tetratricopeptide repeat protein 38

Overview
Nametetratricopeptide repeat protein 38
Smed IDSMED30007392
Length (bp)1916
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tetratricopeptide repeat protein 38 (SMED30007392) t-SNE clustered cells

Violin plots show distribution of expression levels for tetratricopeptide repeat protein 38 (SMED30007392) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tetratricopeptide repeat protein 38 (SMED30007392) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tetratricopeptide repeat protein 38 (SMED30007392) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Human
Match: TTC38 (tetratricopeptide repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:26082])

HSP 1 Score: 185.652 bits (470), Expect = 3.201e-51
Identity = 131/470 (27.87%), Postives = 221/470 (47.02%), Query Frame = 1
Query:   55 SKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT---SGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSD---RFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFN--EGGHENQAR 1440
            S +RD        + LST+SNE  KL+D+ L Q+          G +GCL ++++ DP F +   +   L    +G        L + +K   E     +  +  E+LH  A     +G    A E W + +  HP D+LAL++ +D Y   G   ++ ++ +      +       ++ G  +FGL E    +++ KLA E+L I P ++WS+HT+AHI E K    +G+EFM  ++  W  S  LACHN WH AL+ + +G+  +AL I+DT I+P L++  +   + D+ ++L R+++           +++ +RW  +   + +  +      F DAH  MA L  +  +   ++L    D                       A ++P +     + R   L P  +A+   ++G+    + LL PIR  + +LGGSNAQ D+F Q L  A  N     H+N AR
Sbjct:    5 SPLRDCQAWKDARLPLSTTSNEACKLFDATLTQYVKWTNDKSLGGIEGCLSKLKAADPTFVMGHAMATGLVLIGTGSSVKLDKELDLAVKTMVEISR-TQPLTRREQLHVSAVETFANGNFPKACELWEQILQDHPTDMLALKFSHDAYFYLGYQEQMRDSVARIYPFWTPDIPLSSYVKGIYSFGLMETNFYDQAEKLAKEALSINPTDAWSVHTVAHIHEMKAEIKDGLEFMQHSETFWKDSDMLACHNYWHWALYLIEKGEYEAALTIYDTHILPSLQANDAMLDVVDSCSMLYRLQM---------EGVSVGQRWQDVLP-VARKHSRDHILLFNDAHFLMASLGAHDPQTTQELLTTLRD-----------------------ASESPGENCQHLLARDVGL-PLCQALVEAEDGNPDRVLELLLPIRYRIVQLGGSNAQRDVFNQLLIHAALNCTSSVHKNVAR 439          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Human
Match: TTC38 (tetratricopeptide repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:26082])

HSP 1 Score: 87.0409 bits (214), Expect = 7.054e-19
Identity = 56/198 (28.28%), Postives = 97/198 (48.99%), Query Frame = 1
Query:  193 QGCLERIQSIDPDFPLTKLITFDLT---SGDFESNLSNLKIELKEQFE---NKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDW 768
            +GCL ++++ DP F +   +   L    +G        L + +K   E    + L R+    E+LH  A     +G    A E W + +  HP D+LAL++ +D Y   G   ++ ++ +      +       ++ G  +FGL E    +++ KLA E+L I P ++WS+HT+AHI E K    +G+EFM  ++  W
Sbjct:    2 EGCLSKLKAADPTFVMGHAMATGLVLIGTGSSVKLDKELDLAVKTMVEISRTQPLTRR----EQLHVSAVETFANGNFPKACELWEQILQDHPTDMLALKFSHDAYFYLGYQEQMRDSVARIYPFWTPDIPLSSYVKGIYSFGLMETNFYDQAEKLAKEALSINPTDAWSVHTVAHIHEMKAEIKDGLEFMQHSETFW 195          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Human
Match: TTC38 (tetratricopeptide repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:26082])

HSP 1 Score: 72.4034 bits (176), Expect = 1.917e-13
Identity = 55/210 (26.19%), Postives = 95/210 (45.24%), Query Frame = 1
Query:   55 SKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT---SGDFESNLSNLKIELKEQFE---NKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGIC 666
            S +RD        + LST+SNE  KL+D+ L Q+          G +GCL ++++ DP F +   +   L    +G        L + +K   E    + L R+    E+LH  A     +G    A E W + +  HP D+LAL++ +D Y   G   ++ ++ +      +       ++ G  +FGL E    +++ KLA E+  +C
Sbjct:    5 SPLRDCQAWKDARLPLSTTSNEACKLFDATLTQYVKWTNDKSLGGIEGCLSKLKAADPTFVMGHAMATGLVLIGTGSSVKLDKELDLAVKTMVEISRTQPLTRR----EQLHVSAVETFANGNFPKACELWEQILQDHPTDMLALKFSHDAYFYLGYQEQMRDSVARIYPFWTPDIPLSSYVKGIYSFGLMETNFYDQAEKLAKEAPTLC 210          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Human
Match: TTC38 (tetratricopeptide repeat domain 38 [Source:HGNC Symbol;Acc:HGNC:26082])

HSP 1 Score: 47.7506 bits (112), Expect = 3.821e-6
Identity = 26/66 (39.39%), Postives = 38/66 (57.58%), Query Frame = 1
Query: 1258 IPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFN--EGGHENQARLKM 1449
            +P  +A+   ++G+    + LL PIR  + +LGGSNAQ D+F Q L  A  N     H+N AR K+
Sbjct:   43 LPLCQALVEAEDGNPDRVLELLLPIRYRIVQLGGSNAQRDVFNQLLIHAALNCTSSVHKNVARGKV 108          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Celegans
Match: Y54G11A.7 (pep chromosome:WBcel235:II:14297305:14299633:1 gene:WBGene00013216.1 transcript:Y54G11A.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54G11A.7)

HSP 1 Score: 159.458 bits (402), Expect = 2.620e-42
Identity = 131/476 (27.52%), Postives = 212/476 (44.54%), Query Frame = 1
Query:   88 CGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLTSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNL-TERWTA---LSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
             G+ LST+S+E AK  D+ + Q     +     G    +E++ + DP+  + +     L+    E+   N++   K      +  +  +  EK H KA I    G    AA  W + +  +P DL+A+++ +D +   G      NA      K ++    Y ++ G  AFGLEE G  +++   A  +L +  ++ W+ H  AH+ E  G    G EFM +T+ DW     LA HN WHTALF++   +  SAL I+D EI  R     S   M DA +LL R+EL           +N+  +RW     LS  I   + +F+     D HL +A+ R   Q D +             E ++ +  E   +  +L    A   + I      +P  + M  F   DY      +YPIR ++ ++GGS+AQ D+F Q L  +       +N A    L + R+ +   +   QR+
Sbjct:   18 AGLELSTTSDENAKWLDACIRQLVSWSDCTSLGGFHTSIEKLVASDPEAIMARTFLVGLSGLGTEAAARNVEFAKKMDQLEIDAEKYGNAREKRHAKAAILWGRGKHHEAAIEWDKLLDDYPTDLIAVKFSHDAHFFNGNQIGKKNAIEKVIHKWNADLPCYSYLHGMYAFGLEECGIYDDAETQADRALQLNRFDCWASHAKAHVLEMNGRHKEGKEFMYKTEDDWRQGWMLASHNYWHTALFHIEYAEYESALGIFDREIANRFNKTNSLLDMVDASSLLWRLEL---------EGVNVGRDRWRKIEHLSKFIDNHSIVFN-----DVHLGLAIYR---QEDLET------------EKKLRNSLE--KYSSLLSEDNAQISKTIG-----MPLYDGMLDFARCDYDTAAETMYPIRDKVVQIGGSHAQRDLFVQTLIQSCILSKDPKNWALTPELLVERETLKHDSLLGQRL 457          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Celegans
Match: Y54G11A.4 (pep chromosome:WBcel235:II:14292824:14296055:1 gene:WBGene00013215.1 transcript:Y54G11A.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54G11A.4)

HSP 1 Score: 145.976 bits (367), Expect = 1.224e-37
Identity = 119/437 (27.23%), Postives = 194/437 (44.39%), Query Frame = 1
Query:   88 CGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLTSGDFESNLSNLK-IELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFL 1395
             G+ LST+S+E AK  D+ + Q     +     G     E++ S DP+  + +     +T     +N  N++ IE   Q E  +  +  +  EK H K+ I    G    AA  W + +  +P DL+A+ + +  + + G      NA      K ++    Y ++ G  AFGLEE G   ++ K A  +L +  ++ W+ H  AH+ E  G    G EFM +T+ DW     LA HN WHTALF++   +   AL+I+D EI+ R        S  D  +LL R+EL        N   +  E+   LS  IG  +++ +     D  + +A      Q D  +  ++  D ++ Y   + +                  D         +P  + M  F   DY    + +YPIR ++ ++GGSN+Q D+F Q L
Sbjct:   18 AGLELSTTSDENAKWLDACIRQLVSWSDCTSLGGFDASAEKLASSDPEAIMARTFLIGITGIFGVANARNVEFIEKMNQLE-IDAEKYGNAREKRHAKSAILWGRGKHHEAAIEWDKLLDDYPTDLIAVNFSHRAHFNNGNLIGKKNAIEKVIDKWNADLPCYSYLHGMYAFGLEECGIYGDAEKQADRALQLNRFDCWASHAKAHVLEMNGRHKEGKEFMYKTEDDWRQGWMLAAHNYWHTALFHIESAEYEPALEIFDREIVKR-------SSKVDGSSLLWRLEL-----EGVNVGRDRWEKIENLSKFIGDHSSVSN-----DVQIGIATY---MQEDL-ETEKKLRDSLVKYSELLTE------------------DNAQISKTTGVPLYDGMLNFARRDYDTAADTMYPIRDKIVQIGGSNSQRDLFVQTL 414          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Zebrafish
Match: ttc38 (tetratricopeptide repeat domain 38 [Source:NCBI gene;Acc:553728])

HSP 1 Score: 195.667 bits (496), Expect = 2.907e-55
Identity = 133/475 (28.00%), Postives = 223/475 (46.95%), Query Frame = 1
Query:   91 GINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT-SGDFESNLSN--LKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRL-IPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
            G+ LSTSSNE  KL+D+ L Q+          G +GC+  I++ DPDF +  +I+  L   G   S L +  L   ++   E  +  ++ +  EK H KA      G    A E W   +A HP DLLAL++ +D +   G   ++ ++ +        H   Y +I G  +FGL E    +E+ K+A E+L + P + WS+H +AH+ E K     G+ FM  T+ +W+    LACHN WH AL+++ +G+  +AL I+D ++  R     +   + D+ +LL R+EL           +++ ER+  L   + Q  +      F D H  M  L         ++LE   +                       A+    +R +  ++R+ +P  +A+  F++ +Y+  V LL PI++    +GGS+AQ D+F Q L  A    G  E+Q   + + + R  V   +    R+
Sbjct:    7 GLPLSTSSNEACKLYDAILSQYVTWRNDETLGGIEGCITSIKAADPDFVMGHVISTGLELVGTGSSVLRDERLASAVRRTVELAD-TQQLTSREKNHVKAVQLFSKGALHKACEVWECILADHPTDLLALKFAHDGFFYLGEQTQMRDSVARVMPHWKPHMPLYSYIKGMYSFGLLETRLYDEAEKMAKEALSLTPEDGWSVHAVAHVHEMKAEVDKGLNFMASTEKNWMVCDMLACHNYWHWALYHIEKGNYEAALKIFDEQVSQRCVKSGAMLDIVDSCSLLYRLEL---------EGVSVGERYRELLQ-VTQPHSEDHTLLFNDLHFLMVSLGSKDTGTTQRLLESLQEL----------------------AKDPAENRQLQIAERVGLPMCQALLEFEQRNYRQAVELLKPIKQSFVEIGGSDAQRDVFSQLLIHAAMKSGDKEHQQLARCMLMERDAVRPNSPLTDRL 448          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Zebrafish
Match: ttc38 (tetratricopeptide repeat domain 38 [Source:NCBI gene;Acc:553728])

HSP 1 Score: 194.512 bits (493), Expect = 8.641e-55
Identity = 132/475 (27.79%), Postives = 222/475 (46.74%), Query Frame = 1
Query:   91 GINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT-SGDFESNLSN--LKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRL-IPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
            G+ LS+SSNE  KL+D+ L Q+          G +GC+  I++ DPDF +  +I+  L   G   S L +  L   ++   E  +  ++ +  EK H KA      G    A E W   +A HP DLLAL++ +D +   G   ++ ++ +        H   Y +I G  +FGL E    +E+ K+A E+L + P + WS+H +AH+ E K     G+ FM  T+ +W     LACHN WH AL+++ +G+  +AL I+D ++  R     +   + D+ +LL R+EL           +++ ER+  L   + Q  +      F D H  M  L         ++LE   +                       A+    +R +  ++R+ +P  +A+  F++ +Y+  V LL PI++    +GGS+AQ D+F Q L  A    G  E+Q   + + + R  V   +    R+
Sbjct:   17 GLPLSSSSNEACKLYDAILSQYVTWRNDETLGGIEGCITSIKAADPDFVMGHVISTGLELVGTGSSVLRDERLASAVRRTVELAD-TQQLTSREKNHVKAVQLFSKGALHKACEVWECILADHPTDLLALKFAHDGFFYLGEQTQMRDSVARVMPHWKPHMPLYSYIKGMYSFGLLETRLYDEAEKMAKEALSLTPEDGWSVHAVAHVHEMKAEVEKGLNFMASTEKNWTVCDMLACHNYWHWALYHIEKGNYEAALKIFDEQVSQRCVKSGAMLDIVDSCSLLYRLEL---------EGVSVGERYRELLQ-VTQPHSEDHTLLFNDLHFLMVSLGSKDTGTTQRLLESLQEL----------------------AKDPAENRQLQIAERVGLPMCQALLEFEQRNYRQAVELLKPIKQSFVEIGGSDAQRDVFSQLLIHAAMKSGDKEHQQLARCMLMERDAVRPNSPLTDRL 458          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Zebrafish
Match: ttc38 (tetratricopeptide repeat domain 38 [Source:NCBI gene;Acc:553728])

HSP 1 Score: 193.356 bits (490), Expect = 2.868e-54
Identity = 133/475 (28.00%), Postives = 222/475 (46.74%), Query Frame = 1
Query:   91 GINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT-SGDFESNLSN--LKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRL-IPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
            G+ LSTSSNE  KL+D+ L Q+          G +GC+  I++ DPDF +  +I+  L   G   S L +  L   ++   E  +  ++ +  EK H KA      G    A E W   +A HP DLLAL++ +D +   G   ++ ++ +        H   Y  I G  +FGL E    +E+ K+A E+L + P + WS+H +AH+ E K     G+ FM  T+ +W+    LACHN WH AL+++ +G+  +AL I+D ++  R     +   + D+ +LL R+EL           +++ ER+  L   + Q  +      F D H  M  L         ++LE   +                       A+    +R +  ++R+ +P  +A+  F++ +Y+  V LL PI++    +GGS+AQ D+F Q L  A    G  E+Q   + + + R  V   +    R+
Sbjct:   16 GLPLSTSSNEACKLYDAILSQYVTWRNDETLGGIEGCITSIKAADPDFVMGHVISTGLELVGTGSSVLRDERLASAVRRTVELAD-TQQLTSREKNHVKAVQLFSKGALHKACEVWECILADHPTDLLALKFAHDGFFYLGEQTQMRDSVARVMPHWKPHMPLYRQIKGMYSFGLLETRLYDEAEKMAKEALSLTPEDGWSVHAVAHVHEMKAEVDKGLNFMASTEKNWMVCDMLACHNYWHWALYHIEKGNYEAALKIFDEQVSQRCVKSGAMLDIVDSCSLLYRLEL---------EGVSVGERYRELLQ-VTQPHSEDHTLLFNDLHFLMVSLGSKDTGTTQRLLESLQEL----------------------AKDPAENRQLQIAERVGLPMCQALLEFEQRNYRQAVELLKPIKQSFVEIGGSDAQRDVFSQLLIHAAMKSGDKEHQQLARCMLMERDAVRPNSPLTDRL 457          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Zebrafish
Match: ttc38 (tetratricopeptide repeat domain 38 [Source:NCBI gene;Acc:553728])

HSP 1 Score: 189.119 bits (479), Expect = 9.093e-53
Identity = 132/477 (27.67%), Postives = 222/477 (46.54%), Query Frame = 1
Query:   91 GINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT-SGDFESNLSN--LKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYY--PFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRL-IPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
            G+ LS+SSNE  KL+D+ L Q+          G +GC+  I++ DPDF +  +I+  L   G   S L +  L   ++   E  +  ++ +  EK H KA      G    A E W   +A HP DLLAL++ +D +   G   ++ ++ +        H   Y   +I G  +FGL E    +E+ K+A E+L + P + WS+H +AH+ E K     G+ FM  T+ +W     LACHN WH AL+++ +G+  +AL I+D ++  R     +   + D+ +LL R+EL           +++ ER+  L   + Q  +      F D H  M  L         ++LE   +                       A+    +R +  ++R+ +P  +A+  F++ +Y+  V LL PI++    +GGS+AQ D+F Q L  A    G  E+Q   + + + R  V   +    R+
Sbjct:   16 GLPLSSSSNEACKLYDAILSQYVTWRNDETLGGIEGCITSIKAADPDFVMGHVISTGLELVGTGSSVLRDERLASAVRRTVELAD-TQQLTSREKNHVKAVQLFSKGALHKACEVWECILADHPTDLLALKFAHDGFFYLGEQTQMRDSVARVMPHWKPHMPLYRQVYIKGMYSFGLLETRLYDEAEKMAKEALSLTPEDGWSVHAVAHVHEMKAEVEKGLNFMASTEKNWTVCDMLACHNYWHWALYHIEKGNYEAALKIFDEQVSQRCVKSGAMLDIVDSCSLLYRLEL---------EGVSVGERYRELLQ-VTQPHSEDHTLLFNDLHFLMVSLGSKDTGTTQRLLESLQEL----------------------AKDPAENRQLQIAERVGLPMCQALLEFEQRNYRQAVELLKPIKQSFVEIGGSDAQRDVFSQLLIHAAMKSGDKEHQQLARCMLMERDAVRPNSPLTDRL 459          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Zebrafish
Match: ttc38 (tetratricopeptide repeat domain 38 [Source:NCBI gene;Acc:553728])

HSP 1 Score: 49.2914 bits (116), Expect = 1.164e-6
Identity = 25/73 (34.25%), Postives = 39/73 (53.42%), Query Frame = 1
Query:   46 LNTSKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDL 264
            ++ +  RD       G+ LSTSSNE  KL+D+ L Q+          G +GC+  I++ DPDF +  +I+  L
Sbjct:    1 MHAASFRDCKAWQSDGLPLSTSSNEACKLYDAILSQYVTWRNDETLGGIEGCITSIKAADPDFVMGHVISTGL 73          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Xenopus
Match: tbxt (T-box transcription factor T [Source:Xenbase;Acc:XB-GENE-478789])

HSP 1 Score: 176.792 bits (447), Expect = 3.841e-48
Identity = 134/487 (27.52%), Postives = 225/487 (46.20%), Query Frame = 1
Query:   91 GINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDL------TSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLI-----PFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGG--HENQARLKMLFLNRKDVNEYNN-YYQRIEK 1509
            G+ LST+SNEV KL+D+ L Q+          G  GCL RI+  DP+F +  +    L       S   +  L+N    + +  +++ L    +E E LH  A     +G    AA+ W   +  HP DLLAL++ +D Y   G   ++ ++ +              ++ G  +FGL E    +++LK+A E+L +   +SWS+HT+AH+ E + +  +G+ FM  T+ +W  S  LACH  WH AL+++ +GD  +AL ++D  I P+  +  +   + D  ++L R++L           +N+ +RW  L   I ++        F D H  M+ L    +    +++E                        M +  ++P +    +   LI     P   A+  +  G Y    +L+YPIR ++  +GGS+AQ D+F Q L  A  N     H+N AR     L  +D+   N+   QR+ K
Sbjct:   10 GLTLSTTSNEVCKLFDATLTQYATWKNDCTLGGIDGCLSRIKDTDPNFVMGHVAANGLELIGTGRSPRVDKELANAVRVMSDLSKSQAL----TEREMLHVAAVETFANGNLPKAADLWERILQNHPTDLLALKFAHDCYFYLGEQRQMRDSVARVLPYWKPGTPLSSYVKGMYSFGLLETNFYDQALKVAKEALAVDQTDSWSVHTVAHVHEMRADLDSGLAFMQETENNWKGSDMLACHVYWHWALYFIEKGDYEAALTLYDNHIAPQCFASGTMLDVVDNSSMLYRLQL---------EGVNVGDRWKNLLQ-ITKSHTQDHMLIFNDLHFLMSSLGSKDEDMTRELVE-----------------------SMQELSKSPGE---NQQHGLINHLGTPLCRALIEYDRGHYDKAADLMYPIRYQILGIGGSDAQRDLFNQVLIRAAINSSSKYHQNLAR---CLLTERDMGRPNSPLTQRLIK 453          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Xenopus
Match: tbxt (T-box transcription factor T [Source:Xenbase;Acc:XB-GENE-478789])

HSP 1 Score: 176.022 bits (445), Expect = 8.965e-48
Identity = 134/488 (27.46%), Postives = 225/488 (46.11%), Query Frame = 1
Query:   88 CGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDL------TSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLI-----PFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGG--HENQARLKMLFLNRKDVNEYNN-YYQRIEK 1509
             G+ LST+SNEV KL+D+ L Q+          G  GCL RI+  DP+F +  +    L       S   +  L+N    + +  +++ L    +E E LH  A     +G    AA+ W   +  HP DLLAL++ +D Y   G   ++ ++ +              ++ G  +FGL E    +++LK+A E+L +   +SWS+HT+AH+ E + +  +G+ FM  T+ +W  S  LACH  WH AL+++ +GD  +AL ++D  I P+  +  +   + D  ++L R++L           +N+ +RW  L   I ++        F D H  M+ L    +    +++E                        M +  ++P +    +   LI     P   A+  +  G Y    +L+YPIR ++  +GGS+AQ D+F Q L  A  N     H+N AR     L  +D+   N+   QR+ K
Sbjct:   25 AGLTLSTTSNEVCKLFDATLTQYATWKNDCTLGGIDGCLSRIKDTDPNFVMGHVAANGLELIGTGRSPRVDKELANAVRVMSDLSKSQAL----TEREMLHVAAVETFANGNLPKAADLWERILQNHPTDLLALKFAHDCYFYLGEQRQMRDSVARVLPYWKPGTPLSSYVKGMYSFGLLETNFYDQALKVAKEALAVDQTDSWSVHTVAHVHEMRADLDSGLAFMQETENNWKGSDMLACHVYWHWALYFIEKGDYEAALTLYDNHIAPQCFASGTMLDVVDNSSMLYRLQL---------EGVNVGDRWKNLLQ-ITKSHTQDHMLIFNDLHFLMSSLGSKDEDMTRELVE-----------------------SMQELSKSPGE---NQQHGLINHLGTPLCRALIEYDRGHYDKAADLMYPIRYQILGIGGSDAQRDLFNQVLIRAAINSSSKYHQNLAR---CLLTERDMGRPNSPLTQRLIK 469          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Xenopus
Match: tbxt (T-box transcription factor T [Source:Xenbase;Acc:XB-GENE-478789])

HSP 1 Score: 164.081 bits (414), Expect = 8.513e-44
Identity = 122/454 (26.87%), Postives = 209/454 (46.04%), Query Frame = 1
Query:   61 MRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT------SGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLI-----PFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQ-NDIFY 1386
            +RD       G+ LST+SNEV KL+D+ L Q+          G  GCL RI+  DP+F +  +    L       S   +  L+N    + +  +++ L    +E E LH  A     +G    AA+ W   +  HP DLLAL++ +D Y   G   ++ ++ +              ++ G  +FGL E    +++LK+A E+L +   +SWS+HT+AH+ E + +  +G+ FM  T+ +W  S  LACH  WH AL+++ +GD  +AL ++D  I P+  +  +   + D  ++L R++L           +N+ +RW  L   I ++        F D H  M+ L    +    +++E                        M +  ++P +    +   LI     P   A+  +  G Y    +L+YPIR ++  +GGS+AQ N  +Y
Sbjct:    6 LRDCKAWQDAGLTLSTTSNEVCKLFDATLTQYATWKNDCTLGGIDGCLSRIKDTDPNFVMGHVAANGLELIGTGRSPRVDKELANAVRVMSDLSKSQAL----TEREMLHVAAVETFANGNLPKAADLWERILQNHPTDLLALKFAHDCYFYLGEQRQMRDSVARVLPYWKPGTPLSSYVKGMYSFGLLETNFYDQALKVAKEALAVDQTDSWSVHTVAHVHEMRADLDSGLAFMQETENNWKGSDMLACHVYWHWALYFIEKGDYEAALTLYDNHIAPQCFASGTMLDVVDNSSMLYRLQL---------EGVNVGDRWKNLLQ-ITKSHTQDHMLIFNDLHFLMSSLGSKDEDMTRELVE-----------------------SMQELSKSPGE---NQQHGLINHLGTPLCRALIEYDRGHYDKAADLMYPIRYQILGIGGSDAQVNSSYY 419          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Xenopus
Match: tbxt (T-box transcription factor T [Source:Xenbase;Acc:XB-GENE-478789])

HSP 1 Score: 158.688 bits (400), Expect = 9.047e-42
Identity = 131/497 (26.36%), Postives = 220/497 (44.27%), Query Frame = 1
Query:   61 MRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDL------TSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLI-----PFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGG--HENQARLKMLFLNRKDVNEYNN-YYQRIEK 1509
            +RD       G+ LST+SNEV KL+D+ L Q+          G  GCL RI+  DP+F +  +    L       S   +  L+N    + +  +++ L    +E E LH  A     +G    AA+ W   +  HP DLLAL++ +D Y   G   ++ ++ +              ++ G  +FGL E    +++LK+A E+L +   +SWS+HT+AH+ E + +  +G+ FM  T+ +W  S  LACH  WH AL+++              +I P+  +  +   + D  ++L R++L           +N+ +RW  L   I ++        F D H  M+ L    +    +++E                        M +  ++P +    +   LI     P   A+  +  G Y    +L+YPIR ++  +GGS+AQ D+F Q L  A  N     H+N AR     L  +D+   N+   QR+ K
Sbjct:    6 LRDCKAWQDAGLTLSTTSNEVCKLFDATLTQYATWKNDCTLGGIDGCLSRIKDTDPNFVMGHVAANGLELIGTGRSPRVDKELANAVRVMSDLSKSQAL----TEREMLHVAAVETFANGNLPKAADLWERILQNHPTDLLALKFAHDCYFYLGEQRQMRDSVARVLPYWKPGTPLSSYVKGMYSFGLLETNFYDQALKVAKEALAVDQTDSWSVHTVAHVHEMRADLDSGLAFMQETENNWKGSDMLACHVYWHWALYFIE-------------KIAPQCFASGTMLDVVDNSSMLYRLQL---------EGVNVGDRWKNLLQ-ITKSHTQDHMLIFNDLHFLMSSLGSKDEDMTRELVE-----------------------SMQELSKSPGE---NQQHGLINHLGTPLCRALIEYDRGHYDKAADLMYPIRYQILGIGGSDAQRDLFNQVLIRAAINSSSKYHQNLAR---CLLTERDMGRPNSPLTQRLIK 446          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Xenopus
Match: tbxt (T-box transcription factor T [Source:Xenbase;Acc:XB-GENE-478789])

HSP 1 Score: 154.451 bits (389), Expect = 3.267e-40
Identity = 132/500 (26.40%), Postives = 219/500 (43.80%), Query Frame = 1
Query:   61 MRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDL------TSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGD---VNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLI-----PFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGG--HENQARLKMLFLNRKDVNEYNN-YYQRIEK 1509
            +RD       G+ LST+SNEV KL+D+ L Q+          G  GCL RI+  DP+F +  +    L       S   +  L+N    + +  +++ L    +E E LH  A     +G    AA+ W   +  HP DLLAL++ +D Y   G   ++ ++ +              ++ G  +FGL E    +++LK+A E+L +   +SWS+HT+AH+ E + +  +G+ FM  T+ +W  S  LACH  WH AL+++ + +   + + LD+ D   M                  L R++L           +N+ +RW  L   I ++        F D H  M+ L    +    +++E                        M +  ++P +    +   LI     P   A+  +  G Y    +L+YPIR ++  +GGS+AQ D+F Q L  A  N     H+N AR     L  +D+   N+   QR+ K
Sbjct:    7 LRDCKAWQDAGLTLSTTSNEVCKLFDATLTQYATWKNDCTLGGIDGCLSRIKDTDPNFVMGHVAANGLELIGTGRSPRVDKELANAVRVMSDLSKSQAL----TEREMLHVAAVETFANGNLPKAADLWERILQNHPTDLLALKFAHDCYFYLGEQRQMRDSVARVLPYWKPGTPLSSYVKGMYSFGLLETNFYDQALKVAKEALAVDQTDSWSVHTVAHVHEMRADLDSGLAFMQETENNWKGSDMLACHVYWHWALYFIEKVELTFLGTMLDVVDNSSM------------------LYRLQL---------EGVNVGDRWKNLLQ-ITKSHTQDHMLIFNDLHFLMSSLGSKDEDMTRELVE-----------------------SMQELSKSPGE---NQQHGLINHLGTPLCRALIEYDRGHYDKAADLMYPIRYQILGIGGSDAQRDLFNQVLIRAAINSSSKYHQNLAR---CLLTERDMGRPNSPLTQRLIK 445          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Mouse
Match: Ttc38 (tetratricopeptide repeat domain 38 [Source:MGI Symbol;Acc:MGI:2146198])

HSP 1 Score: 183.726 bits (465), Expect = 8.148e-51
Identity = 129/467 (27.62%), Postives = 220/467 (47.11%), Query Frame = 1
Query:   61 MRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT---SGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLI--PFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFL--AAALFNEGGHENQAR 1440
            +RD       G+ LST+SNE  KL+D+ L Q+          G +GCL ++++ DP F +   I+  L    +G   +   +L + +K   E     +  +  E+LH  A      G    A + W + +  HP D+LAL++ +D Y   G   ++ ++ +      +       ++ G  +FGL E    +++ KLA E+L I P ++WS+HT+AH+ E +    +G+EFM +++  W  S  LACHN WH AL+ + +GD  +AL I+D+ I+P L++  +   + D+ ++L R+++           + L +RW  +   + Q         F DAH  MA L     RD     E                        + +A ++P +    +  + +  P  +A+   + G+    + LL PIR  + ++GGSNAQ D+F Q L  AA       H+N AR
Sbjct:    3 LRDCQAWKNAGLPLSTTSNEACKLFDATLTQYVKWTNDKSLGGIEGCLSKLRAADPTFAMGLAISNGLVLVGTGTSVALDKDLALAVKTMVELSQ-TQTLTPREQLHVSAVEMFAKGNFPRACDLWEQILRDHPTDMLALKFSHDAYFYLGYQEQMRDSVARVYPFWTPDIPLNSYVKGIYSFGLMETNFYDQAQKLAKEALSIEPTDAWSVHTVAHVHEMRAEIKDGLEFMQQSEGHWKDSDMLACHNYWHWALYLIEKGDYEAALTIYDSHILPSLQASGTMLDVVDSCSMLYRLQM---------EGVPLGQRWQTVLP-VTQKHTRDHILLFNDAHFLMASLGA---RDLQTTREL--------------------LTTLQEASKSPGENCQHQLAKDVGLPLCQALLEAENGNPDRVLELLLPIRYRIVQIGGSNAQRDVFNQLLIHAAMTCTSSVHKNVAR 435          
BLAST of tetratricopeptide repeat protein 38 vs. UniProt/SwissProt
Match: sp|A2VD82|TTC38_XENLA (Tetratricopeptide repeat protein 38 OS=Xenopus laevis OX=8355 GN=ttc38 PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.122e-54
Identity = 141/488 (28.89%), Postives = 235/488 (48.16%), Query Frame = 1
Query:   61 MRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT-SGDFESNLSNLKIE-LKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGG--HENQARLKMLFLNRKDVNEYNN-YYQRIEK 1509
            +RD       G+ LST+SNEV KL+D+ L Q+          G +GCL RI + DP+F +  +    L   G   S L + +++   +   + + ++  +E EKLH  A     DG    AA+ W   +  HP DLLAL++ +D Y   G   ++ ++ +              ++ G  +FGL E    +++LK+A E+L +   +SWS+HT+AH+ E K +  +G+ FM  T+ +W  S  LACH  WH AL+ + +GD  +AL ++D  I P+  +  S   + D  ++L R+++           +N+ +RW  L   I +         F D H  M+ L    +    Q++E   +      ++   E +  S +K L A                P  +A+  +  G+Y   V+L+YPIR ++ ++GGS+AQ D+F Q L  A  N     H+N AR   + L  +D+   N+   QR+ K
Sbjct:    6 LRDCKAWQDAGLTLSTTSNEVCKLFDATLIQYATWKNDSTLGGIEGCLSRINNTDPNFVMGHVAANGLELIGTGRSPLVDKELDDALKTMSDLSKSQALTEREKLHVAAVETFADGNLPKAADLWERILQSHPTDLLALKFAHDCYFYLGEQRQMRDSVARVLPYWKPETPLSSYVKGMYSFGLLETNFYDQALKVAKEALAVERTDSWSVHTIAHVHEMKADLDSGLSFMQETENNWKGSDMLACHVYWHWALYLIEKGDYEAALTLYDNHIAPQCFASGSMLDVVDNSSMLYRLQM---------EGVNVGDRWKNLVQ-ITKKHTKDHMLIFNDLHFLMSSLGSKDEDTTRQLVESMQEL-----SKSPGEKQQHSLIKHLGA----------------PLCQALIEYNGGNYDKAVDLIYPIRYQILKIGGSDAQRDLFNQVLIQAAINSDSTHHQNLAR---VLLMERDIGRPNSPLTQRLIK 459          
BLAST of tetratricopeptide repeat protein 38 vs. UniProt/SwissProt
Match: sp|A3KPN8|TTC38_DANRE (Tetratricopeptide repeat protein 38 OS=Danio rerio OX=7955 GN=ttc38 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 8.205e-53
Identity = 132/475 (27.79%), Postives = 221/475 (46.53%), Query Frame = 1
Query:   91 GINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT-SGDFESNLSN--LKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRL-IPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
            G+ LS+SSNE  KL+D+ L Q+          G +GC+  I++ DPDF +  +I+  L   G   S L +  L   ++   E  +  ++ +  EK H KA      G    A E W   +A HP DLLAL++ +D +   G   ++ ++ +        H   Y  I G  +FGL E    +E+ K+A E+L + P + WS+H +AH+ E K     G+ FM  T+ +W     LACHN WH AL+++ +G+  +AL I+D ++  R     +   + D+ +LL R+EL           +++ ER+  L   + Q  +      F D H  M  L         ++LE   +                       A+    +R +  ++R+ +P  +A+  F++ +Y+  V LL PI++    +GGS+AQ D+F Q L  A    G  E+Q   + + + R  V   +    R+
Sbjct:   16 GLPLSSSSNEACKLYDAILSQYVTWRNDETLGGIEGCITSIKAADPDFVMGHVISTGLELVGTGSSVLRDERLASAVRRTVELAD-TQQLTSREKNHVKAVQLFSKGALHKACEVWECILADHPTDLLALKFAHDGFFYLGEQTQMRDSVARVMPHWKPHMPLYRQIKGMYSFGLLETRLYDEAEKMAKEALSLTPEDGWSVHAVAHVHEMKAEVEKGLNFMASTEKNWTVCDMLACHNYWHWALYHIEKGNYEAALKIFDEQVSQRCVKSGAMLDIVDSCSLLYRLEL---------EGVSVGERYRELLQ-VTQPHSEDHTLLFNDLHFLMVSLGSKDTGTTQRLLESLQEL----------------------AKDPAENRQLQIAERVGLPMCQALLEFEQRNYRQAVELLKPIKQSFVEIGGSDAQRDVFSQLLIHAAMKSGDKEHQQLARCMLMERDAVRPNSPLTDRL 457          
BLAST of tetratricopeptide repeat protein 38 vs. UniProt/SwissProt
Match: sp|Q5RFF7|TTC38_PONAB (Tetratricopeptide repeat protein 38 OS=Pongo abelii OX=9601 GN=TTC38 PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 3.664e-52
Identity = 133/471 (28.24%), Postives = 222/471 (47.13%), Query Frame = 1
Query:   52 TSKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT---SGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSD---RFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFN--EGGHENQAR 1440
            TS +RD        + LST+SNE  KL+D+ L Q+          G +GCL ++++ DP F +   I+  L    +G        L + +K   E     +  +  E+LH  A      G    A E W + +  HP D+LAL++ +D Y   G   ++ ++ +      +       ++ G  +FGL E    +++ KLA E+L I P ++WS+HT+AHI E K    +G+EFM  ++  W  S  LACHN WH AL+ + +G+  +AL I+DT I+P L++  +   + D+ ++L R+++           +++ +RW  +     + +   +   F DAH  MA L  +  +   ++L    D                       A ++P +     + R   L P  +A+   ++G+    + LL PIR  + +LGGSNAQ D+F Q L  A  N     H+N AR
Sbjct:    4 TSPLRDCQAWKDARLPLSTTSNEACKLFDATLTQYVKWTNDKSLGGIEGCLSKLKAADPTFAMGHAISTGLVLIGTGSSVKLDKELDLAVKTMMEVSR-TQPLTRREQLHVSAVETFAKGNFPKACELWEQILQDHPTDMLALKFSHDAYFYLGYQEQMRDSVARIYPFWTPDIPLSSYVKGIYSFGLMETNFYDQAEKLAKEALSINPTDAWSVHTVAHIHEMKAEIKDGLEFMQHSETLWKDSDMLACHNYWHWALYLIEKGEYEAALTIYDTHILPSLQANGAMLDVVDSCSMLYRLQM---------EGVSVGQRWQDVLPVTRKHSRDHT-LLFNDAHFLMASLGAHDPQTTQELLTTLRD-----------------------ASESPGENCQHLLARDVGL-PLCQALVEAEDGNPDRVLELLLPIRYRIVQLGGSNAQRDVFNQLLIHAALNCTSSVHKNVAR 439          
BLAST of tetratricopeptide repeat protein 38 vs. UniProt/SwissProt
Match: sp|Q5R3I4|TTC38_HUMAN (Tetratricopeptide repeat protein 38 OS=Homo sapiens OX=9606 GN=TTC38 PE=1 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.537e-50
Identity = 131/470 (27.87%), Postives = 221/470 (47.02%), Query Frame = 1
Query:   55 SKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT---SGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSD---RFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFN--EGGHENQAR 1440
            S +RD        + LST+SNE  KL+D+ L Q+          G +GCL ++++ DP F +   +   L    +G        L + +K   E     +  +  E+LH  A     +G    A E W + +  HP D+LAL++ +D Y   G   ++ ++ +      +       ++ G  +FGL E    +++ KLA E+L I P ++WS+HT+AHI E K    +G+EFM  ++  W  S  LACHN WH AL+ + +G+  +AL I+DT I+P L++  +   + D+ ++L R+++           +++ +RW  +   + +  +      F DAH  MA L  +  +   ++L    D                       A ++P +     + R   L P  +A+   ++G+    + LL PIR  + +LGGSNAQ D+F Q L  A  N     H+N AR
Sbjct:    5 SPLRDCQAWKDARLPLSTTSNEACKLFDATLTQYVKWTNDKSLGGIEGCLSKLKAADPTFVMGHAMATGLVLIGTGSSVKLDKELDLAVKTMVEISR-TQPLTRREQLHVSAVETFANGNFPKACELWEQILQDHPTDMLALKFSHDAYFYLGYQEQMRDSVARIYPFWTPDIPLSSYVKGIYSFGLMETNFYDQAEKLAKEALSINPTDAWSVHTVAHIHEMKAEIKDGLEFMQHSETFWKDSDMLACHNYWHWALYLIEKGEYEAALTIYDTHILPSLQANDAMLDVVDSCSMLYRLQM---------EGVSVGQRWQDVLP-VARKHSRDHILLFNDAHFLMASLGAHDPQTTQELLTTLRD-----------------------ASESPGENCQHLLARDVGL-PLCQALVEAEDGNPDRVLELLLPIRYRIVQLGGSNAQRDVFNQLLIHAALNCTSSVHKNVAR 439          
BLAST of tetratricopeptide repeat protein 38 vs. UniProt/SwissProt
Match: sp|A3KMP2|TTC38_MOUSE (Tetratricopeptide repeat protein 38 OS=Mus musculus OX=10090 GN=Ttc38 PE=1 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 5.699e-50
Identity = 129/467 (27.62%), Postives = 220/467 (47.11%), Query Frame = 1
Query:   61 MRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT---SGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLI--PFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFL--AAALFNEGGHENQAR 1440
            +RD       G+ LST+SNE  KL+D+ L Q+          G +GCL ++++ DP F +   I+  L    +G   +   +L + +K   E     +  +  E+LH  A      G    A + W + +  HP D+LAL++ +D Y   G   ++ ++ +      +       ++ G  +FGL E    +++ KLA E+L I P ++WS+HT+AH+ E +    +G+EFM +++  W  S  LACHN WH AL+ + +GD  +AL I+D+ I+P L++  +   + D+ ++L R+++           + L +RW  +   + Q         F DAH  MA L     RD     E                        + +A ++P +    +  + +  P  +A+   + G+    + LL PIR  + ++GGSNAQ D+F Q L  AA       H+N AR
Sbjct:    3 LRDCQAWKNAGLPLSTTSNEACKLFDATLTQYVKWTNDKSLGGIEGCLSKLRAADPTFAMGLAISNGLVLVGTGTSVALDKDLALAVKTMVELSQ-TQTLTPREQLHVSAVEMFAKGNFPRACDLWEQILRDHPTDMLALKFSHDAYFYLGYQEQMRDSVARVYPFWTPDIPLNSYVKGIYSFGLMETNFYDQAQKLAKEALSIEPTDAWSVHTVAHVHEMRAEIKDGLEFMQQSEGHWKDSDMLACHNYWHWALYLIEKGDYEAALTIYDSHILPSLQASGTMLDVVDSCSMLYRLQM---------EGVPLGQRWQTVLP-VTQKHTRDHILLFNDAHFLMASLGA---RDLQTTREL--------------------LTTLQEASKSPGENCQHQLAKDVGLPLCQALLEAENGNPDRVLELLLPIRYRIVQIGGSNAQRDVFNQLLIHAAMTCTSSVHKNVAR 435          
BLAST of tetratricopeptide repeat protein 38 vs. TrEMBL
Match: A0A1S3HI47 (tetratricopeptide repeat protein 38 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106154748 PE=4 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.135e-56
Identity = 132/483 (27.33%), Postives = 226/483 (46.79%), Query Frame = 1
Query:   64 RDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLIT--FDLTSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWT-ALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
            RD    N+ G+ LST+SNE  KL+D+ L Q+ G ++     G +   +++   DPDF + +++T   DL       NL            +    +  +E E+ H KA     +G    A   W + +  HP D+LAL++ +D Y   G  P + ++ +            Y ++ G  +FGL E    +E+ K++ + L I P ++WS H++AH+ E  G    GI F++ T  DW T   LACHN WH A++++ +G+   A+DI+D+E+  R K   +   + DA +LL R+EL           +N+ +RW     +C     +      F D H+ M+ L   ++    +++E   +++ N +                      ++R +T ++  +P  EA + +  GD+   VNLL P+R ++  +GGSNAQ D+F  FL  A        +    + L   RK + E      R+
Sbjct:    6 RDCQAWNQEGLPLSTTSNEACKLYDAVLTQYVGWYDEDGVGGIETAAKKLTETDPDFVMGRVLTNGLDLIGTGRTINLDPDFKAAINTMTDMAAKQDITERERQHAKAIQMWAEGDTTGACHVWEDILVAHPTDMLALKFAHDSYFYLGYQPHMRDSIARVLPYWKPTMPLYGYLFGMHSFGLVETSLFSEAEKVSRKGLDINPKDAWSTHSLAHVLEMMGRQDEGISFLSTTVRDWTTCGMLACHNFWHWAVYHIEKGEHTGAVDIFDSEVGERCKKSGAMLDIVDACSLLYRLEL---------EGVNVGDRWNDVFETCRPHTDDHILA--FNDVHILMSCLGAKKKDVAKEMMESIREFVKNGKG---------------------TNRDVT-AEVGLPLCEAFEAYDSGDFARAVNLLNPLRYKVLSIGGSNAQRDVFNLFLINAALKSEDKMHHKLARCLLAERKCLKENAPMTDRL 455          
BLAST of tetratricopeptide repeat protein 38 vs. TrEMBL
Match: A0A3Q3H2C2 (Tetratricopeptide repeat domain 38 OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 2.314e-56
Identity = 140/494 (28.34%), Postives = 231/494 (46.76%), Query Frame = 1
Query:   46 LNTSKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLIT--FDLTSGDFESNLSN-LKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI-EKSI 1515
            +N S  RD       G+ LSTSSNE  KL+D+ L Q+          G +GC+  +Q+ DP+F +  +I+   +L S    + L+  L   ++   E  N ++  S  EKLH +A      G    A E W + +  HP D+LAL++ +D Y   G    + ++ +        H   + ++ G  +FGL E    +++LK+A E L + P ++WS+H++AH++E K    NG++FM R + DW  S  LA HN WH AL+++  G   +AL I+D+++  R K+  S     D+ ++L R+E+           + + +RW  L   + Q         F D H  M  L  N+     ++LE   +                     L  +   + + +  +   IP  EAM  +  G+Y  TV LL P+R  +  +GGS+AQ D+F   L  A        +Q   + L + R  V   +   QR+ +KS+
Sbjct:    1 MNASSFRDCQAWKDEGLPLSTSSNEACKLYDAILTQYVKWRNDETLGGIEGCISALQTADPNFVMGHVISTGLELVSTTSSTRLNEPLASAVRRTVELAN-SQNISPREKLHVRAMELFSRGDFPQACEAWEDVLLDHPTDMLALKFAHDSYFYMGAQLPMRDSVARVLPHWKPHMPLFSYLKGQYSFGLLETRFYDQALKVAMEGLALTPDDAWSVHSVAHVYEMKAEVDNGLKFMERREKDWQVSDILASHNYWHWALYFIERGQYEAALQIYDSQVFKRCKASGSMLDTVDSSSMLYRLEM---------EGVCVKDRWQELLQ-VTQPHTDDHVTLFNDLHFLMVALGANESGTSQRLLEGLQE---------------------LAKKPGDNQQHLLANSIGIPMCEAMMAYNSGNYDQTVELLNPLRYRMVDMGGSDAQRDLFNLLLIHATMKSKNKRHQKLGRCLLVERDSVRPNSPLTQRLMQKSL 462          
BLAST of tetratricopeptide repeat protein 38 vs. TrEMBL
Match: A0A1S3HF15 (tetratricopeptide repeat protein 38 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106154748 PE=4 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 7.450e-56
Identity = 131/483 (27.12%), Postives = 227/483 (47.00%), Query Frame = 1
Query:   64 RDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLIT--FDLTSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWT-ALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
            RD    N+ G+ LST+SNE  KL+D+ L Q+ G+++     G    ++ + + DP+F + +++T   DL       NL            +    +  +E E+ H KA     +G    A   W + +  HP D+LAL++ +D Y   G  P + ++ +            Y ++ G  +FGL E    +E+ K++ + L I P ++WS H++AH+ E  G    GI F++ T  DW T   LACHN WH A++++ +G+   A+DI+D+E+  R K   +   + DA +LL R+EL           +N+ +RW     +C     +      F D H+ M+ L   ++    +++E   +++ N +                      ++R +T ++  +P  EA + +  GD+   VNLL P+R ++  +GGSNAQ D+F  FL  A        +    + L   RK + E      R+
Sbjct:    6 RDCQAWNQEGLPLSTTSNEACKLYDAVLTQYTGVYDDASVGGIATSMKAMLAADPNFVMGRVLTNGLDLIGTGRTINLDPDFKAAINTMTDMAAKQDITERERQHAKAIQMWAEGDTTGACHVWEDILVAHPTDMLALKFAHDSYFYLGYQPHMRDSIARVLPYWKPTMPLYGYLFGMHSFGLVETSLFSEAEKVSRKGLDINPKDAWSTHSLAHVLEMMGRQDEGISFLSTTVRDWTTCGMLACHNFWHWAVYHIEKGEHTGAVDIFDSEVGERCKKSGAMLDIVDACSLLYRLEL---------EGVNVGDRWNDVFETCRPHTDDHILA--FNDVHILMSCLGAKKKDVAKEMMESIREFVKNGKG---------------------TNRDVT-AEVGLPLCEAFEAYDSGDFARAVNLLNPLRYKVLSIGGSNAQRDVFNLFLINAALKSEDKMHHKLARCLLAERKCLKENAPMTDRL 455          
BLAST of tetratricopeptide repeat protein 38 vs. TrEMBL
Match: A0A5A9P1W7 (Tetratricopeptide repeat protein 38 OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti008808 PE=4 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 8.625e-56
Identity = 139/492 (28.25%), Postives = 232/492 (47.15%), Query Frame = 1
Query:   46 LNTSKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT-SGDFESNLSNLKIE--LKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSE--LNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRL-IPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
            +N +  RD       G++LSTSSNE  KL+D+ L Q+          G +GC+  +++ DPDF +  +I+  L   G   S L + ++   +K   E    +++ +  E+ H KA      G    A E W + +  HP D+LAL++ +D +   G   ++ ++ +        H  +Y +I G  +FGL E    +E+LK+A E+L + P + WS+H++AH+ E K     G++FM  T+ DW+    LACHN WH AL+++ +G+  +AL I+D ++  R     +     DA +LL R+E L G  +K      L +TE+ T   + +           F D H  M  L         ++LE   +                       A++   +  +  +QR+ +P  +A++ F +G+Y   V LL PIR     +GGS+AQ DIF Q L  A    G   +Q   + + + R  V   +    R+
Sbjct:    1 MNAATFRDCKAWISEGLSLSTSSNEACKLYDAILSQYVTWRNDESVGGIEGCIAAVKAADPDFVMGHVISTGLELVGTGSSVLRDERLANAVKTTLELAK-SQELTPRERNHVKAVELFSRGALHKACEVWEDILVDHPTDMLALKFAHDGFFYLGEQIQMRDSVARVLPHWKPHMPFYSYIKGLYSFGLLETKFYDEALKVAKEALALTPQDGWSVHSVAHVHEMKAEVDKGLKFMASTEKDWMVCDMLACHNYWHWALYHIEKGEYEAALKIFDEQVSQRGVKSGAMLDTVDACSLLYRLE-LEGVSTKDRYRELLQVTEQHTEDHTLL-----------FNDLHFLMVSLGSKDTSITQRLLESLQEL----------------------AKEPADNHQLHIAQRVGLPMCQALQEFDQGNYSQVVQLLKPIRYRFVEIGGSDAQRDIFNQLLIHAAMKSGDKHHQRFARGMLIERDAVRPNSPLTDRL 457          
BLAST of tetratricopeptide repeat protein 38 vs. TrEMBL
Match: A0A2I4D1R8 (tetratricopeptide repeat protein 38 OS=Austrofundulus limnaeus OX=52670 GN=ttc38 PE=4 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.288e-55
Identity = 138/491 (28.11%), Postives = 227/491 (46.23%), Query Frame = 1
Query:   46 LNTSKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLIT--FDLTSGDFESNLS-NLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSD--RFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
            +N S  RD       G+ LSTSSNE  KL+D+ L Q+          G +GC+  +Q+ DP+F +  +I+   +L S    + L+  L   ++   E  N N+  S  EKLH +A      G    A E W + +  HP D+LAL++ +D Y   G    + ++ +        H   + ++ G  +FGL E    +++LK+A E L + P ++WS+H++AH++E +    NG++FM   + DW  S  LA HN WH AL+++  G   +AL+I+D+++  R K+  S   + D+ ++L R+E+           + + ERW  L   + Q         F D H  M  L  ++     ++LE   +   N                       P D  + +      IP  +AM  +  G+Y  TV LL P+R  +  +GGS+AQ D+F   L  A        +Q   + L + R  V   +   QR+
Sbjct:    1 MNASSFRDCQAWKDEGLALSTSSNEACKLYDAILTQYVKWRNDESLGGIEGCISALQTADPNFVMGHVISTGLELVSTTSSTRLNERLASAVRRTVELAN-NQNISPREKLHVRAMELFARGNFSQACEVWEDVLLDHPTDMLALKFAHDSYFYMGAQVPMRDSVARVLPHWKPHTPLFSYLKGQYSFGLLETRFYDQALKVAMEGLALTPDDAWSVHSVAHVYEMRAEVDNGLKFMESREKDWQVSDILASHNYWHWALYFIERGQYEAALEIYDSQVFKRCKASGSMLDIVDSCSMLYRLEM---------EGVCVKERWRELLQ-VTQPHTDDHVTLFNDLHFLMVSLGADELGTSQRLLEGLQELAKN-----------------------PGDNQQHVLAESIGIPMCKAMMEYNNGNYVQTVELLNPLRYRMVDIGGSDAQRDLFNHLLIHASMKSKNKRHQKLARCLLVERDAVRPNSPLTQRL 457          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Cavefish
Match: ttc38 (tetratricopeptide repeat domain 38 [Source:NCBI gene;Acc:103032758])

HSP 1 Score: 181.415 bits (459), Expect = 5.217e-50
Identity = 125/476 (26.26%), Postives = 213/476 (44.75%), Query Frame = 1
Query:   91 GINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLT-SGDFESNLSNLKIE--LKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSE--LNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
            G+ LST+SNE  KL+D+ L Q+          G +GC+  +Q+ DP+F +  +I   L   G   S L N K+   +K   +    ++  +  EKLH KA      G  + A + W + + +HP D+LAL++ +D +   G   ++ ++ +        H   Y ++ G  +FGL E    +++ K+A E L + P + W +H++AH+ E K     G++FM   + +W     LACHN WH AL+++ +G+  +AL I+D ++  R     +     DA +LL R+E + G + K      L +TE  +   + +           F D H  M  L C       ++LE                      +++L      +          +P  EA+  + +G+Y   V +L PIR     +GGS+AQ D+F Q L  +        +Q   + L   R  V   +    R+
Sbjct:   16 GLPLSTTSNEACKLYDAILNQYVTWRNDETLGGIEGCIAAVQAADPNFVMGHVIGTGLELVGTGSSVLRNEKLAGAVKRTLDLAK-SQDLTPREKLHVKAVDLFSRGALDKACDVWEDILVEHPTDMLALKFSHDGFFYLGEQVQMRDSVARVLPHWKPHMPLYSYLKGLYSFGLLETRFYDQAEKVAKEGLALTPEDGWCVHSVAHVHEMKAEIEKGLKFMESNEKNWKVCDMLACHNYWHWALYHVEKGEYEAALKIYDDQVSRRCVKSGAMLDTVDACSLLYRLE-MEGVNVKGRYRELLQVTEPHSEDHTLL-----------FNDLHFLMVSLGCKNTSTTQRLLES---------------------LRVLAKEPGENHEHQLAENIGLPMCEALVEYDQGNYSKAVEILKPIRYHFVEIGGSDAQRDVFSQLLIHSAIKSEDKHHQRYARCLLAERDSVRPNSPLTDRL 457          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Nematostella
Match: EDO49617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFK6])

HSP 1 Score: 174.481 bits (441), Expect = 6.572e-48
Identity = 122/483 (25.26%), Postives = 213/483 (44.10%), Query Frame = 1
Query:   55 SKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLTSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
            S  RDL      G+  +T SNE  K++D+ + Q  G +  P     Q  L+ +   DPDF + ++++ +L      S     K++   +   +      +  EKLH +A      G    A   W + +  +P D++A++   + +  TG   E+ ++ +    +       YP++ G  AFGLEE    +E+ K A   L + P + W+ H  AH+ E  G    GI FM++T  DWV    +A HN WH AL+++ +G+ ++A DI+D+++  R K+  S   ++DA + L R+E+            N+ +RW  L        +  +   F DAH+ M  L    +    ++++   +++                       +  S       +  +   EA+    +GD+   V LL PIR  L  +GGS+AQ D+F   L  A      +E++   + L   RK + E      R+
Sbjct:    6 SHWRDLKAWEDEGLPFTTPSNEAVKMYDAAVSQMVGHYVDPVLESPQKALDLMLEADPDFVMGQVLSLNLALWGKNSPAIQEKVDKLMELACRT---SITPREKLHVEAVKELSLGNPVKACLIWDDILTTYPTDMMAIKISQETFFFTGLQKEMRDSVARVLPRWKPSIPLYPYLFGMLAFGLEETNFYHEAEKQALRGLELAPTDCWATHARAHVLEMTGRQDEGIAFMSKTLNDWVKGDGMAGHNFWHWALYHIEKGEYDAAWDIYDSQLAQRCKTPGSTLDLTDASSFLYRMEV---------EGQNVGDRWVDLLPFWAPHVDDHN-MIFNDAHMLMCTLGAKDEEMTLKLMKSLQEYV----------------------SEGSSHNCTLSREVGVTLCEALVLADKGDFPGAVELLKPIRYRLIAIGGSHAQRDVFNLLLIHAALQSSRNEHKLLARSLLAERKALKENAPMTDRL 453          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Nematostella
Match: EDO30169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1J3])

HSP 1 Score: 151.754 bits (382), Expect = 1.561e-40
Identity = 108/422 (25.59%), Postives = 190/422 (45.02%), Query Frame = 1
Query:  154 WYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLTSGDFESNLSNLKIELKEQFENKNL---NRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWE---------FYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIF 1383
            + G ++     G +  L+++   DP F + K++   L      + + ++  +LK+   +  +     K ++ EKLH +A      G    A   W + +   P D+LAL+  +D Y   G  P++ ++ +    K       Y ++ G  AFGL E     ++ K A + L + P + WS H+ AH+ E  G    GI FM+ T  DW     LACHN WH A++++ +G+ ++ALDI+D+++  R KS  +   + DA +LL R+++           +N+  RW            L S WE         F DAH+ M  L    +    +++E   +++ + +                       +R ++R    +   EA +   +GD+   V LL P+R  +  +GGSNAQ  +F
Sbjct:    1 YTGWYDDKSVGGIEETLKKLTQADPSFVMGKVLCVGLELISTNTGI-HVNAKLKQDLADLQVLASKSKITQREKLHVQAVNQFAHGDTTGACLVWEDILTADPTDMLALKLAHDSYFYLGFQPQMRDSIARVLPKWRPDLPLYSYLHGMYAFGLVETNCYQDAEKHALKGLKLNPRDCWSTHSQAHVLEMMGRQDEGIAFMSSTLDDWTVGEMLACHNFWHWAVYHVEKGEHDAALDIYDSQVGQRCKSG-AMLDLVDASSLLYRLQM---------EGINVGNRWH----------ELLSLWESHADDHILMFNDAHMLMCTLGAKNEGMTLKLMESLRNFVRDGKGH---------------------NREVSRDVG-VAICEAFEMADKGDFAGAVELLKPVRYRIVNIGGSNAQVGLF 379          
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Medaka
Match: ttc38 (tetratricopeptide repeat domain 38 [Source:NCBI gene;Acc:101157939])

HSP 1 Score: 182.185 bits (461), Expect = 3.009e-50
Identity = 130/489 (26.58%), Postives = 212/489 (43.35%), Query Frame = 1
Query:   46 LNTSKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLIT--FDLTSGDFESNLS-NLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRI 1503
            +N S  RD       G+ LSTSSNE  KL+D+ L Q+          G +GC+  +++ DP+F +  +I+   +L S      L   L   ++   E  N  +  S  EKLH  A      G    A E W + +  HP D LAL++ +D Y   G    + ++ +        H   + ++ G  +FGL E    +++LK A E L + P ++WS+H++AH+ E K     G+ FM   + DW  S  LA HN WH AL+ + +G    AL I+DT++  R K+  +   + DA ++L R+E+           + + +RW  L   + Q         F D H  M  L   +     ++LE   +                     L      + +        +    AM  + +G+Y   V LLYP+R  +  +GGS+AQ D+F Q L  A        ++   + L + R      +   +R+
Sbjct:    1 MNASSFRDCQAWKAEGLPLSTSSNEACKLFDATLTQYVKWTNDETLGGIEGCISAMKTADPNFVMGHVISTGLELVSTTSSPRLDERLAAAVRRTVELAN-TQDVSPREKLHATAVELFSQGNFPKACEVWEDILLDHPTDFLALKFSHDAYFYMGAQGPLRDSVARVLPHWKPHMPLFSYLKGLYSFGLLEMRFYDQALKEAMEGLSLTPEDAWSVHSVAHVHEMKAEVDEGLRFMESREKDWQASDMLASHNYWHWALYLMEKGQYEGALQIYDTQVFKRCKASGAMLDIVDASSMLYRLEM---------EGVCVKDRWRELLH-VTQPHTDDHVTVFNDLHFLMVSLGAEETTTSRRLLEGLQE---------------------LAKEPGENQQHQVAGSVGVSVCRAMVEYSQGNYARAVELLYPLRYSIVDVGGSDAQRDLFSQLLIQAAIKSERKRHRKLGRCLLVERDSARPRSPLTRRL 457          
BLAST of tetratricopeptide repeat protein 38 vs. Planmine SMEST
Match: SMESG000071607.1 (SMESG000071607.1)

HSP 1 Score: 1036.17 bits (2678), Expect = 0.000e+0
Identity = 497/501 (99.20%), Postives = 499/501 (99.60%), Query Frame = 1
Query:   25 MIGHQGKLNTSKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLTSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRIEKSIINFL 1527
            MIGHQGKLNTSKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLTSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLA+AML CNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMK FQEGDYQATVNLLYP+RKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRIEKSIINFL
Sbjct:    1 MIGHQGKLNTSKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLTSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLALAMLGCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKFFQEGDYQATVNLLYPMRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRIEKSIINFL 501          
BLAST of tetratricopeptide repeat protein 38 vs. Planmine SMEST
Match: SMESG000071607.1 (SMESG000071607.1)

HSP 1 Score: 1010.36 bits (2611), Expect = 0.000e+0
Identity = 485/489 (99.18%), Postives = 487/489 (99.59%), Query Frame = 1
Query:   61 MRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLTSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLAMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRIEKSIINFL 1527
            MRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLTSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLA+AML CNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMK FQEGDYQATVNLLYP+RKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRIEKSIINFL
Sbjct:    1 MRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEAPETNGTQGCLERIQSIDPDFPLTKLITFDLTSGDFESNLSNLKIELKEQFENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALRYLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHLNESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVTSTALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAVALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHLALAMLGCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAPSDRFITRSQRLIPFLEAMKFFQEGDYQATVNLLYPMRKELRRLGGSNAQNDIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRIEKSIINFL 489          
The following BLAST results are available for this feature:
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TTC383.201e-5127.87tetratricopeptide repeat domain 38 [Source:HGNC Sy... [more]
TTC387.054e-1928.28tetratricopeptide repeat domain 38 [Source:HGNC Sy... [more]
TTC381.917e-1326.19tetratricopeptide repeat domain 38 [Source:HGNC Sy... [more]
TTC383.821e-639.39tetratricopeptide repeat domain 38 [Source:HGNC Sy... [more]
back to top
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y54G11A.72.620e-4227.52pep chromosome:WBcel235:II:14297305:14299633:1 gen... [more]
Y54G11A.41.224e-3727.23pep chromosome:WBcel235:II:14292824:14296055:1 gen... [more]
back to top
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc382.907e-5528.00tetratricopeptide repeat domain 38 [Source:NCBI ge... [more]
ttc388.641e-5527.79tetratricopeptide repeat domain 38 [Source:NCBI ge... [more]
ttc382.868e-5428.00tetratricopeptide repeat domain 38 [Source:NCBI ge... [more]
ttc389.093e-5327.67tetratricopeptide repeat domain 38 [Source:NCBI ge... [more]
ttc381.164e-634.25tetratricopeptide repeat domain 38 [Source:NCBI ge... [more]
back to top
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbxt3.841e-4827.52T-box transcription factor T [Source:Xenbase;Acc:X... [more]
tbxt8.965e-4827.46T-box transcription factor T [Source:Xenbase;Acc:X... [more]
tbxt8.513e-4426.87T-box transcription factor T [Source:Xenbase;Acc:X... [more]
tbxt9.047e-4226.36T-box transcription factor T [Source:Xenbase;Acc:X... [more]
tbxt3.267e-4026.40T-box transcription factor T [Source:Xenbase;Acc:X... [more]
back to top
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ttc388.148e-5127.62tetratricopeptide repeat domain 38 [Source:MGI Sym... [more]
back to top
BLAST of tetratricopeptide repeat protein 38 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2VD82|TTC38_XENLA1.122e-5428.89Tetratricopeptide repeat protein 38 OS=Xenopus lae... [more]
sp|A3KPN8|TTC38_DANRE8.205e-5327.79Tetratricopeptide repeat protein 38 OS=Danio rerio... [more]
sp|Q5RFF7|TTC38_PONAB3.664e-5228.24Tetratricopeptide repeat protein 38 OS=Pongo abeli... [more]
sp|Q5R3I4|TTC38_HUMAN1.537e-5027.87Tetratricopeptide repeat protein 38 OS=Homo sapien... [more]
sp|A3KMP2|TTC38_MOUSE5.699e-5027.62Tetratricopeptide repeat protein 38 OS=Mus musculu... [more]
back to top
BLAST of tetratricopeptide repeat protein 38 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HI471.135e-5627.33tetratricopeptide repeat protein 38 isoform X2 OS=... [more]
A0A3Q3H2C22.314e-5628.34Tetratricopeptide repeat domain 38 OS=Kryptolebias... [more]
A0A1S3HF157.450e-5627.12tetratricopeptide repeat protein 38 isoform X1 OS=... [more]
A0A5A9P1W78.625e-5628.25Tetratricopeptide repeat protein 38 OS=Triplophysa... [more]
A0A2I4D1R82.288e-5528.11tetratricopeptide repeat protein 38 OS=Austrofundu... [more]
back to top
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc385.217e-5026.26tetratricopeptide repeat domain 38 [Source:NCBI ge... [more]
back to top
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO496176.572e-4825.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301691.561e-4025.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tetratricopeptide repeat protein 38 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttc383.009e-5026.58tetratricopeptide repeat domain 38 [Source:NCBI ge... [more]
back to top
BLAST of tetratricopeptide repeat protein 38 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000071607.10.000e+099.20SMESG000071607.1[more]
SMESG000071607.10.000e+099.18SMESG000071607.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007392 ID=SMED30007392|Name=tetratricopeptide repeat protein 38|organism=Schmidtea mediterranea sexual|type=transcript|length=1916bp
TCTATATAAATCTTATATGAAAAGATGATAGGTCATCAAGGTAAGTTAAA
CACATCTAAAATGAGAGACTTGATCCAATTAAATAAATGTGGAATAAATT
TATCAACATCCTCTAACGAAGTTGCAAAGTTGTGGGATTCATTTTTGTTT
CAGTGGTATGGGTTATTCGAAGCACCAGAAACTAATGGAACCCAAGGCTG
TTTAGAACGTATTCAATCCATTGATCCTGATTTCCCATTGACTAAACTTA
TTACTTTCGATCTAACAAGTGGAGATTTTGAAAGCAACTTAAGTAACTTG
AAAATCGAGCTCAAAGAACAGTTTGAAAACAAAAATTTGAATCGCAAATG
GTCAGAATATGAAAAATTACACACGAAAGCTTTTATTTTCAAATTGGATG
GATATGATGAATGCGCTGCTGAATGTTGGATTGAACAAATTGCCAAACAC
CCTCAAGACCTTCTTGCTCTTAGATATCTAAATGATCACTATATAAGTAC
CGGAACTACTCCAGAAATTGCGAATGCGTTTTCGTTATGTCGTCAGAAGA
TGTCATCACACGATGTTTACTATCCTTTTATTTTAGGTTATGAAGCATTT
GGACTTGAAGAAAAGGGGCATTTAAATGAATCCCTCAAATTAGCAACAGA
ATCGTTGGGTATTTGCCCATGGAATTCTTGGTCAATACATACTATGGCTC
ACATATTTGAATCAAAAGGGAATTCTTTAAATGGGATTGAATTTATGAAT
CGGACCAAACCCGATTGGGTTACTAGTACGGCTTTGGCTTGCCATAATAC
GTGGCATACTGCTCTTTTTTACTTGAATGAAGGAGATGTGAATTCGGCTT
TAGACATTTGGGATACAGAAATAATGCCACGTCTAAAAAGTCAATATTCT
CATTTCAGTATGAGTGATGCCGTGGCCCTTTTGACACGAATAGAACTCCT
TCGTGGGTATCATTCAAAATCGAATTCAGAATTAAATTTGACAGAACGCT
GGACAGCTTTGTCTTCTTGCATCGGTCAAGCTGCCAATTTGTTTAGCGGC
TGGGAATTCTATGATGCTCATTTAGCAATGGCTATGCTTAGGTGCAATCA
ACAAAGGGATTTTGATCAAATACTCGAGCGCTGCAATGACTGGATTATTA
ATTATGAAAATCGCATTTTCGATGAATGGGAATGTGATTCATTTGTAAAA
ATGCTTCAGGCCCGGCAAGCACCATCTGATCGGTTTATAACTAGATCTCA
GCGGCTGATTCCTTTTCTCGAAGCAATGAAATGTTTCCAGGAAGGTGATT
ATCAAGCAACTGTAAATTTACTTTATCCGATTCGTAAAGAGTTGCGCAGA
TTAGGAGGAAGCAATGCCCAGAACGACATATTTTACCAGTTTCTCGCTGC
GGCACTTTTCAATGAGGGTGGACATGAAAATCAAGCACGGTTGAAAATGC
TCTTTTTAAACCGGAAAGATGTGAATGAATATAATAATTATTACCAAAGG
ATTGAAAAATCAATTATAAATTTCCTATAAAAATAATAATATTAATAATG
AGAACTCATTTCGATATTGATTCCTTTTTTATGGATTTATTTGATTATAT
TTTTTATTGATTACACACACACATATATATATATATTATTGAAAGAACCT
TTTTTAGTTTTCACCTCTAATTGCATTCTGTTTGCAATGACAGTTTTTTA
TTGATTGACTATGAATCAGATGTTTTATTGATATTCACAAATTTTCGGCA
CAGCCTTTTTCAAATGATATAGATATATTATTGGGACTAAATTGAATACC
TTGAACACGTGAAATCGGATGTAAAGTAAAATAATTGTTGAACCGATATA
TTTCTATAAAACTCAACATTATTATTAGTATTATGATTATTATTATTAAT
AATTATTAGTTTTAAC
back to top

protein sequence of SMED30007392-orf-1

>SMED30007392-orf-1 ID=SMED30007392-orf-1|Name=SMED30007392-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=502bp
MIGHQGKLNTSKMRDLIQLNKCGINLSTSSNEVAKLWDSFLFQWYGLFEA
PETNGTQGCLERIQSIDPDFPLTKLITFDLTSGDFESNLSNLKIELKEQF
ENKNLNRKWSEYEKLHTKAFIFKLDGYDECAAECWIEQIAKHPQDLLALR
YLNDHYISTGTTPEIANAFSLCRQKMSSHDVYYPFILGYEAFGLEEKGHL
NESLKLATESLGICPWNSWSIHTMAHIFESKGNSLNGIEFMNRTKPDWVT
STALACHNTWHTALFYLNEGDVNSALDIWDTEIMPRLKSQYSHFSMSDAV
ALLTRIELLRGYHSKSNSELNLTERWTALSSCIGQAANLFSGWEFYDAHL
AMAMLRCNQQRDFDQILERCNDWIINYENRIFDEWECDSFVKMLQARQAP
SDRFITRSQRLIPFLEAMKCFQEGDYQATVNLLYPIRKELRRLGGSNAQN
DIFYQFLAAALFNEGGHENQARLKMLFLNRKDVNEYNNYYQRIEKSIINF
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011990TPR-like_helical_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0070062extracellular exosome