VLEADLVEALQEFGTISYVVLMPKKRQALVEYEDMSGSCNAVTYANDNQIYIAGNPAFVNYSTSQKISRPGDPDDSRSVNNVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSSQDMNP--NPNKRPRQPALLGDHPPEYGGYHGYQDDSYGGYEGRRMAPS--MGGPRRGGASQRYGGQYGAPPPPPGEYSAHA-ESPVM-MVYGLEPTKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAICHLNNHFLFNQKLNVCVSKQQAIMPGQSYE-LDDGSNSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNA 438          

HSP 2 Score: 35.8094 bits (81), Expect = 6.533e-50
Identity = 27/94 (28.72%), Postives = 44/94 (46.81%), Query Frame = 1
Query: 1246 SNTSFFQCSLPFLESDL-SNMIMQSGVPRPLNIIIFNNKNDHV--KKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSAREPKN 1518
            SN   F  + P    D+ S +  + GV  P N+  F  K      +   GL E+  + D++ AL+++NH  +  P+    + LKL FS  +  N
Sbjct:  430 SNVLHFFNAAPEAAGDVFSEICEELGVKSPSNVKNFAAKGGASSERSSSGLLEWESVNDAMEALAMMNHYQMKNPNGPYPYTLKLCFSTAQHAN 523          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Cavefish
Match: hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:ZFIN;Acc:ZDB-GENE-040426-710])

HSP 1 Score: 165.622 bits (418), Expect = 5.442e-43
Identity = 121/415 (29.16%), Postives = 194/415 (46.75%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSINSIDNKSLDHST--NILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSV--------------PVLRNDDESWDFTKSQVKQGIL--KPPVNGSVSSNTI---NMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNA 1270
            ++ES+L +  +++G+++ +  + N    L+E+ + + +   V  +     YI      + YS+    S    S D  +  NIL   + N  YPIT D++  IC   G + RI I +KN    V+ +VE+  +  A+ AK +L+G DIYSGCC+L ++Y+K + +              P L   D + +  K Q +  +L   PP  G   S      + +    P         P       P    P +  G P                P+     D+ VI      MVY L P+ I  D +FN+FCLYGNV +V+F+ ++PG AMV+MG   +V+  I + N   LF Q++ +    +  I P ++ + L +G+ +FKDF    NNRF +      N+I  P+  LHFFN 
Sbjct:  128 ITESDLVEALREFGTISYVVLMPNKRQALVEYEDMSGSCNAVTYANDNQVYIAGRPCYINYSTSQKISRPGDSGDAPSVNNILLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNG---VQAMVEY-PLQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPTLSGQDPNANPNKRQRQPALLGDHPPEYGGPQSGYGHYDDTYGPPPPHYEGRRMGPPLARGRGGPRYGAPQYGHGPP----------------PEYASQADSPVI------MVYGLDPYKINADRIFNVFCLYGNVERVKFMKSKPGAAMVEMGDCYAVERAISHLNHTMLFNQKLNICVSKQQAIIPGQSYQ-LEDGSCSFKDFHGSRNNRFTSPEQAAKNRIQRPSNVLHFFNG 515          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Cavefish
Match: hnrnpl2 (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:103041983])

HSP 1 Score: 107.457 bits (267), Expect = 1.788e-27
Identity = 56/127 (44.09%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  893 VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNA 1270
            V MVY L P  I  D +FNIFCLYGNV +V+F+ ++PG AMV+MG   +VD  I + N+  LF Q++ +    +  I P ++ E L +G+ +FKDF    NNRF +      N+I  P+  LHFFNA
Sbjct:  290 VMMVYGLEPTKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAICHLNNHFLFNQKLNVCVSKQQAIMPGQSYE-LDDGSNSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNA 415          

HSP 2 Score: 35.8094 bits (81), Expect = 1.788e-27
Identity = 27/94 (28.72%), Postives = 43/94 (45.74%), Query Frame = 1
Query: 1246 SNTSFFQCSLPFLESD-LSNMIMQSGVPRPLNIIIFNNKNDHV--KKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSAREPKN 1518
            SN   F  + P    D  S +  + GV  P N+  F  K      +   GL E+  + D++ AL+++NH  +  P+    + LKL FS  +  N
Sbjct:  407 SNVLHFFNAAPEAAGDVFSEICEELGVKSPSNVKNFAAKGGASSERSSSGLLEWESVNDAMEALAMMNHYQMKNPNGPYPYTLKLCFSTAQHAN 500          

HSP 3 Score: 104.76 bits (260), Expect = 3.589e-23
Identity = 57/177 (32.20%), Postives = 100/177 (56.50%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L +  +++G+++ +  +      L+E+ + + +   V  +     YI  +   + YS SQ I+   +     S N +L   + N  YPIT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:   53 VLEADLVEALQEFGTISYVVLMPKKRQALVEYEDMSGSCNAVTYANDNQIYIAGNPAFVNYSTSQKISRPGDPDDSRSVNNVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 226          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Cavefish
Match: hnrnpl2 (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:103041983])

HSP 1 Score: 107.071 bits (266), Expect = 2.159e-27
Identity = 56/127 (44.09%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  893 VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNA 1270
            V MVY L P  I  D +FNIFCLYGNV +V+F+ ++PG AMV+MG   +VD  I + N+  LF Q++ +    +  I P ++ E L +G+ +FKDF    NNRF +      N+I  P+  LHFFNA
Sbjct:  324 VMMVYGLEPTKINADRVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYAVDRAICHLNNHFLFNQKLNVCVSKQQAIMPGQSYE-LDDGSNSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNA 449          

HSP 2 Score: 36.1946 bits (82), Expect = 2.159e-27
Identity = 27/94 (28.72%), Postives = 44/94 (46.81%), Query Frame = 1
Query: 1246 SNTSFFQCSLPFLESDL-SNMIMQSGVPRPLNIIIFNNKNDHV--KKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSAREPKN 1518
            SN   F  + P    D+ S +  + GV  P N+  F  K      +   GL E+  + D++ AL+++NH  +  P+    + LKL FS  +  N
Sbjct:  441 SNVLHFFNAAPEAAGDVFSEICEELGVKSPSNVKNFAAKGGASSERSSSGLLEWESVNDAMEALAMMNHYQMKNPNGPYPYTLKLCFSTAQHAN 534          

HSP 3 Score: 105.531 bits (262), Expect = 2.728e-23
Identity = 57/177 (32.20%), Postives = 100/177 (56.50%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L +  +++G+++ +  +      L+E+ + + +   V  +     YI  +   + YS SQ I+   +     S N +L   + N  YPIT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:   53 VLEADLVEALQEFGTISYVVLMPKKRQALVEYEDMSGSCNAVTYANDNQIYIAGNPAFVNYSTSQKISRPGDPDDSRSVNNVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 226          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Sea Lamprey
Match: HNRNPLL (heterogeneous nuclear ribonucleoprotein L like [Source:HGNC Symbol;Acc:HGNC:25127])

HSP 1 Score: 113.235 bits (282), Expect = 8.172e-30
Identity = 56/128 (43.75%), Postives = 77/128 (60.16%), Query Frame = 2
Query:  893 VFMVYNLPF-TICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVY      I  D +FNI CL+GNV KV+FL ++PG AMV+MG   +VD  + + N   +FG+++ L    +  I P +  E LP+GT ++KDF+   NNRF N      N+I +P   LHFFNAP
Sbjct:  316 VLMVYGFDAERINCDRVFNILCLFGNVEKVKFLKSKPGAAMVEMGDPYAVDRAVSHLNMSQIFGKKINLCVSKQQSIVPGQAYE-LPDGTNSYKDFTGSRNNRFANAEKAAKNRIQQPTTVLHFFNAP 442          

HSP 2 Score: 35.4242 bits (80), Expect = 8.172e-30
Identity = 22/84 (26.19%), Postives = 38/84 (45.24%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSARE 1509
            FF   +         +  +  + RPL+   F+ K+D  K   GL E+    D++ AL+ +NH  +   +    + LKL FS  +
Sbjct:  438 FFNAPMDITAEIFMQLCDEMSIARPLSFKAFSGKSD--KSMSGLMEWENKNDAMEALACINHHSLKNANGPYPYTLKLCFSTAQ 519          

HSP 3 Score: 104.76 bits (260), Expect = 8.643e-24
Identity = 60/185 (32.43%), Postives = 100/185 (54.05%), Query Frame = 2
Query:   98 ESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSI----DNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQG 637
            ES+L +  + +G ++ +  +      L+EF +  ++ + V  S     Y+        +S SQ I+      DN++ +H   IL   + N  YPIT D++  IC   G + RI I +KN    ++ +  FD +  A+ AK +L+G DIYSGCC+L V+Y+K + + V +ND E+WD+T   +K G
Sbjct:   62 ESDLVEAVQHFGPISYVVMMPKKRQALVEFEDLESSRSCVNYSSTGSIYVCGQPAYFNFSTSQKISRPGGPEDNRNSNH---ILLFTILNPIYPITTDVLYTICNPCGPVQRIVIFRKNG---LQAMATFDSVQSAQRAKSSLNGADIYSGCCTLKVEYAKPTRLNVFKNDSETWDYTNPGLKAG 240          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Sea Lamprey
Match: HNRNPLL (heterogeneous nuclear ribonucleoprotein L like [Source:HGNC Symbol;Acc:HGNC:25127])

HSP 1 Score: 111.694 bits (278), Expect = 1.993e-26
Identity = 62/183 (33.88%), Postives = 98/183 (53.55%), Query Frame = 2
Query:   89 TVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLD---HSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKM---SSVPVLRNDDESWDFT 616
            +  ES++ +  +++G+V  +  + +    L+EF     A   V  +   P Y+        +S SQ I+       D    + +IL + V+N  YPIT ++I  IC  +G + RI I KKN    V+ L  FD I  A+ AK +L+G DIYSGCC+L ++Y+K    + + V RND E+WD+T
Sbjct:   22 SADESQVMEALQEFGTVRHVVMMPHRRQALVEFERLEDARACVAGTAGDPVYVGGQPAYCNFSTSQRISRKGGTPADDVARTNHILLLTVNNALYPITTEVIHTICSPYGVVQRIVIFKKNG---VQALRTFDSIPSAQQAKSSLNGADIYSGCCTLKIEYAKERKPARLNVYRNDSETWDYT 201          

HSP 2 Score: 105.916 bits (263), Expect = 1.718e-24
Identity = 52/128 (40.62%), Postives = 77/128 (60.16%), Query Frame = 2
Query:  893 VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MVYN+ P  +    LFN+ CLYGNV K++FL ++PG  M+QM   +SVD  +   N+  LFGQ++ L    + EI   +  E L +G+ +F+DF    +NRF      + N+IL P+  LHF++AP
Sbjct:  284 VMMVYNMNPSVMNCSRLFNLVCLYGNVEKIKFLKSKPGVGMIQMADAASVDRAVANLNTAQLFGQKLSLSVSKQQEIVAGQAFE-LEDGSDSFRDFVGSRHNRFSTHEQASKNRILPPSAILHFYSAP 410          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006507.1 (pep scaffold:Pmarinus_7.0:GL480554:3468:10153:1 gene:ENSPMAG00000005883.1 transcript:ENSPMAT00000006507.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 7.895e-17
Identity = 45/137 (32.85%), Postives = 79/137 (57.66%), Query Frame = 2
Query:  263 KLEYSSQSINSIDNKSLDHSTN-------ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKPP 652
            + E  +Q+   + N S    TN       IL+I V N+ YPIT++++  +  K+G +L+I I  KN  +  + L++F   S A  AK  L G++IY+GCC+L V +S+++++ V  N+++S D T+  +  G  + P
Sbjct:  119 RREQKAQAAMMVANGSDSEETNSAAPQSPILHIIVENLLYPITLEVLHHVFSKYGTVLKIIIFNKN--SQYQALMQFADASNAHQAKTMLDGQNIYNGCCTLRVGFSRLTNLNVKYNNEKSRDLTRPDLPAGEGQGP 253          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006509.1 (pep scaffold:Pmarinus_7.0:GL480554:3489:6552:1 gene:ENSPMAG00000005883.1 transcript:ENSPMAT00000006509.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 2.273e-6
Identity = 31/96 (32.29%), Postives = 50/96 (52.08%), Query Frame = 2
Query:  263 KLEYSSQSINSIDNKSLDHSTN-------ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIY 529
            + E  +Q+   + N S    TN       IL+I V N+ YPIT++++  +  K+G +L+I I  KN  +  + L++F   S A  AK A  G  +Y
Sbjct:  112 RREQKAQAAMMVANGSDSEETNSAAPQSPILHIIVENLLYPITLEVLHHVFSKYGTVLKIIIFNKN--SQYQALMQFADASNAHQAKTANPGWSVY 205          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Nematostella
Match: EDO39119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAW4])

HSP 1 Score: 152.525 bits (384), Expect = 1.698e-39
Identity = 119/405 (29.38%), Postives = 191/405 (47.16%), Query Frame = 2
Query:   98 ESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKI--------KPFYIESHKIKLEYSSQSINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKN-LDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSS-VPVLRNDDESWDFTKSQVKQGILK--PPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            E +L +   QYG+++ I  +  +   L+EF E   A TLV  +++        +P Y    K     S Q   ++  +S      IL I + N +Y +T DI+  I  K G + RI I +K+ L  +VE    FD +  A+ AKE L+G DIY+GC +L ++    +  + V +ND E++D+T+ +   G+L   PP  G +S                P Y                    G P + Y    +Q      P++   ++      G V MVY L    +  D LFN+ C YGNV K++FLL +PGTAM ++    + +T ++  +   LF Q++      +  +     +  LP+G+P+FK F +  NNRF +    + N++  P + LHFFNAP
Sbjct:   61 EQDLMQCLSQYGNISCITMMPKIRQALVEFEEIACANTLVNQTQMGNPVILCGRPAYANYSK-----SKQISRNVHVRSETQPNKILLITIINPQYVVTTDILHTIFSKQGMVQRIVIFRKSGLQAMVE-ESRFDCVEAARHAKETLNGADIYTGCNTLKIESQGYAQQLNVRKNDSETYDYTQDK-GPGMLGHPPPKQGLLSPPPPAYGGGPPAYGGAPNYG-------------------GAPPMGYGAQPMQA-----PQMQTYRNH--PSGGNVIMVYGLDKDKMNCDRLFNLLCCYGNVIKIKFLLGKPGTAMAELHEHVACNTVMENLSKMTLFDQQLEFSFSKQDYLVEPANVPNLPDGSPSFKSFDNSKNNRFTSATASSKNRVFTPMKVLHFFNAP 432          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Nematostella
Match: EDO35537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLA1])

HSP 1 Score: 97.4413 bits (241), Expect = 3.670e-23
Identity = 59/183 (32.24%), Postives = 99/183 (54.10%), Query Frame = 2
Query:   98 ESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSI------NSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMS-SVPVLRNDDESWDFTKS 622
            E++L ++ + +G++  +  L  +   L+EF    +A  +V  S+  P  +   ++ + YS SQ I      N   N +   ++NIL + + N  +PI V I+ +IC   GK+LRI I  KN             +S A+ A   L+G+DIY+GCC+L + YSK +  + V +NDDE+WD+T +
Sbjct:   20 ETDLIQVLQPFGTITYVTLLPKIRQALVEFESLESAIAVVTYSQTSPLTVLGRQMFVNYSKSQEIKRDKVLNGDSNGACAEASNILLLTIINPLHPINVKILHKICSPSGKVLRIVIFHKN---------GLQALS-AERALAVLNGQDIYAGCCTLKIDYSKKAKKLNVFKNDDETWDYTGA 192          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Nematostella
Match: EDO43995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXA3])

HSP 1 Score: 93.5893 bits (231), Expect = 3.665e-20
Identity = 62/221 (28.05%), Postives = 108/221 (48.87%), Query Frame = 2
Query:   77 DIPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS---------SQSINSIDNKSLDH-------------------STN--ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKP 649
            ++    +++E+  +   YG V  +  L   +   +E      A  L+ +    P  I   +I ++YS         SQ    +   S  H                   S N  IL I V N+ YPIT++++ QI  K+G +L+I I  +N  N  + LV+F + +EA++AK +L G++IY+GCC+L + YSK+ ++ V  N+D++ D+T+  +  G   P
Sbjct:    9 NVAAEATDAEIIALGIPYGRVTNVLMLKGKNQAFLEMKTKENAMALMNSYSYIPPSIRGRQIYIQYSNHQELTTNESQHSPGVRGLSSSHLGAGIGSLTSGLGIAGELPSVNGCILRIIVENMLYPITIEVLNQIFTKYGTVLKIVIFTRN--NQFQALVQFSQSTEARAAKCSLDGQNIYNGCCTLRIDYSKLKTLSVKYNNDKTRDYTRPDLPSGESTP 227          

HSP 2 Score: 62.003 bits (149), Expect = 4.265e-10
Identity = 38/117 (32.48%), Postives = 55/117 (47.01%), Query Frame = 2
Query:  923 ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            I  D LF +F  YG+V +V+ L N+  TA+VQ  +     T I + N   +FG+EM++       +   K  E     T   KD+ +   +RF      N   I  P+RTLH  N P
Sbjct:  290 ISCDALFTLFGCYGDVQRVKILFNKKDTALVQFANVHQAQTAIGHLNGVRVFGKEMKVTNSKHTSVSLPKEGE----DTNLTKDYMNSPLHRFKKPGSKNFQNIFPPSRTLHLSNIP 402          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Nematostella
Match: EDO35536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLA0])

HSP 1 Score: 86.2705 bits (212), Expect = 3.095e-19
Identity = 48/131 (36.64%), Postives = 75/131 (57.25%), Query Frame = 2
Query:  893 VFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKIL---EPNRTLHFFNAP 1273
            + MVY L    +  + +FN+FCLYGNV KV+FL N+PG  MVQM  K + +  I+  +   +F  ++ ++    P I  S  +  LP+ +P+  +F+ + NNRF  D+    + ++    P R LHFFNAP
Sbjct:    1 MLMVYGLNHEKMNCERIFNLFCLYGNVIKVKFLTNKPGACMVQMSDKIASEMIIRNLSGATIFDNKINIMFSKHPFIADSSVVTALPDSSPSAMNFADNRNNRFKYDNMPFLDSVVGYQPPTRMLHFFNAP 131          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Medaka
Match: hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:101175582])

HSP 1 Score: 119.013 bits (297), Expect = 8.393e-28
Identity = 61/180 (33.89%), Postives = 108/180 (60.00%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-----SQSINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V+E++L +  +++G+++ +  + N    L+E+ + N ++T V  +     YI  H   + YS     S+  +S D++S++   N+L   + N  YPIT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:   49 VTEADLVEALQEFGAISYVVVMPNKRQALVEYEDMNGSSTAVTYAADNQVYIAGHPAFINYSTSKKISRPGDSDDSRSVN---NVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 222          

HSP 2 Score: 108.997 bits (271), Expect = 1.740e-24
Identity = 55/127 (43.31%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  893 VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNA 1270
            V MVY L P  +  D +FNIFCLYGNV +V+F+ ++PG  MV+MG   +VD  I + N+  LFGQ++ +    +  I P ++ E L +G+ +FKDF    NNRF +      N+I  P+  LHFFNA
Sbjct:  308 VVMVYGLDPVKMNADRVFNIFCLYGNVERVKFMKSKPGACMVEMGDCYAVDRAITHLNNNFLFGQKLNVCVSKQQAIVPGQSYE-LEDGSSSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNA 433          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Medaka
Match: hnrnpl (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:101175582])

HSP 1 Score: 119.013 bits (297), Expect = 9.282e-28
Identity = 61/180 (33.89%), Postives = 108/180 (60.00%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-----SQSINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V+E++L +  +++G+++ +  + N    L+E+ + N ++T V  +     YI  H   + YS     S+  +S D++S++   N+L   + N  YPIT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:   49 VTEADLVEALQEFGAISYVVVMPNKRQALVEYEDMNGSSTAVTYAADNQVYIAGHPAFINYSTSKKISRPGDSDDSRSVN---NVLLFTIMNPIYPITTDVLYTICNNCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 222          

HSP 2 Score: 108.997 bits (271), Expect = 1.760e-24
Identity = 55/127 (43.31%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  893 VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNA 1270
            V MVY L P  +  D +FNIFCLYGNV +V+F+ ++PG  MV+MG   +VD  I + N+  LFGQ++ +    +  I P ++ E L +G+ +FKDF    NNRF +      N+I  P+  LHFFNA
Sbjct:  319 VVMVYGLDPVKMNADRVFNIFCLYGNVERVKFMKSKPGACMVEMGDCYAVDRAITHLNNNFLFGQKLNVCVSKQQAIVPGQSYE-LEDGSSSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNA 444          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Medaka
Match: ENSORLT00000000593.2 (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:101166731])

HSP 1 Score: 112.079 bits (279), Expect = 1.529e-25
Identity = 61/180 (33.89%), Postives = 104/180 (57.78%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSI----NSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L    +++G+++ +  +      L+E+ + N +   V  +     YI  H   + YS SQ I    +S D +S++   N+L + + N  YPIT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:   52 VMEADLVDALQEFGAISYVVMMPKKRQALVEYEDVNASCNAVTFAAENQVYIAGHPAFINYSTSQKISRPGDSDDTRSVN---NVLLLTILNPIYPITTDVLYTICNNCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 225          

HSP 2 Score: 109.383 bits (272), Expect = 1.041e-24
Identity = 57/127 (44.88%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  893 VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNA 1270
            V MVY L P  I  D +FNIFCLYGNV +V+F+ ++PG AMV+MG   SVD  I + N+  LFGQ++ +    +  I P ++ + L + T +FKDF    NNRF +      N+I  P+  LHFFNA
Sbjct:  311 VLMVYGLEPSKINADKVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYSVDRAITHLNNNFLFGQKLNVCVSKQQAIVPGQSYQ-LEDNTSSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNA 436          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Medaka
Match: ENSORLT00000000591.2 (heterogeneous nuclear ribonucleoprotein L [Source:NCBI gene;Acc:101166731])

HSP 1 Score: 111.694 bits (278), Expect = 2.192e-25
Identity = 61/180 (33.89%), Postives = 104/180 (57.78%), Query Frame = 2
Query:   92 VSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSI----NSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFT 616
            V E++L    +++G+++ +  +      L+E+ + N +   V  +     YI  H   + YS SQ I    +S D +S++   N+L + + N  YPIT D++  IC   G + RI I +KN    V+ +VEFD +  A+ AK +L+G DIYSGCC+L ++Y+K + + V +ND ++WD+T
Sbjct:   52 VMEADLVDALQEFGAISYVVMMPKKRQALVEYEDVNASCNAVTFAAENQVYIAGHPAFINYSTSQKISRPGDSDDTRSVN---NVLLLTILNPIYPITTDVLYTICNNCGPVQRIVIFRKNG---VQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYT 225          

HSP 2 Score: 109.768 bits (273), Expect = 1.124e-24
Identity = 57/127 (44.88%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  893 VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNA 1270
            V MVY L P  I  D +FNIFCLYGNV +V+F+ ++PG AMV+MG   SVD  I + N+  LFGQ++ +    +  I P ++ + L + T +FKDF    NNRF +      N+I  P+  LHFFNA
Sbjct:  323 VLMVYGLEPSKINADKVFNIFCLYGNVERVKFMKSKPGAAMVEMGDCYSVDRAITHLNNNFLFGQKLNVCVSKQQAIVPGQSYQ-LEDNTSSFKDFHGSRNNRFTSPEQAAKNRIQHPSNVLHFFNA 448          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Medaka
Match: HNRNPLL (heterogeneous nuclear ribonucleoprotein L like [Source:NCBI gene;Acc:101169581])

HSP 1 Score: 110.538 bits (275), Expect = 3.972e-25
Identity = 62/180 (34.44%), Postives = 104/180 (57.78%), Query Frame = 2
Query:   89 TVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYS-SQSINSIDNKSLDHSTN-ILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEF-DKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTK 619
             V E++L +  +++G++  +  +      L+EF    +A   V     +P YI   +    +S SQ I    N     S N +L +++ N  YPIT D++  +C   G +LRI I K+N    ++ +VE+ D +S+A+ AK AL+G DIYSGCC+L ++Y++ + + V+RND+ SWD+TK
Sbjct:   63 AVVEADLVEALEKFGTICYVMMMPFKRQALVEFDSVESAERCVTCGGREPVYIADQQAFFNFSTSQRITRPTNADDPTSKNKVLLLSIQNPLYPITTDVLYTVCNPVGNVLRIVIFKRN---GIQAMVEYPDSLSDAQKAKLALNGADIYSGCCTLKIEYARPNRLNVVRNDNTSWDYTK 239          

HSP 2 Score: 92.0485 bits (227), Expect = 1.964e-23
Identity = 49/128 (38.28%), Postives = 77/128 (60.16%), Query Frame = 2
Query:  893 VFMVYNL-PFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V MV  L P  +    +FN+FCLYGNV KV+F+ + PGTA+V+MG + +VD  + + N   +FG+++ +    +  + PS+  E L + + +++DFS   NNRF + H  + N I  P   LHF+N P
Sbjct:  295 VAMVSGLHPSKMNCSRIFNLFCLYGNVEKVKFMKSVPGTALVEMGDEYAVDRAVTHLNGIKVFGKKLNVCVSKQQAVIPSQVFE-LADCSSSYQDFSLTRNNRFSSAHS-SRNIIQPPAAVLHFYNGP 420          

HSP 3 Score: 37.7354 bits (86), Expect = 1.964e-23
Identity = 25/72 (34.72%), Postives = 36/72 (50.00%), Query Frame = 1
Query: 1285 ESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFS 1500
            +  L  +  +  VP  +   +F+ K    K   GL EF    +++ AL+VLNH  I IP  +  F LKL FS
Sbjct:  425 QHQLLKLCSEHSVPSFIKFKVFDAKPSS-KTLSGLLEFDSKTEAIEALTVLNHHQIRIPGISNPFTLKLCFS 495          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Planmine SMEST
Match: SMESG000058661.1 (SMESG000058661.1)

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 421/422 (99.76%), Postives = 421/422 (99.76%), Query Frame = 2
Query:   11 MSHQNLDKKFNIKNNNQTILATDIPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPMHPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNLPFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAPY 1276
            MSHQNLDKKFNIKNNNQTILATDIPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGNPSMYPPIYNYPPPISYHNPIPVTPMHPFGCPNLLYNY NLQKNSKIKPKLDINKDAFVIESGVVFMVYNLPFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAPY
Sbjct:    1 MSHQNLDKKFNIKNNNQTILATDIPLTVSESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSINSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGNPSMYPPIYNYPPPISYHNPIPVTPMHPFGCPNLLYNYTNLQKNSKIKPKLDINKDAFVIESGVVFMVYNLPFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAPY 422          

HSP 2 Score: 478.019 bits (1229), Expect = 0.000e+0
Identity = 232/243 (95.47%), Postives = 236/243 (97.12%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSAREPKNVTQTYGDNKRSISVRENDESNPSKRVKSEKKEELCKDEIKQELGAEIDIGLCSSKEINETQPDEKDLITNNGWHGEISQTAEESQLGGYVIHCKVKSENIDCVIETPEEIGEIDPHQERIDINFNHSLRQSNVSCTPDPFNLLVESTAIPIADEIR 1986
            FF     FLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSAREPKNVTQTYGDNKRSISVRENDESNPSKRVKSEKKEELCKDEIKQELGA+IDIGLCSSKEI+ETQPDEKDLITNNGWHGEISQTAEESQLGGYVIHCKVKSENIDCVIETPEE+GEIDPHQERIDINFNHSL QSN+SC PDPFNLLVESTAIPIADEIR
Sbjct:  417 FFNAPYTFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFSAREPKNVTQTYGDNKRSISVRENDESNPSKRVKSEKKEELCKDEIKQELGADIDIGLCSSKEISETQPDEKDLITNNGWHGEISQTAEESQLGGYVIHCKVKSENIDCVIETPEEMGEIDPHQERIDINFNHSLSQSNISCAPDPFNLLVESTAIPIADEIR 659          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Planmine SMEST
Match: SMESG000005298.1 (SMESG000005298.1)

HSP 1 Score: 95.9005 bits (237), Expect = 4.829e-21
Identity = 48/129 (37.21%), Postives = 81/129 (62.79%), Query Frame = 2
Query:  893 VFMVY--NLPFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            V M+Y  NL F  C D+LFN+ C+YGNV K++FL ++ G+AMVQM   +S+D  +   +++ LFG+ ++     +P I        LP+GT +FKD+++   NRF+       N++  P++T++++NAP
Sbjct:  302 VAMIYGLNLEFVNC-DNLFNLLCIYGNVIKIKFLKSKEGSAMVQMSDGASIDRMMHLLHNQPLFGKTLQFQISKQPVIMDVPAPYKLPDGTVSFKDYTNCRENRFVTPQLAEKNRVFPPSKTINYWNAP 429          

HSP 2 Score: 25.409 bits (54), Expect = 4.829e-21
Identity = 13/43 (30.23%), Postives = 24/43 (55.81%), Query Frame = 1
Query: 1372 KKCIGLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFS 1500
            K   GL ++  +E+++ A+++ NH  I        + LKL+FS
Sbjct:  460 KSSSGLLQWASVEEAINAIALCNHIMIESEGAKFPYQLKLSFS 502          

HSP 3 Score: 96.2857 bits (238), Expect = 1.661e-20
Identity = 56/205 (27.32%), Postives = 109/205 (53.17%), Query Frame = 2
Query:   98 ESELYKIFKQYGSVNKIQKLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQS----INSIDNKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDESWDFTKSQV----KQGILKPPVNGSVSSNTINM 688
            E ++ +  +++G +  I  +      L+EF    +A  +V+  +    +I +   K+ +S+       +   N+++  +  +L   + +  YPI VD+I +IC   G+++R+FI +K   +I++ LVEF  + +A   K  L+G DIYSGCC+L ++Y+  + V V++N ++S+DF    +     Q +L  P N  ++S    M
Sbjct:   34 EIDVSRAMEKFGPIRDIAMIPKRRQALVEFENLVSAQEVVKRYRNDFIHIANRPAKINFSTSEHVLKRSGPLNEAVSTANKVLIFFIYDAVYPINVDVINKICKPHGRVVRVFINRKA--SIMQALVEFYSLDDAIRVKRNLNGADIYSGCCTLKIEYATTNRVNVIQNSEDSYDFEAPSMGMRSSQSLLGLPSNNEMASRVSMM 236          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Planmine SMEST
Match: SMESG000068328.1 (SMESG000068328.1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.743e-19
Identity = 46/131 (35.11%), Postives = 71/131 (54.20%), Query Frame = 2
Query:  887 GVVFMVYNLPFTICVDHLFNIFCLYGNVSKVRFLLNQPG--TAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            GVV    NL   I  D+LFN+FCLYGNV K++ +  + G  +A VQM ++ + + C+   N   +FG+ + +      +I      + +PN  P  + F SD  NRF +    +  K+  P++TLHFFN P
Sbjct:  305 GVVLFCANLSSKIQPDNLFNLFCLYGNVEKIK-MGPETGLKSAFVQMSNREAAEFCLM-VNGYEIFGKPVEISISKFSDI-----TDTIPNKDPV-QSFYSDFYNRFKSSFS-SKTKVFFPSQTLHFFNVP 426          

HSP 2 Score: 47.7506 bits (112), Expect = 1.743e-19
Identity = 22/83 (26.51%), Postives = 46/83 (55.42%), Query Frame = 1
Query: 1258 FFQCSLPFLESDLSNMIMQSGVPRPLNIIIFNNKNDHVKKCI--GLFEFHRLEDSLVALSVLNHKPIIIPDTNQVFHLKLTFS 1500
            FF     F   +++++ + + V  P  ++IF  KN   +  +  GL EF  + +++  + ++NH  +++P  +  FH+KL+FS
Sbjct:  422 FFNVPSTFTAEEIADVFISAKVKDPSQVVIFPRKNSSQRGSLVTGLIEFDSVSEAIEGVVMVNHTRLLLPQVSHPFHIKLSFS 504          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Planmine SMEST
Match: SMESG000033951.1 (SMESG000033951.1)

HSP 1 Score: 69.707 bits (169), Expect = 4.667e-12
Identity = 86/336 (25.60%), Postives = 139/336 (41.37%), Query Frame = 2
Query:  329 ILNINVSNVK-YPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMS---------------SVPVLRNDDE-SWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPM---HPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            IL + + N+K Y I   +I ++  +FGK+LRI I  KN+    +CLVE D    A  +   L+G+D+++ CC L +++SK +               +V  L+ D++ S  F   Q K     PP     S +T+ + Q          +          P          P   P  L   +        +P +     A  I+S ++ +V NL +  +  D +F +F +YG+VSKV       G A+V M + S  +T  ++ N   LFG+ +        EI          N     K F++   +RF   +  N   I  P+  LH  N P
Sbjct:  243 ILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQ--CQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPP-QQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSII-LVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPG-EIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIP 573          
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Planmine SMEST
Match: SMESG000033951.1 (SMESG000033951.1)

HSP 1 Score: 69.707 bits (169), Expect = 4.696e-12
Identity = 86/336 (25.60%), Postives = 139/336 (41.37%), Query Frame = 2
Query:  329 ILNINVSNVK-YPITVDIIKQICLKFGKILRIFIGKKNLDNIVECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMS---------------SVPVLRNDDE-SWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGXXXXXXXXXXXXXXXXXXXXXXVTPM---HPFGCPXXXXXXXXXQKNSKIKPKLDINKDAFVIESGVVFMVYNLPFT-ICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCIQYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRFLNDHGINSNKILEPNRTLHFFNAP 1273
            IL + + N+K Y I   +I ++  +FGK+LRI I  KN+    +CLVE D    A  +   L+G+D+++ CC L +++SK +               +V  L+ D++ S  F   Q K     PP     S +T+ + Q          +          P          P   P  L   +        +P +     A  I+S ++ +V NL +  +  D +F +F +YG+VSKV       G A+V M + S  +T  ++ N   LFG+ +        EI          N     K F++   +RF   +  N   I  P+  LH  N P
Sbjct:  241 ILRVVIENLKNYNINHLVILKVFQRFGKVLRIIIFTKNMQ--CQCLVELDNSISAHVSLLHLNGQDLFNDCCRLKIEFSKNTDSLQIQRQNDKCRDYTVSPLQEDEQFSLHFLDWQAKSVSTVPP-QQYPSLSTVPLLQTQVQKPLYSDFLPNNLFYTVMPNVFKSTFQPSPVAIPESLLISDCAINPLYQEPIVKPPSSANAIDSSII-LVSNLNYEKVNTDSIFTLFGVYGDVSKVCISPPSVGAALVYMQTNSQAETACRHLNLVPLFGKIISTYLLPG-EIVAQSIFNTELNSDIEVKHFTNTPLHRFKKPNSKNHFNIYPPSSVLHLSNIP 571          
The following BLAST results are available for this feature:
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPL4.513e-2942.19heterogeneous nuclear ribonucleoprotein L [Source:... [more]
HNRNPL4.513e-2942.19heterogeneous nuclear ribonucleoprotein L [Source:... [more]
HNRNPL6.082e-2942.19heterogeneous nuclear ribonucleoprotein L [Source:... [more]
HNRNPL6.082e-2942.19heterogeneous nuclear ribonucleoprotein L [Source:... [more]
HNRNPL7.554e-2942.19heterogeneous nuclear ribonucleoprotein L [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrpl-14.946e-2228.81Heterogeneous nuclear RibonucleoProtein (HnRNP) L ... [more]
hrpl-12.580e-2033.52Heterogeneous nuclear RibonucleoProtein (HnRNP) L ... [more]
hrpl-12.580e-2033.52Heterogeneous nuclear RibonucleoProtein (HnRNP) L ... [more]
ptb-11.452e-1828.02PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
ptb-13.275e-1630.51PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sm6.138e-4833.83gene:FBgn0003435 transcript:FBtr0301609[more]
sm1.123e-4733.04gene:FBgn0003435 transcript:FBtr0304655[more]
sm2.922e-4733.53gene:FBgn0003435 transcript:FBtr0100232[more]
sm2.922e-4733.53gene:FBgn0003435 transcript:FBtr0086492[more]
sm4.337e-4733.83gene:FBgn0003435 transcript:FBtr0308796[more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptbp31.578e-3025.05polypyrimidine tract binding protein 3 [Source:ZFI... [more]
ptbp31.578e-3025.05polypyrimidine tract binding protein 3 [Source:ZFI... [more]
ptbp32.020e-3025.05polypyrimidine tract binding protein 3 [Source:ZFI... [more]
hnrnpl21.453e-2944.88heterogeneous nuclear ribonucleoprotein L2 [Source... [more]
hnrnpl21.657e-2944.88heterogeneous nuclear ribonucleoprotein L2 [Source... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
admp6.928e-4831.31anti-dorsalizing morphogenic protein [Source:Xenba... [more]
admp1.130e-4630.79anti-dorsalizing morphogenic protein [Source:Xenba... [more]
admp1.196e-4630.71anti-dorsalizing morphogenic protein [Source:Xenba... [more]
admp6.443e-4630.34anti-dorsalizing morphogenic protein [Source:Xenba... [more]
taco11.141e-2924.66translational activator of mitochondrially encoded... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnrnpl1.092e-2942.97heterogeneous nuclear ribonucleoprotein L [Source:... [more]
Hnrnpl1.092e-2942.97heterogeneous nuclear ribonucleoprotein L [Source:... [more]
Hnrnpl1.746e-2942.97heterogeneous nuclear ribonucleoprotein L [Source:... [more]
Hnrnpl1.783e-2942.97heterogeneous nuclear ribonucleoprotein L [Source:... [more]
Ptbp34.236e-2724.31polypyrimidine tract binding protein 3 [Source:MGI... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R081|HNRPL_MOUSE6.638e-2942.97Heterogeneous nuclear ribonucleoprotein L OS=Mus m... [more]
sp|F1LQ48|HNRPL_RAT1.143e-2842.97Heterogeneous nuclear ribonucleoprotein L OS=Rattu... [more]
sp|P14866|HNRPL_HUMAN1.987e-2842.19Heterogeneous nuclear ribonucleoprotein L OS=Homo ... [more]
sp|Q9Z118|PTBP3_RAT7.263e-2724.77Polypyrimidine tract-binding protein 3 OS=Rattus n... [more]
sp|O95758|PTBP3_HUMAN2.882e-2624.94Polypyrimidine tract-binding protein 3 OS=Homo sap... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4V6K32.596e-17478.25HnRNP L protein OS=Dugesia japonica OX=6161 PE=2 S... [more]
A0A3S5AMB83.138e-5830.43Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A3S5BVH41.907e-5430.94Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A401SLC62.285e-5332.10Uncharacterized protein (Fragment) OS=Chiloscylliu... [more]
A0A4Z2CYV49.657e-5330.90Heterogeneous nuclear ribonucleoprotein L isoform ... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpl23.397e-5031.31heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl26.533e-5031.06heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl5.442e-4329.16heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl21.788e-2744.09heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl22.159e-2744.09heterogeneous nuclear ribonucleoprotein L [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
HNRNPLL8.172e-3043.75heterogeneous nuclear ribonucleoprotein L like [So... [more]
HNRNPLL1.993e-2633.88heterogeneous nuclear ribonucleoprotein L like [So... [more]
ENSPMAT00000006507.17.895e-1732.85pep scaffold:Pmarinus_7.0:GL480554:3468:10153:1 ge... [more]
ENSPMAT00000006509.12.273e-632.29pep scaffold:Pmarinus_7.0:GL480554:3489:6552:1 gen... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO391191.698e-3929.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355373.670e-2332.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439953.665e-2028.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355363.095e-1936.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpl8.393e-2833.89heterogeneous nuclear ribonucleoprotein L [Source:... [more]
hnrnpl9.282e-2833.89heterogeneous nuclear ribonucleoprotein L [Source:... [more]
ENSORLT00000000593.21.529e-2533.89heterogeneous nuclear ribonucleoprotein L [Source:... [more]
ENSORLT00000000591.22.192e-2533.89heterogeneous nuclear ribonucleoprotein L [Source:... [more]
HNRNPLL3.972e-2534.44heterogeneous nuclear ribonucleoprotein L like [So... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein L vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058661.10.000e+099.76SMESG000058661.1[more]
SMESG000005298.14.829e-2137.21SMESG000005298.1[more]
SMESG000068328.11.743e-1935.11SMESG000068328.1[more]
SMESG000033951.14.667e-1225.60SMESG000033951.1[more]
SMESG000033951.14.696e-1225.60SMESG000033951.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007400 ID=SMED30007400|Name=Heterogeneous nuclear ribonucleoprotein L|organism=Schmidtea mediterranea sexual|type=transcript|length=2234bp
TCCATTACAAATGAGTCATCAAAACTTAGATAAAAAATTTAATATTAAAA
ATAACAATCAGACCATATTGGCTACAGACATTCCTCTAACTGTATCAGAA
TCTGAACTATATAAGATTTTTAAACAGTATGGATCTGTTAATAAAATCCA
AAAGCTTTCAAATTTATCTTGCTGTTTAATTGAATTTTCAGAAAGTAATA
CAGCAACAACTCTTGTTCAAAATTCAAAAATCAAGCCATTTTACATTGAA
TCACACAAAATTAAATTAGAATATTCATCTCAATCAATTAACTCGATTGA
TAATAAATCTCTTGACCATTCAACAAATATATTAAACATTAATGTGTCAA
ATGTAAAATATCCTATTACTGTGGATATAATTAAGCAGATTTGCCTAAAA
TTCGGCAAGATATTACGAATTTTTATTGGCAAAAAGAATTTAGATAATAT
TGTTGAATGTCTAGTAGAATTTGATAAAATTTCTGAAGCCAAATCTGCCA
AAGAAGCTTTACACGGAGAAGATATATATTCTGGCTGTTGTTCCTTAGAT
GTTAAATATTCAAAAATGTCCAGCGTCCCGGTATTAAGAAATGATGATGA
GTCTTGGGATTTTACTAAATCACAAGTTAAGCAGGGTATTTTAAAACCAC
CAGTCAATGGATCCGTTTCAAGTAATACTATTAATATGTTTCAAGCAGGT
AATCCATCTATGTACCCTCCTATTTATAACTATCCTCCACCAATTTCATA
TCATAATCCTATACCCGTTACGCCAATGCATCCTTTCGGTTGCCCAAATT
TGCTTTATAATTATAATAATTTACAAAAAAATTCCAAAATCAAACCAAAA
TTAGATATTAATAAAGACGCGTTTGTAATTGAATCAGGAGTTGTATTTAT
GGTTTATAATTTGCCGTTTACTATTTGTGTGGATCATTTGTTCAACATTT
TTTGTTTGTATGGAAATGTCAGTAAAGTTAGATTTCTCCTGAACCAACCG
GGTACCGCAATGGTGCAAATGGGTTCCAAATCATCCGTGGACACGTGTAT
TCAGTATTACAACAGTAAAAATCTATTCGGTCAAGAAATGCGACTTGTGA
AATGTTCTAAACCGGAAATTTTTCCATCTAAAACAATCGAGTTTCTCCCA
AACGGGACTCCAGCTTTTAAAGACTTTTCTTCCGATGCTAACAATCGATT
TTTGAATGATCACGGAATAAACAGTAATAAAATCCTCGAACCGAATCGAA
CACTTCATTTTTTCAATGCTCCTTACCTTTCCTCGAATCCGATTTGAGTA
ACATGATTATGCAATCCGGTGTTCCGAGACCTTTGAATATTATCATTTTC
AACAATAAGAATGACCACGTGAAAAAGTGTATTGGACTGTTTGAATTCCA
CCGGCTTGAAGATTCATTAGTCGCTCTATCGGTGCTCAATCACAAGCCAA
TCATAATTCCAGATACGAATCAAGTCTTTCATTTGAAGTTGACATTTAGC
GCCCGGGAACCGAAAAATGTCACCCAAACCTATGGCGACAATAAGCGATC
GATTTCAGTCCGAGAAAATGATGAGTCGAATCCGAGCAAGCGAGTGAAAA
GTGAAAAGAAAGAAGAATTGTGCAAAGATGAGATTAAACAAGAGCTCGGT
GCAGAAATCGATATTGGATTGTGCTCCTCGAAAGAAATAAATGAAACTCA
ACCCGATGAGAAAGATTTAATTACAAACAACGGTTGGCACGGGGAAATTA
GCCAGACGGCCGAGGAATCCCAGTTGGGCGGTTACGTAATCCACTGCAAA
GTTAAATCGGAAAATATCGATTGTGTCATTGAAACCCCAGAGGAAATTGG
CGAAATAGATCCACACCAGGAACGGATCGATATTAATTTCAATCATTCGC
TTAGACAATCAAATGTCAGCTGCACTCCGGATCCGTTCAATCTATTGGTC
GAATCAACTGCGATCCCAATAGCTGACGAAATCCGTTCCGACCTGCTCAG
TGATTAATTGCACTCAATCGATCATTTCCTCGCTTGGATTCCGATGATTC
CCGCTAGATAAAAGTGCCTCTTAAGTTTCCCTTGATTAAAAATCGACCCG
TTAGAAAATTAAACAATCAACATTCTGAAATACGGATCAGCTTTGTAAAA
TTGTACTTTTAGATCATTTTAATTTTGTATGATGAAGATTATTGCTATTT
TGTATATTGTGTATTTAATTGTATTGAATAAATG
back to top

protein sequence of SMED30007400-orf-1

>SMED30007400-orf-1 ID=SMED30007400-orf-1|Name=SMED30007400-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=432bp
PLQMSHQNLDKKFNIKNNNQTILATDIPLTVSESELYKIFKQYGSVNKIQ
KLSNLSCCLIEFSESNTATTLVQNSKIKPFYIESHKIKLEYSSQSINSID
NKSLDHSTNILNINVSNVKYPITVDIIKQICLKFGKILRIFIGKKNLDNI
VECLVEFDKISEAKSAKEALHGEDIYSGCCSLDVKYSKMSSVPVLRNDDE
SWDFTKSQVKQGILKPPVNGSVSSNTINMFQAGNPSMYPPIYNYPPPISY
HNPIPVTPMHPFGCPNLLYNYNNLQKNSKIKPKLDINKDAFVIESGVVFM
VYNLPFTICVDHLFNIFCLYGNVSKVRFLLNQPGTAMVQMGSKSSVDTCI
QYYNSKNLFGQEMRLVKCSKPEIFPSKTIEFLPNGTPAFKDFSSDANNRF
LNDHGINSNKILEPNRTLHFFNAPYLSSNPI*
back to top

protein sequence of SMED30007400-orf-2

>SMED30007400-orf-2 ID=SMED30007400-orf-2|Name=SMED30007400-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=235bp
MIMQSGVPRPLNIIIFNNKNDHVKKCIGLFEFHRLEDSLVALSVLNHKPI
IIPDTNQVFHLKLTFSAREPKNVTQTYGDNKRSISVRENDESNPSKRVKS
EKKEELCKDEIKQELGAEIDIGLCSSKEINETQPDEKDLITNNGWHGEIS
QTAEESQLGGYVIHCKVKSENIDCVIETPEEIGEIDPHQERIDINFNHSL
RQSNVSCTPDPFNLLVESTAIPIADEIRSDLLSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR021790PTBP1_RRM
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0005515protein binding
GO:0036002pre-mRNA binding
Vocabulary: biological process
TermDefinition
GO:0000381regulation of alternative mRNA splicing, via spliceosome
GO:0006397mRNA processing
GO:0008380RNA splicing
GO:0033119negative regulation of RNA splicing
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0048025negative regulation of mRNA splicing, via spliceosome
GO:0051148negative regulation of muscle cell differentiation
GO:0075522IRES-dependent viral translational initiation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016020membrane
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 295..363
e-value: 6.3E-5
score: 32.4
coord: 109..180
e-value: 1.3E-4
score: 31.3
coord: 18..87
e-value: 3.1E-4
score: 30.1
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 23..70
e-value: 2.0E-4
score: 21.1
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 17..91
score: 10.991
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 294..367
score: 9.814
IPR021790PTBP1, RNA recognition motif 2-likePFAMPF11835RRM_8coord: 103..185
e-value: 1.3E-12
score: 47.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 290..390
e-value: 1.7E-21
score: 78.2
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 3..105
e-value: 4.2E-13
score: 51.3
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 106..209
e-value: 7.2E-28
score: 98.5
NoneNo IPR availablePFAMPF13893RRM_5coord: 291..391
e-value: 2.0E-28
score: 98.5
NoneNo IPR availablePANTHERPTHR15592:SF18HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN Lcoord: 15..428
NoneNo IPR availablePANTHERPTHR15592MATRIN 3/NUCLEAR PROTEIN 220-RELATEDcoord: 15..428
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 104..205
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 10..90
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 293..370