Peripheral plasma membrane protein CASK

Overview
NamePeripheral plasma membrane protein CASK
Smed IDSMED30007389
Length (bp)3368
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peripheral plasma membrane protein CASK (SMED30007389) t-SNE clustered cells

Violin plots show distribution of expression levels for Peripheral plasma membrane protein CASK (SMED30007389) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peripheral plasma membrane protein CASK (SMED30007389) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peripheral plasma membrane protein CASK (SMED30007389) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007389

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30007389SMESG000060582.1 SmedASXL_016188SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30007389SMESG000060582.1 dd_Smed_v4_7723_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007389SMESG000060582.1 dd_Smed_v4_7723_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30007389SMESG000060582.1 dd_Smed_v4_7723_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30007389SMESG000060582.1 dd_Smed_v4_7723_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007389SMESG000060582.1 dd_Smed_v4_7723_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30007389SMESG000060582.1 dd_Smed_v6_7723_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30007389SMESG000060582.1 SMED30007389smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30007389SMESG000060582.1 SMED30007389smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Human
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:HGNC Symbol;Acc:HGNC:1497])

HSP 1 Score: 1198.34 bits (3099), Expect = 0.000e+0
Identity = 614/927 (66.24%), Postives = 746/927 (80.47%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE            IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L ++  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP   T+T   N  D SL+RL +ES++L+  Y HYFDL I+NN+I++TIR L+ +++ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLN-EDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 897          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Human
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:HGNC Symbol;Acc:HGNC:1497])

HSP 1 Score: 1196.03 bits (3093), Expect = 0.000e+0
Identity = 614/938 (65.46%), Postives = 746/938 (79.53%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                       IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L ++  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP   T+T   N  D SL+RL +ES++L+  Y HYFDL I+NN+I++TIR L+ +++ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLN-EDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 908          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Human
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:HGNC Symbol;Acc:HGNC:1497])

HSP 1 Score: 1192.95 bits (3085), Expect = 0.000e+0
Identity = 614/950 (64.63%), Postives = 746/950 (78.53%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                                   IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L ++  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP   T+T   N  D SL+RL +ES++L+  Y HYFDL I+NN+I++TIR L+ +++ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLN-EDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 920          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Human
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:HGNC Symbol;Acc:HGNC:1497])

HSP 1 Score: 1191.79 bits (3082), Expect = 0.000e+0
Identity = 614/951 (64.56%), Postives = 746/951 (78.44%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSID-MEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D    G L++  AVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                                   IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L ++  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP   T+T   N  D SL+RL +ES++L+  Y HYFDL I+NN+I++TIR L+ +++ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLN-EDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 926          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Human
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:HGNC Symbol;Acc:HGNC:1497])

HSP 1 Score: 1191.41 bits (3081), Expect = 0.000e+0
Identity = 613/933 (65.70%), Postives = 747/933 (80.06%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTT------ADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQET-ANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T      ++LKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE            IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L ++  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP   T+T   N  D SL+RL +ES++L+  Y HYFDL I+NN+I++TIR L+ +++ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEGKRWISNLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLN-EDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 903          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Celegans
Match: lin-2 (pep chromosome:WBcel235:X:12399517:12414037:-1 gene:WBGene00002991.1 transcript:F17E5.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-2)

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 460/979 (46.99%), Postives = 619/979 (63.23%), Query Frame = 2
Query:   68 ILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKW-----------SAFY------GDPAVINHDDSIDME----DGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIY-------GDGAIR---VTPPPMSSFLNGD-----------------------GEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAV--INNT-----------AGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +L D    + ++I +GPFS V R +H  + ++F ++ +++  F    GL   ++  E  IC  L++P+I  L +T +S    +++FE MEG+D+CFEIV+RA+ GFV+SE V SHY RQ+++AL YCH   I+HRD++PH ++LA+K+ SAP+KL GFG+A  L     ++ G                   GRVG P FMAPE+VR++      D W  GV+LF+LL+G LPF G+   ++ +I+     +   + N IS  AR+LV R+L+ DP KR++ +EAL H WI  K   A + H+++ +++++++N  RKLK  VL+AV+S ++           +AF       GD        S D      D +LS A  V   LD++  +            F   + +D  +  LL +YD I +          D STLR K+ L +++ +       EA EL+ +++SPH  + + A DV   +I        G G      V+  P  ++LNG                          D  E EL   ++R+RLVQFQK+T EPMGITLK+N++G+C VARIMHGGMIHRQ TLHVGDEIREIN  SV  R++E LQ++L++ARG VT KI+PSYR  P  CEI+V+A F+Y P  DDLIPC QAG+ FK GDILQ+ISKDDHNWWQAR  S+   I N+           AGLIPSPELQEWR+A LA+ERSK     +C WF KKK+    KY  KHS +FDQLDLVTYEEV+RL  ++RKTLVLLGAHGVGRRHIKN LI   P+RFAYPIPHTTRPPRKDEV+GK+Y+FV++E+MM DI NNEYLEYGTHEE+MYGTKL+TIR+IH +G IAILDVEPQAL+VLRTAE+SP+VVFIAAP L  M D     DGSLE+L  ES++L   +GH FD  I N+DI+DTI QL+R ++++ +  QW+PV WVY
Sbjct:   11 LLLDEQLSIRDVIEQGPFSNVYRILHGPSNRKFLLRSINLNLFRQHTGLGFEEIDEEIRICQNLQHPYICRLEKTINSVHYRHIIFENMEGNDICFEIVQRASNGFVFSEYVVSHYTRQLLDALDYCHTRKIVHRDVRPHNLVLASKDTSAPLKLCGFGVAKDLS----EIGGSM---------------ACGRVGVPQFMAPEIVRKDRVSCSSDIWSSGVVLFLLLAGRLPFSGSTSDIYERIMQTDVDVDGYMPN-ISESARNLVRRMLNADPSKRISAKEALNHEWIRDKEHMASRKHMNDVIDQMRRYNESRKLKSNVLSAVNSGRFDETTPRQDTPQTAFVDGSSPGGDCCHRGESSSNDAAEPPADKDLSGAYKVLGSLDAINSLLDPNSYKPGSTTF-QKIHDDGSVRNLLRLYDKIKALPCEPVVTEVDTSTLR-KETLNQIDGLLGPS--PEALELRQLLNSPHLASCVQALDVVVCEIRDPKNEASGSGDKEGNCVSSDPAPAYLNGGVLPLGAQRAGTSFEHFNQSAVHTSYDEEEEELYDCMSRLRLVQFQKDTQEPMGITLKVNEDGRCFVARIMHGGMIHRQATLHVGDEIREINGMSVANRSVESLQEMLRDARGQVTFKIIPSYRSAPPACEIFVRAQFDYEPSQDDLIPCPQAGIPFKTGDILQVISKDDHNWWQARFVSSFPSIGNSSNAQRSNQQQVAGLIPSPELQEWRTACLAMERSKNTCNTHCMWFNKKKKYYTTKYLQKHSALFDQLDLVTYEEVMRLSQYRRKTLVLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKDEVDGKHYYFVTNEQMMADIQNNEYLEYGTHEESMYGTKLETIRNIHKSGKIAILDVEPQALKVLRTAEYSPFVVFIAAPNLQGMQDP----DGSLEKLLNESDVLRQAFGHLFDFIITNSDIDDTIAQLERLVEKLPAYPQWLPVTWVY 961          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Celegans
Match: lin-2 (pep chromosome:WBcel235:X:12399517:12406131:-1 gene:WBGene00002991.1 transcript:F17E5.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-2)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 310/542 (57.20%), Postives = 382/542 (70.48%), Query Frame = 2
Query: 1313 DDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDI-------YGDGAIR---VTPPPMSSFLNG-----------------------DGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAV--INNT-----------AGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            D STLR K+ L +++ +       EA EL+ +++SPH  + + A DV   +I        G G      V+  P  ++LNG                          D  E EL   ++R+RLVQFQK+T EPMGITLK+N++G+C VARIMHGGMIHRQ TLHVGDEIREIN  SV  R++E LQ++L++ARG VT KI+PSYR  P  CEI+V+A F+Y P  DDLIPC QAG+ FK GDILQ+ISKDDHNWWQAR  S+   I N+           AGLIPSPELQEWR+A LA+ERSK     +C WF KKK+    KY  KHS +FDQLDLVTYEEV+RL  ++RKTLVLLGAHGVGRRHIKN LI   P+RFAYPIPHTTRPPRKDEV+GK+Y+FV++E+MM DI NNEYLEYGTHEE+MYGTKL+TIR+IH +G IAILDVEPQAL+VLRTAE+SP+VVFIAAP L  M D     DGSLE+L  ES++L   +GH FD  I N+DI+DTI QL+R ++++ +  QW+PV WVY
Sbjct:   86 DTSTLR-KETLNQIDGLLGPS--PEALELRQLLNSPHLASCVQALDVVVCEIRDPKNEASGSGDKEGNCVSSDPAPAYLNGGVLPLGAQRAGTSFEHFNQSAVHTSYDEEEEELYDCMSRLRLVQFQKDTQEPMGITLKVNEDGRCFVARIMHGGMIHRQATLHVGDEIREINGMSVANRSVESLQEMLRDARGQVTFKIIPSYRSAPPACEIFVRAQFDYEPSQDDLIPCPQAGIPFKTGDILQVISKDDHNWWQARFVSSFPSIGNSSNAQRSNQQQVAGLIPSPELQEWRTACLAMERSKNTCNTHCMWFNKKKKYYTTKYLQKHSALFDQLDLVTYEEVMRLSQYRRKTLVLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKDEVDGKHYYFVTNEQMMADIQNNEYLEYGTHEESMYGTKLETIRNIHKSGKIAILDVEPQALKVLRTAEYSPFVVFIAAPNLQGMQD----PDGSLEKLLNESDVLRQAFGHLFDFIITNSDIDDTIAQLERLVEKLPAYPQWLPVTWVY 620          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 242.276 bits (617), Expect = 2.528e-71
Identity = 136/336 (40.48%), Postives = 204/336 (60.71%), Query Frame = 2
Query:   56 MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYG-TQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMK 1057
            M     F + Y + E +GKG FS+VRRC+HK T  +FA KI++  K +         L+REA IC  L++P+IV L ++   +   Y+VF+ + G +L  +IV R      YSEA ASH I+QI+E++ YCH + I+HRDLKP  +LLA+K   A VKL  FG+A++++        D+  +             +G  GTP +++PEV++++PY KPVD W CGV+L+ILL G  PF+   Q  L+AQI  G Y   S  W+ ++ EA+ L+  +L ++P KR+T ++AL+ PWI  + R A   H  +TV+ LKKFN+RRKLKG +L  + + +
Sbjct:    2 MNASTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLS---ARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVARE----FYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVN--------DSEAW-------------HGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATR 309          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 242.276 bits (617), Expect = 2.528e-71
Identity = 136/336 (40.48%), Postives = 204/336 (60.71%), Query Frame = 2
Query:   56 MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYG-TQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMK 1057
            M     F + Y + E +GKG FS+VRRC+HK T  +FA KI++  K +         L+REA IC  L++P+IV L ++   +   Y+VF+ + G +L  +IV R      YSEA ASH I+QI+E++ YCH + I+HRDLKP  +LLA+K   A VKL  FG+A++++        D+  +             +G  GTP +++PEV++++PY KPVD W CGV+L+ILL G  PF+   Q  L+AQI  G Y   S  W+ ++ EA+ L+  +L ++P KR+T ++AL+ PWI  + R A   H  +TV+ LKKFN+RRKLKG +L  + + +
Sbjct:    2 MNASTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLS---ARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVARE----FYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVN--------DSEAW-------------HGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATR 309          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 242.276 bits (617), Expect = 2.528e-71
Identity = 136/336 (40.48%), Postives = 204/336 (60.71%), Query Frame = 2
Query:   56 MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYG-TQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMK 1057
            M     F + Y + E +GKG FS+VRRC+HK T  +FA KI++  K +         L+REA IC  L++P+IV L ++   +   Y+VF+ + G +L  +IV R      YSEA ASH I+QI+E++ YCH + I+HRDLKP  +LLA+K   A VKL  FG+A++++        D+  +             +G  GTP +++PEV++++PY KPVD W CGV+L+ILL G  PF+   Q  L+AQI  G Y   S  W+ ++ EA+ L+  +L ++P KR+T ++AL+ PWI  + R A   H  +TV+ LKKFN+RRKLKG +L  + + +
Sbjct:    2 MNASTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLS---ARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVARE----FYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVN--------DSEAW-------------HGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATR 309          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Fly
Match: CASK (gene:FBgn0013759 transcript:FBtr0084161)

HSP 1 Score: 1073.54 bits (2775), Expect = 0.000e+0
Identity = 545/920 (59.24%), Postives = 685/920 (74.46%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPD-DSTLRAKKVLEELNMVSYNEFL---REAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPV----FKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +EILFD+VY+LCE+IGKGPFSIVRRCIH+E+ QQFAVKIVD+ KFT SPGL+TADLKREA+ICH+LK+PHIVEL ETYSS+GMLYMVFE+MEGSDLCFE+V+RA AGFVYSEAVA HY+RQI+EALRYCHE++I+HRD++P C LLA  +NSAPVKLGGFG A+QL P T +                   + +GRVG PH+MAPEVV R  YGK  D WG GV+L +LLSG LPF G+   L   +  GR   ++  W  IS  A+DLV+++L  +P  RL+I E L HPWI  + +  +THL +TVEELK++N+RRKLKG V A          Y   A +    + D    E +   AV  ILD L+++  L +    D D L  +  D +LH  L+++D I +  +++ GR P  ++  R + VLE+L+  S    L      EEL  ++++PH  ALL++HDV A D+YG+ A+RVTPPPM  +LNGD  D+ E     +VTRVRLVQFQKNTDEPMGITLKM ++G+CIVARIMHGGMIHRQ TLHVGDEIREIN + V  +++  LQ++L+ ARGSVT KIVPSYR  P  CEI+V+A F+YNP DD+LIPC+QAG+ F++GDILQIISKDDH+WWQARL    +  +AGLIPSPELQEWR A   ++++KQE  NC+ FG+KK+Q +DKY AKH+ +FD LD+VTYEEVV++PV    F+RKTLVLLGAHGVGRRHIKN LI   PD++AYPIPHTTRP + +E NG++Y+FVSH+EMM DI  NEYLEYGTHE+AMYGTKLDTIR IH+ G +AILDVEPQAL++LRTAEF+PYVVFIAAP L  + D     DGSLERL++ESEML   YGH+FDL IVNNDI +TI  L+ +ID V ++ QWVPV+W+Y
Sbjct:    4 DEILFDDVYELCEVIGKGPFSIVRRCIHRESNQQFAVKIVDVAKFTASPGLSTADLKREATICHMLKHPHIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILEALRYCHENDILHRDVRPACALLATVDNSAPVKLGGFGSAIQL-PGTRETI-----------------ETHGRVGCPHYMAPEVVTRRLYGKGCDVWGAGVMLHVLLSGRLPFLGSGVRLQQSVARGRLSFEAPEWKSISANAKDLVMKMLAANPHHRLSITEVLDHPWIRDRDKLQRTHLADTVEELKRYNARRKLKGAVQAIAGGTNMDPLYATDADMPITGATDEWADEEAGIEAVQRILDCLDDIYSLQD-AHVDADVLRDMLRDNRLHQFLQLFDRIAATVVTSNGRAPAAEAVGRCRDVLEQLSSTSGGNSLGGKYAKEELMRLLAAPHMQALLHSHDVVARDVYGEEALRVTPPPMVPYLNGDELDNVEGGELQHVTRVRLVQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCEIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQARL--DTVGGSAGLIPSPELQEWRIACQTVDKTKQEQVNCSIFGRKKKQCRDKYLAKHNAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIADY----DGSLERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 898          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Fly
Match: CASK (gene:FBgn0013759 transcript:FBtr0330368)

HSP 1 Score: 1073.15 bits (2774), Expect = 0.000e+0
Identity = 545/920 (59.24%), Postives = 685/920 (74.46%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPD-DSTLRAKKVLEELNMVSYNEFL---REAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPV----FKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +EILFD+VY+LCE+IGKGPFSIVRRCIH+E+ QQFAVKIVD+ KFT SPGL+TADLKREA+ICH+LK+PHIVEL ETYSS+GMLYMVFE+MEGSDLCFE+V+RA AGFVYSEAVA HY+RQI+EALRYCHE++I+HRD++P C LLA  +NSAPVKLGGFG A+QL P T +                   + +GRVG PH+MAPEVV R  YGK  D WG GV+L +LLSG LPF G+   L   +  GR   ++  W  IS  A+DLV+++L  +P  RL+I E L HPWI  + +  +THL +TVEELK++N+RRKLKG V A          Y   A +    + D    E +   AV  ILD L+++  L +    D D L  +  D +LH  L+++D I +  +++ GR P  ++  R + VLE+L+  S    L      EEL  ++++PH  ALL++HDV A D+YG+ A+RVTPPPM  +LNGD  D+ E     +VTRVRLVQFQKNTDEPMGITLKM ++G+CIVARIMHGGMIHRQ TLHVGDEIREIN + V  +++  LQ++L+ ARGSVT KIVPSYR  P  CEI+V+A F+YNP DD+LIPC+QAG+ F++GDILQIISKDDH+WWQARL    +  +AGLIPSPELQEWR A   ++++KQE  NC+ FG+KK+Q +DKY AKH+ +FD LD+VTYEEVV++PV    F+RKTLVLLGAHGVGRRHIKN LI   PD++AYPIPHTTRP + +E NG++Y+FVSH+EMM DI  NEYLEYGTHE+AMYGTKLDTIR IH+ G +AILDVEPQAL++LRTAEF+PYVVFIAAP L  + D     DGSLERL++ESEML   YGH+FDL IVNNDI +TI  L+ +ID V ++ QWVPV+W+Y
Sbjct:    4 DEILFDDVYELCEVIGKGPFSIVRRCIHRESNQQFAVKIVDVAKFTASPGLSTADLKREATICHMLKHPHIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILEALRYCHENDILHRDVRPACALLATVDNSAPVKLGGFGSAIQL-PGTRETI-----------------ETHGRVGCPHYMAPEVVTRRLYGKGCDVWGAGVMLHVLLSGRLPFLGSGVRLQQSVARGRLSFEAPEWKSISANAKDLVMKMLAANPHHRLSITEVLDHPWIRDRDKLQRTHLADTVEELKRYNARRKLKGAVQAIAGGTNMDPLYATDADMPITGATDEWADEEAGIEAVQRILDCLDDIYSLQD-AHVDADVLRDMLRDNRLHQFLQLFDRIAATVVTSNGRAPAAEAVGRCRDVLEQLSSTSGGNSLGGKYAKEELMRLLAAPHMQALLHSHDVVARDVYGEEALRVTPPPMVPYLNGDELDNVEGGELQHVTRVRLVQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCEIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQARL--DTVGGSAGLIPSPELQEWRIACQTVDKTKQEQVNCSIFGRKKKQCRDKYLAKHNAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIADY----DGSLERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 898          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Fly
Match: CASK (gene:FBgn0013759 transcript:FBtr0301327)

HSP 1 Score: 1063.14 bits (2748), Expect = 0.000e+0
Identity = 545/938 (58.10%), Postives = 685/938 (73.03%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPD-DSTLRAKKVLEELNMVSYNEFLR---EAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE------------------TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPV----FKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +EILFD+VY+LCE+IGKGPFSIVRRCIH+E+ QQFAVKIVD+ KFT SPGL+TADLKREA+ICH+LK+PHIVEL ETYSS+GMLYMVFE+MEGSDLCFE+V+RA AGFVYSEAVA HY+RQI+EALRYCHE++I+HRD++P C LLA  +NSAPVKLGGFG A+QL P T +                   + +GRVG PH+MAPEVV R  YGK  D WG GV+L +LLSG LPF G+   L   +  GR   ++  W  IS  A+DLV+++L  +P  RL+I E L HPWI  + +  +THL +TVEELK++N+RRKLKG V A          Y   A +    + D    E +   AV  ILD L+++  L +    D D L  +  D +LH  L+++D I +  +++ GR P  ++  R + VLE+L+  S    L      EEL  ++++PH  ALL++HDV A D+YG+ A+RVTPPPM  +LNGD  D+ E     +VTRVRLVQFQKNTDEPMGITLKM ++G+CIVARIMHGGMIHRQ TLHVGDEIREIN + V  +++  LQ++L+ ARGSVT KIVPSYR  P  CEI+V+A F+YNP DD+LIPC+QAG+ F++GDILQIISKDDH+WWQARL    +  +AGLIPSPELQEWR A   ++++KQE                    NC+ FG+KK+Q +DKY AKH+ +FD LD+VTYEEVV++PV    F+RKTLVLLGAHGVGRRHIKN LI   PD++AYPIPHTTRP + +E NG++Y+FVSH+EMM DI  NEYLEYGTHE+AMYGTKLDTIR IH+ G +AILDVEPQAL++LRTAEF+PYVVFIAAP L  + D     DGSLERL++ESEML   YGH+FDL IVNNDI +TI  L+ +ID V ++ QWVPV+W+Y
Sbjct:    4 DEILFDDVYELCEVIGKGPFSIVRRCIHRESNQQFAVKIVDVAKFTASPGLSTADLKREATICHMLKHPHIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILEALRYCHENDILHRDVRPACALLATVDNSAPVKLGGFGSAIQL-PGTRETI-----------------ETHGRVGCPHYMAPEVVTRRLYGKGCDVWGAGVMLHVLLSGRLPFLGSGVRLQQSVARGRLSFEAPEWKSISANAKDLVMKMLAANPHHRLSITEVLDHPWIRDRDKLQRTHLADTVEELKRYNARRKLKGAVQAIAGGTNMDPLYATDADMPITGATDEWADEEAGIEAVQRILDCLDDIYSLQD-AHVDADVLRDMLRDNRLHQFLQLFDRIAATVVTSNGRAPAAEAVGRCRDVLEQLSSTSGGNSLGGKYAKEELMRLLAAPHMQALLHSHDVVARDVYGEEALRVTPPPMVPYLNGDELDNVEGGELQHVTRVRLVQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCEIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQARL--DTVGGSAGLIPSPELQEWRIACQTVDKTKQEQGEPGAGCSAHADGCDGSAVNCSIFGRKKKQCRDKYLAKHNAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIADY----DGSLERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 916          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Fly
Match: CASK (gene:FBgn0013759 transcript:FBtr0112873)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 308/470 (65.53%), Postives = 376/470 (80.00%), Query Frame = 2
Query: 1430 ALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE----------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPV----FKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            ALL++HDV A D+YG+ A+RVTPPPM  +LNGD  D+ E     +VTRVRLVQFQKNTDEPMGITLKM ++G+CIVARIMHGGMIHRQ TLHVGDEIREIN + V  +++  LQ++L+ ARGSVT KIVPSYR  P  CE          I+V+A F+YNP DD+LIPC+QAG+ F++GDILQIISKDDH+WWQARL    +  +AGLIPSPELQEWR A   ++++KQE  NC+ FG+KK+Q +DKY AKH+ +FD LD+VTYEEVV++PV    F+RKTLVLLGAHGVGRRHIKN LI   PD++AYPIPHTTRP + +E NG++Y+FVSH+EMM DI  NEYLEYGTHE+AMYGTKLDTIR IH+ G +AILDVEPQAL++LRTAEF+PYVVFIAAP L  + D     DGSLERL++ESEML   YGH+FDL IVNNDI +TI  L+ +ID V ++ QWVPV+W+Y
Sbjct:    6 ALLHSHDVVARDVYGEEALRVTPPPMVPYLNGDELDNVEGGELQHVTRVRLVQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCELFRIRPAPVLIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQARL--DTVGGSAGLIPSPELQEWRIACQTVDKTKQEQVNCSIFGRKKKQCRDKYLAKHNAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIADY----DGSLERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 469          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Fly
Match: CASK (gene:FBgn0013759 transcript:FBtr0112872)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 308/470 (65.53%), Postives = 376/470 (80.00%), Query Frame = 2
Query: 1430 ALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE----------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPV----FKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            ALL++HDV A D+YG+ A+RVTPPPM  +LNGD  D+ E     +VTRVRLVQFQKNTDEPMGITLKM ++G+CIVARIMHGGMIHRQ TLHVGDEIREIN + V  +++  LQ++L+ ARGSVT KIVPSYR  P  CE          I+V+A F+YNP DD+LIPC+QAG+ F++GDILQIISKDDH+WWQARL    +  +AGLIPSPELQEWR A   ++++KQE  NC+ FG+KK+Q +DKY AKH+ +FD LD+VTYEEVV++PV    F+RKTLVLLGAHGVGRRHIKN LI   PD++AYPIPHTTRP + +E NG++Y+FVSH+EMM DI  NEYLEYGTHE+AMYGTKLDTIR IH+ G +AILDVEPQAL++LRTAEF+PYVVFIAAP L  + D     DGSLERL++ESEML   YGH+FDL IVNNDI +TI  L+ +ID V ++ QWVPV+W+Y
Sbjct:  128 ALLHSHDVVARDVYGEEALRVTPPPMVPYLNGDELDNVEGGELQHVTRVRLVQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCELFRIRPAPVLIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQARL--DTVGGSAGLIPSPELQEWRIACQTVDKTKQEQVNCSIFGRKKKQCRDKYLAKHNAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIADY----DGSLERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 591          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Zebrafish
Match: caska (calcium/calmodulin-dependent serine protein kinase a [Source:ZFIN;Acc:ZDB-GENE-020802-4])

HSP 1 Score: 1187.56 bits (3071), Expect = 0.000e+0
Identity = 614/950 (64.63%), Postives = 742/950 (78.11%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W  IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+D  LH LL++YD IN+++         D+  RAK+VLEE++    N    +A+EL+ I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMND   CIVARIMHGGMIHRQGTLH+GDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                                   IYV+A FEY+P  DDLIPC +AG++F++GDI+QII+KDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNYFFVSH++MM+DI+NN+YLEYG+HE+AMYGT+L+TIR IH  GLIAILDVEPQAL+VLRTAEF+PYVVFIAAP   T+T   N  D SL+RL +ESE+L+  Y HYFD  I+NN+I++TIR L+ +ID V S+AQWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEAIIKGKYKMNPRQWGHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDHHLHTLLDLYDKINTKSSPQIRNPSSDAVQRAKEVLEEISCYPENT---DAKELRRILTQPHFMALLQTHDVVAHEVYSDDAMRVTPPPTSPYLNGDSPESTNGDMDIENVTRVRLVQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHIGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQQSSCEKESPSTSRQSPANGHSSINSSILDLPSTIQPKGRQIYVRAQFEYDPVKDDLIPCKEAGIRFRVGDIIQIINKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNDYLEYGSHEDAMYGTRLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPYVVFIAAP---TITPGMN-EDESLQRLQKESEILQKTYAHYFDQTIINNEIDETIRLLEEAIDMVCSTAQWVPVSWVY 920          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Zebrafish
Match: caska (calcium/calmodulin-dependent serine protein kinase a [Source:ZFIN;Acc:ZDB-GENE-020802-4])

HSP 1 Score: 1157.9 bits (2994), Expect = 0.000e+0
Identity = 603/933 (64.63%), Postives = 723/933 (77.49%), Query Frame = 2
Query:  113 GPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYH-MKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            GPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y  M  + W  IS  A+DLV R+L LDP +R+T+ EAL HPW+ +   A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+D  LH LL++YD IN+++         D+  RAK+VLEE++    N    +A+EL+ I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMND   CIVARIMHGGMIHRQGTLH+GDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                                   IYV+A FEY+P  DDLIPC +AG++F++GDI+QII+KDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNYFFVSH++MM+DI+NN+YLEYG+HE+AMYGT+L+TIR IH  GLIAILDVEPQAL+VLRTAEF+PYVVFIAAP   T+T   N  D SL+RL +ESE+L+  Y HYFD  I+NN+I++TIR L+ +ID V S+AQWVPV+WVY
Sbjct:    2 GPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEAIIKGKYKVMNPRQWGHISESAKDLVRRMLMLDPAERITVYEALNHPWLKRDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDHHLHTLLDLYDKINTKSSPQIRNPSSDAVQRAKEVLEEISCYPENT---DAKELRRILTQPHFMALLQTHDVVAHEVYSDDAMRVTPPPTSPYLNGDSPESTNGDMDIENVTRVRLVQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHIGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQQSSCEKESPSTSRQSPANGHSSINSSILDLPSTIQPKGRQIYVRAQFEYDPVKDDLIPCKEAGIRFRVGDIIQIINKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNDYLEYGSHEDAMYGTRLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPYVVFIAAP---TITPGMN-EDESLQRLQKESEILQKTYAHYFDQTIINNEIDETIRLLEEAIDMVCSTAQWVPVSWVY 901          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Zebrafish
Match: caskb (calcium/calmodulin-dependent serine protein kinase b [Source:ZFIN;Acc:ZDB-GENE-030131-4473])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 316/494 (63.97%), Postives = 376/494 (76.11%), Query Frame = 2
Query: 1430 ALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQC-----------------------------------EIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQET-ANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLA-TMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            ALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +L+  NVTRVRLVQFQKNTDEPMGITLKMND   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR   + C                                   +IYV+A FEY+P  D+LIPC +AG++F++GDI+QIISKDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+      DLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PD+FAYPIPHTTRPP+KDE NGKNYFFVSH++MM+DI+NNEYLEYG+HE+AMYGT+L+TIR IH   ++AILDVEPQAL+VLRTAEFSPYVVFIAAP +   MT+     D SL+RL +ESE L+  Y HYFD  I+NN+I+DTIR L+ +++ V S+AQWVPV+WVY
Sbjct:    2 ALLQTHDVVAHEVYSDDALRVTPPPTSPYLNGDSPESVNGDLDLENVTRVRLVQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRSQSLSCDKESPDLSRQSPANGHSSVTSSILDLPSTIQPKGRQIYVRAQFEYDPAKDELIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNA-----DLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLIAKHPDKFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTRLETIRKIHELNMVAILDVEPQALKVLRTAEFSPYVVFIAAPTITPAMTE-----DESLQRLQKESEALQHSYAHYFDQTIINNEIDDTIRLLEEAVELVCSTAQWVPVSWVY 484          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Zebrafish
Match: mpp1 (membrane protein, palmitoylated 1 [Source:ZFIN;Acc:ZDB-GENE-031113-4])

HSP 1 Score: 456.062 bits (1172), Expect = 2.113e-149
Identity = 219/413 (53.03%), Postives = 307/413 (74.33%), Query Frame = 2
Query: 1562 NVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTD-VHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            + TR+R V F+KN  EP+G+TLK+N++ +C VARI+HGGMIHRQG+LH GDEI EIN +SV  ++++ LQK+LK+  G VTLKI+ + +  PM CE+Y++A F+Y+P  D+LIPC +AG+KF+ GDI+ II+K D NWWQ ++ S+   + AGLIPSPELQEWR AS + + +++   +C+ FGKKK+    KY AKHS +FDQLD+++YEEVVRLP F RKTLVL+GAHGVGR  IKN L+   P++FAYP PHTTRP +KDE NGK Y+F+S++EM + I  NE LEYG+++  M+GTK++TI  IH  G IA+LDVEPQ L+VLRTAEF+P V+FIA       ++ V N+         +ES+ L   + H+FD  +VNND++++++ ++ +I+   SS QWVP++WVY
Sbjct:   67 DATRMREVAFEKNPSEPLGVTLKLNEKQRCTVARILHGGMIHRQGSLHEGDEIAEINGKSVSNQSVDQLQKILKDTNGVVTLKIISNQQSRPMACEMYMRAQFDYDPAKDELIPCKEAGLKFQTGDIIHIINKKDPNWWQGKVDSSS-TDFAGLIPSPELQEWRVASKS-KATREAGQSCSPFGKKKKCKD-KYLAKHSSIFDQLDVISYEEVVRLPAFNRKTLVLIGAHGVGRSLIKNSLLSKYPEKFAYPAPHTTRPQKKDEENGKEYYFISNDEMTKGIVGNELLEYGSYQGHMFGTKIETIHKIHEQGKIAVLDVEPQTLKVLRTAEFAPLVIFIAPTNTGNQSEAVQNIQ--------KESDSLLAAHRHFFDEILVNNDVDESVKGVEDAIERASSSPQWVPISWVY 468          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Zebrafish
Match: mpp1 (membrane protein, palmitoylated 1 [Source:ZFIN;Acc:ZDB-GENE-031113-4])

HSP 1 Score: 437.187 bits (1123), Expect = 4.121e-142
Identity = 212/403 (52.61%), Postives = 298/403 (73.95%), Query Frame = 2
Query: 1562 NVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTD-VHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSS 2767
            + TR+R V F+KN  EP+G+TLK+N++ +C VARI+HGGMIHRQG+LH GDEI EIN +SV  ++++ LQK+LK+  G VTLKI+ + +  PM CE+Y++A F+Y+P  D+LIPC +AG+KF+ GDI+ II+K D NWWQ ++ S+   + AGLIPSPELQEWR AS + + +++   +C+ FGKKK+    KY AKHS +FDQLD+++YEEVVRLP F RKTLVL+GAHGVGR  IKN L+   P++FAYP PHTTRP +KDE NGK Y+F+S++EM + I  NE LEYG+++  M+GTK++TI  IH  G IA+LDVEPQ L+VLRTAEF+P V+FIA       ++ V N+         +ES+ L   + H+FD  +VNND++++++ ++ +I+   SS
Sbjct:   67 DATRMREVAFEKNPSEPLGVTLKLNEKQRCTVARILHGGMIHRQGSLHEGDEIAEINGKSVSNQSVDQLQKILKDTNGVVTLKIISNQQSRPMACEMYMRAQFDYDPAKDELIPCKEAGLKFQTGDIIHIINKKDPNWWQGKVDSSS-TDFAGLIPSPELQEWRVASKS-KATREAGQSCSPFGKKKKCKD-KYLAKHSSIFDQLDVISYEEVVRLPAFNRKTLVLIGAHGVGRSLIKNSLLSKYPEKFAYPAPHTTRPQKKDEENGKEYYFISNDEMTKGIVGNELLEYGSYQGHMFGTKIETIHKIHEQGKIAVLDVEPQTLKVLRTAEFAPLVIFIAPTNTGNQSEAVQNIQ--------KESDSLLAAHRHFFDEILVNNDVDESVKGVEDAIERASSS 458          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Xenopus
Match: wbp11 (WW domain binding protein 11 [Source:Xenbase;Acc:XB-GENE-966604])

HSP 1 Score: 1213.36 bits (3138), Expect = 0.000e+0
Identity = 616/915 (67.32%), Postives = 743/915 (81.20%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + WN IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CEIYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L +A  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNYFFVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP +          D SL+RL +ESE+L+  Y HYFDL I+NN+I++TIR L+ +I+ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWNHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENAK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPSIS----EDESLQRLQKESEILQRTYAHYFDLTIINNEIDETIRHLEDAIELVCTAPQWVPVSWVY 885          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Xenopus
Match: wbp11 (WW domain binding protein 11 [Source:Xenbase;Acc:XB-GENE-966604])

HSP 1 Score: 1204.5 bits (3115), Expect = 0.000e+0
Identity = 616/928 (66.38%), Postives = 743/928 (80.06%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSID-MEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + WN IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D    G L++  AVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE            IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L +A  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNYFFVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP +          D SL+RL +ESE+L+  Y HYFDL I+NN+I++TIR L+ +I+ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWNHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEDIPTTTQTKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENAK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPSIS----EDESLQRLQKESEILQRTYAHYFDLTIINNEIDETIRHLEDAIELVCTAPQWVPVSWVY 903          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Xenopus
Match: wbp11 (WW domain binding protein 11 [Source:Xenbase;Acc:XB-GENE-966604])

HSP 1 Score: 1196.03 bits (3093), Expect = 0.000e+0
Identity = 616/951 (64.77%), Postives = 743/951 (78.13%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSID-MEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + WN IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D    G L++  AVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                                   IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L +A  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNYFFVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP +          D SL+RL +ESE+L+  Y HYFDL I+NN+I++TIR L+ +I+ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWNHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSINNSVSDIPTTTQTKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENAK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPSIS----EDESLQRLQKESEILQRTYAHYFDLTIINNEIDETIRHLEDAIELVCTAPQWVPVSWVY 926          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Xenopus
Match: wbp11 (WW domain binding protein 11 [Source:Xenbase;Acc:XB-GENE-966604])

HSP 1 Score: 1196.03 bits (3093), Expect = 0.000e+0
Identity = 616/950 (64.84%), Postives = 743/950 (78.21%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + WN IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                                   IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L +A  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNYFFVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP +          D SL+RL +ESE+L+  Y HYFDL I+NN+I++TIR L+ +I+ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWNHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSINNSVSDIPTTTQTKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENAK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPSIS----EDESLQRLQKESEILQRTYAHYFDLTIINNEIDETIRHLEDAIELVCTAPQWVPVSWVY 920          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Xenopus
Match: wbp11 (WW domain binding protein 11 [Source:Xenbase;Acc:XB-GENE-966604])

HSP 1 Score: 1182.93 bits (3059), Expect = 0.000e+0
Identity = 611/942 (64.86%), Postives = 738/942 (78.34%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSID-MEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE--------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + WN IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D    G L++  AVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                          IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L +A  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+      DLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNYFFVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP +          D SL+RL +ESE+L+  Y HYFDL I+NN+I++TIR L+ +I+ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWNHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSINNSVSVRPIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENAK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNA-----DLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPSIS----EDESLQRLQKESEILQRTYAHYFDLTIINNEIDETIRHLEDAIELVCTAPQWVPVSWVY 912          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Mouse
Match: Cask (calcium/calmodulin-dependent serine protein kinase (MAGUK family) [Source:MGI Symbol;Acc:MGI:1309489])

HSP 1 Score: 1197.96 bits (3098), Expect = 0.000e+0
Identity = 614/927 (66.24%), Postives = 746/927 (80.47%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE            IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L ++  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP   T+T   N  D SL+RL +ES++L+  Y HYFDL I+NN+I++TIR L+ +++ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLN-EDESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 897          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Mouse
Match: Cask (calcium/calmodulin-dependent serine protein kinase (MAGUK family) [Source:MGI Symbol;Acc:MGI:1309489])

HSP 1 Score: 1196.03 bits (3093), Expect = 0.000e+0
Identity = 614/938 (65.46%), Postives = 746/938 (79.53%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                       IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L ++  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP   T+T   N  D SL+RL +ES++L+  Y HYFDL I+NN+I++TIR L+ +++ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLN-EDESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 908          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Mouse
Match: Cask (calcium/calmodulin-dependent serine protein kinase (MAGUK family) [Source:MGI Symbol;Acc:MGI:1309489])

HSP 1 Score: 1192.95 bits (3085), Expect = 0.000e+0
Identity = 614/950 (64.63%), Postives = 746/950 (78.53%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                                   IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L ++  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP   T+T   N  D SL+RL +ES++L+  Y HYFDL I+NN+I++TIR L+ +++ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLN-EDESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 920          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Mouse
Match: Cask (calcium/calmodulin-dependent serine protein kinase (MAGUK family) [Source:MGI Symbol;Acc:MGI:1309489])

HSP 1 Score: 1161.75 bits (3004), Expect = 0.000e+0
Identity = 599/904 (66.26%), Postives = 723/904 (79.98%), Query Frame = 2
Query:  131 RRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQET-ANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            RRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE            IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L ++  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP   T+T   N  D SL+RL +ES++L+  Y HYFDL I+NN+I++TIR L+ +++ V ++ QWVPV+WVY
Sbjct:    1 RRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCEDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLN-EDESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 871          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Mouse
Match: Mpp1 (membrane protein, palmitoylated [Source:MGI Symbol;Acc:MGI:105941])

HSP 1 Score: 466.077 bits (1198), Expect = 3.227e-153
Identity = 230/454 (50.66%), Postives = 323/454 (71.15%), Query Frame = 2
Query: 1436 LNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            LN  +VT  D+Y +G+     P   S  +  G+++          RVRL+QF+K T+EPMGITLK+N++  C VARI+HGGMIHRQG+LHVGDEI EIN  +V   +++ LQK +K  +G ++LK++ + +      +++++A F+Y+P+ D+LIPC +AG+KF  GDI+QII+KDD NWWQ R+  +    +AGLIPSPELQEWR AS+A   +  E  +C+ FGKKK+    KY AKHS +FDQLD+V+YEEVVRLP FKRKTLVL+GA GVGR HIKN L+   P++FAYP P+TTRPP+K E +GK Y F+S EEM ++I+ NE+LE+G+++  M+GTK +T+  IH    IAILD+EPQ L+ +RTAE SP++VFIA     T T+        L++L ++SE +  QY HYFDL +VNN +++T+++L+ + D+  SS QWVPV+WVY
Sbjct:   37 LNQSNVTTEDMYTNGS-----PAPGSPAHAKGQEA---------RRVRLIQFEKITEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIANQQSRLPALQMFMRAQFDYDPQKDNLIPCKEAGLKFVTGDIIQIINKDDSNWWQGRVEGSS-KESAGLIPSPELQEWRVASVA-HSAPSEAPSCSPFGKKKKCKD-KYLAKHSSIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKNGLLSHNPEKFAYPAPYTTRPPKKSEEDGKEYHFISTEEMTKNISANEFLEFGSYQGNMFGTKFETVHQIHKQDKIAILDIEPQTLKTVRTAELSPFIVFIAPTDQGTQTEA-------LQQLQKDSEAIRSQYAHYFDLSLVNNSVDETLKKLQEAFDQACSSPQWVPVSWVY 466          
BLAST of Peripheral plasma membrane protein CASK vs. UniProt/SwissProt
Match: sp|O70589|CSKP_MOUSE (Peripheral plasma membrane protein CASK OS=Mus musculus OX=10090 GN=Cask PE=1 SV=2)

HSP 1 Score: 1191.79 bits (3082), Expect = 0.000e+0
Identity = 614/951 (64.56%), Postives = 746/951 (78.44%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSID-MEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D    G L++  AVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                                   IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L ++  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP   T+T   N  D SL+RL +ES++L+  Y HYFDL I+NN+I++TIR L+ +++ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLN-EDESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 926          
BLAST of Peripheral plasma membrane protein CASK vs. UniProt/SwissProt
Match: sp|O14936|CSKP_HUMAN (Peripheral plasma membrane protein CASK OS=Homo sapiens OX=9606 GN=CASK PE=1 SV=3)

HSP 1 Score: 1191.79 bits (3082), Expect = 0.000e+0
Identity = 614/951 (64.56%), Postives = 746/951 (78.44%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSID-MEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D    G L++  AVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                                   IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L ++  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF+P+VVFIAAP   T+T   N  D SL+RL +ES++L+  Y HYFDL I+NN+I++TIR L+ +++ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP---TITPGLN-EDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 926          
BLAST of Peripheral plasma membrane protein CASK vs. UniProt/SwissProt
Match: sp|Q62915|CSKP_RAT (Peripheral plasma membrane protein CASK OS=Rattus norvegicus OX=10116 GN=Cask PE=1 SV=1)

HSP 1 Score: 1173.3 bits (3034), Expect = 0.000e+0
Identity = 607/939 (64.64%), Postives = 739/939 (78.70%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSID-MEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP     D S D    G L++  AVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    +A+ELK I++ PHFMALL  H V AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMN+   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                       IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L ++  N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+      DLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   P+RFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGTKL+TIR IH  GLIAILDVEPQAL+VLRTAEF P+VVFIAAP   T+T   N  D SL+RL +ES++L+  Y HYFDL I+NN+I++TIR L+ +++ V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPEN---NDAKELKRILTQPHFMALLQTHHVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNA-----DLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPERFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFPPFVVFIAAP---TITPGLN-EDESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 909          
BLAST of Peripheral plasma membrane protein CASK vs. UniProt/SwissProt
Match: sp|Q24210|CSKP_DROME (Peripheral plasma membrane protein CASK OS=Drosophila melanogaster OX=7227 GN=CASK PE=1 SV=4)

HSP 1 Score: 1073.54 bits (2775), Expect = 0.000e+0
Identity = 545/920 (59.24%), Postives = 685/920 (74.46%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPD-DSTLRAKKVLEELNMVSYNEFL---REAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPV----FKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +EILFD+VY+LCE+IGKGPFSIVRRCIH+E+ QQFAVKIVD+ KFT SPGL+TADLKREA+ICH+LK+PHIVEL ETYSS+GMLYMVFE+MEGSDLCFE+V+RA AGFVYSEAVA HY+RQI+EALRYCHE++I+HRD++P C LLA  +NSAPVKLGGFG A+QL P T +                   + +GRVG PH+MAPEVV R  YGK  D WG GV+L +LLSG LPF G+   L   +  GR   ++  W  IS  A+DLV+++L  +P  RL+I E L HPWI  + +  +THL +TVEELK++N+RRKLKG V A          Y   A +    + D    E +   AV  ILD L+++  L +    D D L  +  D +LH  L+++D I +  +++ GR P  ++  R + VLE+L+  S    L      EEL  ++++PH  ALL++HDV A D+YG+ A+RVTPPPM  +LNGD  D+ E     +VTRVRLVQFQKNTDEPMGITLKM ++G+CIVARIMHGGMIHRQ TLHVGDEIREIN + V  +++  LQ++L+ ARGSVT KIVPSYR  P  CEI+V+A F+YNP DD+LIPC+QAG+ F++GDILQIISKDDH+WWQARL    +  +AGLIPSPELQEWR A   ++++KQE  NC+ FG+KK+Q +DKY AKH+ +FD LD+VTYEEVV++PV    F+RKTLVLLGAHGVGRRHIKN LI   PD++AYPIPHTTRP + +E NG++Y+FVSH+EMM DI  NEYLEYGTHE+AMYGTKLDTIR IH+ G +AILDVEPQAL++LRTAEF+PYVVFIAAP L  + D     DGSLERL++ESEML   YGH+FDL IVNNDI +TI  L+ +ID V ++ QWVPV+W+Y
Sbjct:    4 DEILFDDVYELCEVIGKGPFSIVRRCIHRESNQQFAVKIVDVAKFTASPGLSTADLKREATICHMLKHPHIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILEALRYCHENDILHRDVRPACALLATVDNSAPVKLGGFGSAIQL-PGTRETI-----------------ETHGRVGCPHYMAPEVVTRRLYGKGCDVWGAGVMLHVLLSGRLPFLGSGVRLQQSVARGRLSFEAPEWKSISANAKDLVMKMLAANPHHRLSITEVLDHPWIRDRDKLQRTHLADTVEELKRYNARRKLKGAVQAIAGGTNMDPLYATDADMPITGATDEWADEEAGIEAVQRILDCLDDIYSLQD-AHVDADVLRDMLRDNRLHQFLQLFDRIAATVVTSNGRAPAAEAVGRCRDVLEQLSSTSGGNSLGGKYAKEELMRLLAAPHMQALLHSHDVVARDVYGEEALRVTPPPMVPYLNGDELDNVEGGELQHVTRVRLVQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCEIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQARL--DTVGGSAGLIPSPELQEWRIACQTVDKTKQEQVNCSIFGRKKKQCRDKYLAKHNAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIADY----DGSLERLAKESEMLRQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY 898          
BLAST of Peripheral plasma membrane protein CASK vs. UniProt/SwissProt
Match: sp|P54936|LIN2_CAEEL (Protein lin-2 OS=Caenorhabditis elegans OX=6239 GN=lin-2 PE=1 SV=1)

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 460/979 (46.99%), Postives = 619/979 (63.23%), Query Frame = 2
Query:   68 ILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKW-----------SAFY------GDPAVINHDDSIDME----DGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIY-------GDGAIR---VTPPPMSSFLNGD-----------------------GEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAV--INNT-----------AGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +L D    + ++I +GPFS V R +H  + ++F ++ +++  F    GL   ++  E  IC  L++P+I  L +T +S    +++FE MEG+D+CFEIV+RA+ GFV+SE V SHY RQ+++AL YCH   I+HRD++PH ++LA+K+ SAP+KL GFG+A  L     ++ G                   GRVG P FMAPE+VR++      D W  GV+LF+LL+G LPF G+   ++ +I+     +   + N IS  AR+LV R+L+ DP KR++ +EAL H WI  K   A + H+++ +++++++N  RKLK  VL+AV+S ++           +AF       GD        S D      D +LS A  V   LD++  +            F   + +D  +  LL +YD I +          D STLR K+ L +++ +       EA EL+ +++SPH  + + A DV   +I        G G      V+  P  ++LNG                          D  E EL   ++R+RLVQFQK+T EPMGITLK+N++G+C VARIMHGGMIHRQ TLHVGDEIREIN  SV  R++E LQ++L++ARG VT KI+PSYR  P  CEI+V+A F+Y P  DDLIPC QAG+ FK GDILQ+ISKDDHNWWQAR  S+   I N+           AGLIPSPELQEWR+A LA+ERSK     +C WF KKK+    KY  KHS +FDQLDLVTYEEV+RL  ++RKTLVLLGAHGVGRRHIKN LI   P+RFAYPIPHTTRPPRKDEV+GK+Y+FV++E+MM DI NNEYLEYGTHEE+MYGTKL+TIR+IH +G IAILDVEPQAL+VLRTAE+SP+VVFIAAP L  M D     DGSLE+L  ES++L   +GH FD  I N+DI+DTI QL+R ++++ +  QW+PV WVY
Sbjct:   11 LLLDEQLSIRDVIEQGPFSNVYRILHGPSNRKFLLRSINLNLFRQHTGLGFEEIDEEIRICQNLQHPYICRLEKTINSVHYRHIIFENMEGNDICFEIVQRASNGFVFSEYVVSHYTRQLLDALDYCHTRKIVHRDVRPHNLVLASKDTSAPLKLCGFGVAKDLS----EIGGSM---------------ACGRVGVPQFMAPEIVRKDRVSCSSDIWSSGVVLFLLLAGRLPFSGSTSDIYERIMQTDVDVDGYMPN-ISESARNLVRRMLNADPSKRISAKEALNHEWIRDKEHMASRKHMNDVIDQMRRYNESRKLKSNVLSAVNSGRFDETTPRQDTPQTAFVDGSSPGGDCCHRGESSSNDAAEPPADKDLSGAYKVLGSLDAINSLLDPNSYKPGSTTF-QKIHDDGSVRNLLRLYDKIKALPCEPVVTEVDTSTLR-KETLNQIDGLLGPS--PEALELRQLLNSPHLASCVQALDVVVCEIRDPKNEASGSGDKEGNCVSSDPAPAYLNGGVLPLGAQRAGTSFEHFNQSAVHTSYDEEEEELYDCMSRLRLVQFQKDTQEPMGITLKVNEDGRCFVARIMHGGMIHRQATLHVGDEIREINGMSVANRSVESLQEMLRDARGQVTFKIIPSYRSAPPACEIFVRAQFDYEPSQDDLIPCPQAGIPFKTGDILQVISKDDHNWWQARFVSSFPSIGNSSNAQRSNQQQVAGLIPSPELQEWRTACLAMERSKNTCNTHCMWFNKKKKYYTTKYLQKHSALFDQLDLVTYEEVMRLSQYRRKTLVLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKDEVDGKHYYFVTNEQMMADIQNNEYLEYGTHEESMYGTKLETIRNIHKSGKIAILDVEPQALKVLRTAEYSPFVVFIAAPNLQGMQDP----DGSLEKLLNESDVLRQAFGHLFDFIITNSDIDDTIAQLERLVEKLPAYPQWLPVTWVY 961          
BLAST of Peripheral plasma membrane protein CASK vs. TrEMBL
Match: A0A4S2KYG7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010456 PE=3 SV=1)

HSP 1 Score: 1353.96 bits (3503), Expect = 0.000e+0
Identity = 659/919 (71.71%), Postives = 786/919 (85.53%), Query Frame = 2
Query:   56 MAE-EILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSP-EPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSK-QETANC-AWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATM-TDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            MAE +  FD++Y L E+IGKGPFS+VRRC+HKET  Q+AVKIVD+VKFT+SPGL+TADLKREASICH+LK+PHIVEL ETYSSDGMLYMVFEYM+G+DL FEIVKRATAGFVYSEAVASHY+RQ++EALRYCHE+NI+HRDLKPHCV+LA++ENSAPVKL GFG+A  +DP T +++GDT   VD++I +SL+ DQ GR+GTPHFMAPE+VRREPYGK VDAW CGVLLF LLSGSLPFYGT++ LF QIV GRYH++ +VWNMISTEARDLV+ LL  DP +R+TIEEAL HPWI+QKARA KTHLHETVEE+++FN+RRKLKG +LAAVSS KW++FY D  V + +D +D ED E++SA AVSA+LDSL+EMQCLTEC+E+D D   +VFED+ LH LLE+YD INS  +    R P+D+T +   V+ EL  +S  EF   A+E+++++  PH   LL  HDV AH++Y   A+R+TPPP+SSFLNGD ED   E ++EP+VTRVRLVQFQKNTDEPMGITLKMNDEG+CIVARIMHGGMIHRQGTLHVGDE+REIN   V GR++E+LQ++L++ARGSV+LKIVPSYR NP+QCEIYV+ MF+YNPE+DDLIPC QAGV+F++GDILQIISKDDHNWWQARLW    ++ AGL+PSPEL EWR A+  +E +   E   C +WF +K+RQ+++KYR KHS V+DQLDLVTYEEVVRLP F+R+TLVLLGAHGVGRRHIKNCLIQSAPDRFAYP+PHTTR PRKDEV+GKNY+FVSHEEMMRDI  NEYLEYGTHE+AMYGTKLDTIR IH+AGLIAILDVEPQAL+VLRTAEF+P VVFIAAP L  M  D HN NDGSLERL+RES+ LE  Y HYFDLKIVNNDIEDTI+QLKR+IDE Q++ QW+PV WVY
Sbjct:    1 MAETDAQFDDLYDLQEIIGKGPFSVVRRCVHKETGIQYAVKIVDVVKFTSSPGLSTADLKREASICHMLKHPHIVELLETYSSDGMLYMVFEYMKGADLSFEIVKRATAGFVYSEAVASHYLRQVLEALRYCHENNIVHRDLKPHCVILASQENSAPVKLSGFGLAFHMDPNTNEISGDTSLTVDQEIFVSLRSDQCGRIGTPHFMAPEMVRREPYGKAVDAWSCGVLLFALLSGSLPFYGTRDILFTQIVSGRYHLQPKVWNMISTEARDLVMHLLQPDPHQRMTIEEALHHPWISQKARASKTHLHETVEEMRRFNARRKLKGAILAAVSSTKWASFYSDNEVGSTEDILD-EDDEVTSA-AVSAVLDSLDEMQCLTECSEKDADLFQSVFEDEHLHCLLELYDHINSYGLGPSFRAPEDATSKCHVVVTELTKISNPEFSGLADEVRYLLRLPHLRGLLQTHDVVAHEVYSSEALRITPPPLSSFLNGDDEDEQLETDVEPHVTRVRLVQFQKNTDEPMGITLKMNDEGRCIVARIMHGGMIHRQGTLHVGDELREINGAPVAGRSVEHLQRILRDARGSVSLKIVPSYRTNPVQCEIYVRTMFDYNPEEDDLIPCPQAGVRFQVGDILQIISKDDHNWWQARLWGTDYHSPAGLVPSPELHEWRMANKPVENNHVGENVYCGSWFSRKRRQAREKYRLKHSAVYDQLDLVTYEEVVRLPQFRRRTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPVPHTTRAPRKDEVSGKNYYFVSHEEMMRDIAANEYLEYGTHEDAMYGTKLDTIRQIHAAGLIAILDVEPQALKVLRTAEFAPCVVFIAAPALRDMANDQHNPNDGSLERLARESQFLENHYRHYFDLKIVNNDIEDTIQQLKRAIDEFQTNPQWIPVTWVY 917          
BLAST of Peripheral plasma membrane protein CASK vs. TrEMBL
Match: A0A075A359 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00463 PE=3 SV=1)

HSP 1 Score: 1344.33 bits (3478), Expect = 0.000e+0
Identity = 656/919 (71.38%), Postives = 784/919 (85.31%), Query Frame = 2
Query:   56 MAE-EILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSP-EPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSK-QETANC-AWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATM-TDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            MAE +  FD++Y L E+IGKGPFS+VRRC HKET  Q+AVKIVD+VKFT+SPGL+TADLKREASICH+LK+PHIVEL ETYSSDGMLYMVFEYM+G+DL FEIVKRATAGFVYSEAVASHY+RQ++EALRYCHE+NI+HRDLKPHCV+LA++ENSAPVKL GFG+A  +DP T +++GDT   VD++I +SL+ DQ GR+GTPHFMAPE+VRREPYGK VDAW CGVLLF LLSGSLPFYGT++ LF QIV GRYH++ +VWNMISTEARDLV+ LL+ DP +R+TIEEAL HPWI+QKARA KTHLHETVEE+++FN+RRKLKG +LAAVSS KW++FY D    + +D +D ED E++SA AVSA+LDSL+EMQCLTEC+E+D D   +VFED+ LH LLE+YD INS  +    R P+D+T +   V+ EL  +S  EF   A+E+++++  PH   LL  HDV AH++Y   A+R+TPPP+SSFLNGD +D   E ++EP+VTRVRLVQFQKNTDEPMGITLKMNDEG+CIVARIMHGGMIHRQGTLHVGDE+REIN   V GR++E+LQ++L++ARGSV+LKIVPSYR NP+QCEIYV+ MF+YNPE+DDLIPC QAGV+F++GDILQIISKDDHNWWQARLW    ++ AGL+PSPEL EWR A+  +E +   E   C +WF +K+RQ+++KYR KHS V+DQLDLVTYEEVVRLP F+R+TLVLLGAHGVGRRHIKNCLIQSAPDRFAYP+PHTTR PRKDEV+GKNY+FVSHEEMMRDI  NEYLEYGTHE+AMYGTKLDTIR IH+AGLIAILDVEPQAL+VLRTAEF+P VVFIAAP L  M  D HN NDGSLERL+RES+ LE  Y HYFDLKIVNNDIE TI+QLKR+IDE Q++ QW+PV WVY
Sbjct:    1 MAETDAQFDDLYDLQEIIGKGPFSVVRRCAHKETGIQYAVKIVDVVKFTSSPGLSTADLKREASICHMLKHPHIVELLETYSSDGMLYMVFEYMKGADLSFEIVKRATAGFVYSEAVASHYLRQVLEALRYCHENNIVHRDLKPHCVILASQENSAPVKLSGFGLAFHMDPNTNEISGDTPLTVDQEIFVSLRSDQCGRIGTPHFMAPEMVRREPYGKAVDAWNCGVLLFALLSGSLPFYGTRDILFTQIVSGRYHLQPKVWNMISTEARDLVMHLLEPDPHQRMTIEEALHHPWISQKARASKTHLHETVEEMRRFNARRKLKGAILAAVSSTKWASFYSDIEAGSTEDILD-EDDEVTSA-AVSAVLDSLDEMQCLTECSEKDADLFQSVFEDEHLHCLLELYDHINSYGLGPSFRAPEDATSKCHVVVTELTKISNPEFSGLADEVRYLLRLPHLRGLLQTHDVVAHEVYSSDALRITPPPLSSFLNGDDDDEQLETDVEPHVTRVRLVQFQKNTDEPMGITLKMNDEGRCIVARIMHGGMIHRQGTLHVGDELREINGAPVAGRSVEHLQRILRDARGSVSLKIVPSYRTNPVQCEIYVRTMFDYNPEEDDLIPCPQAGVRFQVGDILQIISKDDHNWWQARLWGTDYHSPAGLVPSPELHEWRMANKPVENNPVGENVYCGSWFSRKRRQAREKYRLKHSAVYDQLDLVTYEEVVRLPQFRRRTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPVPHTTRAPRKDEVSGKNYYFVSHEEMMRDIAANEYLEYGTHEDAMYGTKLDTIRQIHAAGLIAILDVEPQALKVLRTAEFAPCVVFIAAPALRDMANDQHNPNDGSLERLARESQFLENHYRHYFDLKIVNNDIEVTIQQLKRAIDEFQTNPQWIPVTWVY 917          
BLAST of Peripheral plasma membrane protein CASK vs. TrEMBL
Match: A0A1S8X8D3 (Kinase domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01142 PE=4 SV=1)

HSP 1 Score: 1318.14 bits (3410), Expect = 0.000e+0
Identity = 645/918 (70.26%), Postives = 770/918 (83.88%), Query Frame = 2
Query:  107 GKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHF-----------------MALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSP-EPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSK-QETANC-AWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMT-DVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
             +GPFS+VRRC HKET  Q+AVKIVD+VKFT+SPGL+TADLKREASICH+LK+PHIVEL ETYSSDGMLYMVFEYM+G+DL FEIVKRATAGFVYSEAVASHY+RQ++EALRYCHE+NI+HRDLKPHCV+LA++ENSAPVKL GFG+A  +DP T +++GDT   VD++I +SL+ DQ GR+GTPHFMAPE+VRREPYGK VDAW CGVLLF LLSGSLPFYGT++ LF QIV GRYH++ +VWNMISTEARDLV+ LL+ DP +R+TIEEAL HPWI+QKARA KTHLHETVEE+++FN+RRKLKG +LAAVSS KW++FY D    + +D +D ED E++SA AVSA+LDSL+EMQCLTEC+E+D D   +VFED+ LH LLE+YD INS  +    R P+D+T +   V+ EL  +S  EF   A+E+++++  PH                    LL  HDV AH++Y   A+R+TPPP+SSFLNGD +D   E ++EP+VTRVRLVQFQKNTDEPMGITLKMNDEG+CIVARIMHGGMIHRQGTLHVGDE+REIN   V GR++E+LQ++L++ARGSV+LKIVPSYR NP+QCEIYV+ MF+YNPE+DDLIPC QAGV+F++GDILQIISKDDHNWWQARLW    ++ AGL+PSPEL EWR A+  +E +   E   C +WF +K+RQ+++KYR KHS V+DQLDLVTYEEVVRLP F+R+TLVLLGAHGVGRRHIKNCLIQSAPDRFAYP+PHTTR PRKDEV+GKNY+FVSHEEMMRDI  NEYLEYGTHE+AMYGTKLDTIR IH+AGLIAILDVEPQAL+VLRTAEF+P VVFIAAP L  M  D HN NDGSLERL+RES+ LE  Y HYFDLKIVNNDIE TI+QLKR+IDE Q++ QW+PV WVY
Sbjct:   35 ARGPFSVVRRCAHKETGIQYAVKIVDVVKFTSSPGLSTADLKREASICHMLKHPHIVELLETYSSDGMLYMVFEYMKGADLSFEIVKRATAGFVYSEAVASHYLRQVLEALRYCHENNIVHRDLKPHCVILASQENSAPVKLSGFGLAFHMDPNTNEISGDTPLTVDQEIFVSLRSDQCGRIGTPHFMAPEMVRREPYGKAVDAWNCGVLLFALLSGSLPFYGTRDILFTQIVSGRYHLQPKVWNMISTEARDLVMHLLEPDPHQRMTIEEALHHPWISQKARASKTHLHETVEEMRRFNARRKLKGAILAAVSSTKWASFYSDIEAGSTEDILD-EDDEVTSA-AVSAVLDSLDEMQCLTECSEKDADLFQSVFEDEHLHCLLELYDHINSYGLGPSFRAPEDATSKCHVVVTELTKISNPEFSGLADEVRYLLRLPHLRSEYIRATLIPCNILRSQGLLQTHDVVAHEVYSSDALRITPPPLSSFLNGDDDDEQLETDVEPHVTRVRLVQFQKNTDEPMGITLKMNDEGRCIVARIMHGGMIHRQGTLHVGDELREINGAPVAGRSVEHLQRILRDARGSVSLKIVPSYRTNPVQCEIYVRTMFDYNPEEDDLIPCPQAGVRFQVGDILQIISKDDHNWWQARLWGTDYHSPAGLVPSPELHEWRMANKPVENNPVGENVYCGSWFSRKRRQAREKYRLKHSAVYDQLDLVTYEEVVRLPQFRRRTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPVPHTTRAPRKDEVSGKNYYFVSHEEMMRDIAANEYLEYGTHEDAMYGTKLDTIRQIHAAGLIAILDVEPQALKVLRTAEFAPCVVFIAAPALRDMANDQHNPNDGSLERLARESQFLENHYRHYFDLKIVNNDIEVTIQQLKRAIDEFQTNPQWIPVTWVY 950          
BLAST of Peripheral plasma membrane protein CASK vs. TrEMBL
Match: A0A0X3P2P4 (Peripheral plasma membrane protein CASK OS=Schistocephalus solidus OX=70667 GN=CSKP PE=3 SV=1)

HSP 1 Score: 1286.94 bits (3329), Expect = 0.000e+0
Identity = 625/914 (68.38%), Postives = 762/914 (83.37%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANC-AWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCL-ATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            E++LFD+VY+L E+IGKGPFS+VRRC+H+E+ Q +AVKI+DI+KFT SPGL+TADLKREASICH+LK+PHIVEL ETYSSDGMLYMVFEYMEG+DLC EIVKRATAGFVYSEAVASHY+RQI+EA+RYCHE+NIIHRDLKPHC++LA+++NSAP KLGGFGIA QL+P T  + GD    VD++I +SL+ DQ GR+GTPH+M PE+VR E YGKPVDAW CGV LF+LLSGSLPFYGT++ L+ QI+ G+Y M   +WN IS EA+DL +RLL+++P +RLTIEEALRHPWI QKARAPK HLH TVEE+K FN+RR+LKG +LAAVSS KW++FY D  +        +E+ +  ++ AVS +LDSLEEMQCLTE   +  +     F+D QL  LLE+YD INS  +S    +PD++T++++ VLEEL+     E+  + +EL+FI++S H  ALL  HDV AHD+YG+ A+RVTPPP  S  NGD +D  EPE   NVTRVRLVQFQK TDEPMGITLK+ ++ KC+VARIMHGGM+HRQGTLHVGDE+REINSE V GR++EYLQ+ L+ ARGSVTLKIVPS R+NPMQCEIYV+AMF YNPE+DDLIPC+QAG++F++GDILQIISKDDHNWWQAR+W +   + AGLIPSPELQ+WR+AS A+E +    ANC +WF +KKR +K+KYRAK S +FDQL+L TYEEVVRLP F+R+TLVLLGAHGVGRRHIKN LIQSAP+RFAYPIPHTTRP RKDEVNGKNY FVS EEMMRDI NNEYLEYGTHE+AMYGTKLDTIR IH+AGLIAILDVEPQAL++LRTAEF+P+VVFIA+P L + M D++  NDGSLERL+RES++LE  + H FDLKIVNND+E+TI+QL   I+E+QS  QW+PV WVY
Sbjct:    4 EDVLFDDVYELSEIIGKGPFSVVRRCVHRESGQSYAVKIIDIIKFTGSPGLSTADLKREASICHLLKHPHIVELVETYSSDGMLYMVFEYMEGADLCLEIVKRATAGFVYSEAVASHYMRQILEAVRYCHENNIIHRDLKPHCIVLASRQNSAPAKLGGFGIAAQLNPDTGLIPGDVPLTVDQEIFVSLREDQCGRIGTPHYMCPEMVRHESYGKPVDAWSCGVFLFVLLSGSLPFYGTRDALYTQILTGQYRMNPDIWNSISAEAKDLTMRLLEVNPLRRLTIEEALRHPWICQKARAPKVHLHNTVEEMKFFNARRRLKGAILAAVSSTKWASFYSD--INGAPTEEVIEEDDEVTSAAVSVVLDSLEEMQCLTENGLEAAELKELAFQDSQLCCLLELYDHINSNPLSPNSVLPDNATVKSRDVLEELHTNVSAEYQADVDELRFILTSAHLKALLRTHDVVAHDVYGENAVRVTPPPTFS-ANGDDDDEAEPENGHNVTRVRLVQFQKTTDEPMGITLKLTEDEKCVVARIMHGGMVHRQGTLHVGDELREINSEPVFGRSVEYLQRRLREARGSVTLKIVPSCRNNPMQCEIYVRAMFSYNPENDDLIPCAQAGIEFEVGDILQIISKDDHNWWQARVWGSDPQSPAGLIPSPELQDWRAASRAVEHNHGSLANCGSWFSRKKRGTKEKYRAKQSAIFDQLELYTYEEVVRLPTFRRRTLVLLGAHGVGRRHIKNSLIQSAPERFAYPIPHTTRPQRKDEVNGKNYNFVSQEEMMRDIANNEYLEYGTHEQAMYGTKLDTIRQIHAAGLIAILDVEPQALKLLRTAEFAPWVVFIASPDLNSLMRDINCPNDGSLERLARESQLLEQHFKHLFDLKIVNNDMEETIKQLNIGIEELQSRPQWIPVTWVY 914          
BLAST of Peripheral plasma membrane protein CASK vs. TrEMBL
Match: A0A267G9S7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001372g1 PE=3 SV=1)

HSP 1 Score: 1283.86 bits (3321), Expect = 0.000e+0
Identity = 645/931 (69.28%), Postives = 766/931 (82.28%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTF---GRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEP-NVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAW----FGKK---KRQSKDKYRAKHSG--------VFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +E+LFD+VYQ+ E+IGKGPFSIVR+CIHK+T++ +AVK VD+ KF +SPGL+TADLKREASICH+LK+ HIVEL ETYS +GMLYMVFEYM+G+DLCFEIVKRATAGFV+SE+VA+HY+RQI+EA+RYCHEHNIIHRDLKPHCVLL +KENSAPVKLGGFGIAVQLD   L V GDT   V+++I +SL+ DQ GR+GTPHFMAPEV+RREPYGKPVDAWGCGVLL+ILL+GSLPFYGT++ LF QI+ GRY  K +VW+ IS EA+DLV RLLD+DP +RLT+EEALRHPWI +++R PK HL ETVEE+KKFNSRRKLKG VLAAVSS KWSA Y D            +D    ++ AVSA+LDSLE+MQCLTEC E D D L +VFE+  LH+LLE+YD INS+N+S     G+IPD +    + VL+ +      EF  +  EL+ ++  PHF ALL AHDV AHD+Y D AIRVTPPP+SS+LNGD  D    + EP NVTRVRLVQFQKNT+EPMGITLKM++E K IVARIMHGGMIHRQGTLHVGDEIREIN E V+G+++E LQ+LLK ARGSVTLKIVPSYR++PMQCEIYVKAMF YNP++D+L PC QAG++F++GDILQ+ISKDDH+WWQAR W+A  N  A +IPSPELQEWR+A  AIERSK++  NC      FG++   K  +K +  A  +G         +DQL++VTYEEVV+L  F+RKTLVLLGAHGVGRRHIKN LIQSAPDRFAYPIPHTTRPP K+EVNG++Y+FV  EEMMRDITNNEYLEYGTHE+AMYGTKLDTIR IH  G +AILDVEPQALRVLRTAEF+PYVVFIAAP L+TM+DVH LNDGSLERL++ESE+LE  YGHYFDLKI+NNDIEDTI QLK+ +D V +  QWVPVNWVY
Sbjct:   24 QEVLFDDVYQMLEIIGKGPFSIVRKCIHKQTQKLYAVKTVDVTKFASSPGLSTADLKREASICHLLKHNHIVELQETYSMEGMLYMVFEYMDGADLCFEIVKRATAGFVFSESVATHYMRQILEAVRYCHEHNIIHRDLKPHCVLLHSKENSAPVKLGGFGIAVQLDSSGL-VPGDTPVKVEQEIFVSLRDDQLGRIGTPHFMAPEVIRREPYGKPVDAWGCGVLLYILLTGSLPFYGTKDVLFRQILSGRYRKKPRVWDHISAEAKDLVSRLLDVDPQRRLTVEEALRHPWIHERSRVPKLHLSETVEEMKKFNSRRKLKGAVLAAVSSAKWSASYADADTSASAADPAEDD---VTSAAVSAVLDSLEDMQCLTECNEGDRDLLQSVFENDTLHSLLELYDHINSRNLSGSAIRGQIPDKAVSLGRDVLDSIGQCRSREFYSDCMELRELLLQPHFRALLQAHDVLAHDVYSDQAIRVTPPPLSSYLNGDIADEGGLDAEPDNVTRVRLVQFQKNTNEPMGITLKMSEENKIIVARIMHGGMIHRQGTLHVGDEIREINGEPVLGQSVEALQRLLKEARGSVTLKIVPSYRNHPMQCEIYVKAMFNYNPDEDELHPCPQAGIRFRVGDILQVISKDDHHWWQARAWNAPSNTPASMIPSPELQEWRAACTAIERSKKDPVNCGAGLFSFGRRQGAKSGTKQRGGAGMAGKQQQFAAAAYDQLEMVTYEEVVQLTNFRRKTLVLLGAHGVGRRHIKNTLIQSAPDRFAYPIPHTTRPPGKNEVNGRSYYFVGREEMMRDITNNEYLEYGTHEDAMYGTKLDTIREIHRHGKVAILDVEPQALRVLRTAEFAPYVVFIAAPELSTMSDVHGLNDGSLERLAKESELLERHYGHYFDLKIINNDIEDTIAQLKQCVDLVHTKHQWVPVNWVY 950          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Cavefish
Match: caska (calcium/calmodulin-dependent serine protein kinase a [Source:ZFIN;Acc:ZDB-GENE-020802-4])

HSP 1 Score: 1186.4 bits (3068), Expect = 0.000e+0
Identity = 604/915 (66.01%), Postives = 739/915 (80.77%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++N+IHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W  IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP      + +     + +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++  S N    +A+EL+ I++ PHFMALL  HDV AH+++ D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMND   CIVARIMHGGMIHRQGTLHVGDEIREINS SV  +T+E LQK+L+  RGS+T KIVPSYR     CEIYV+A FEY+P  D+LIPC +AG+ F++GDI+QII+KDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+      DLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+K+E NGKNY+FVSH++MM+DI NN+YLEYG+HE+AMYGT+L+TIR IH  GLI+ILDVEPQAL+VLRTAEF+PYVVFIAAP   T+T   N  D SL+RL +ESE+L+  Y HYFDL I+NN+I++TIR L+ +ID V ++ QWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNVIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWGHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPP-----EELAEFSEDPTSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVHRAKEVLEEISCYSEN---TDAKELRRILTQPHFMALLQTHDVVAHEVFSDEALRVTPPPTSPYLNGDSPESTNGDMDIENVTRVRLVQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINSISVANQTVEQLQKMLREMRGSITFKIVPSYRTQQSSCEIYVRAQFEYDPAKDELIPCKEAGIHFRVGDIIQIINKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACMAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNA-----DLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKEEENGKNYYFVSHDQMMQDIANNDYLEYGSHEDAMYGTRLETIRKIHEQGLISILDVEPQALKVLRTAEFAPYVVFIAAP---TITPGMN-EDESLQRLQKESEILQKTYAHYFDLTIINNEIDETIRHLEEAIDLVCTTGQWVPVSWVY 880          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Cavefish
Match: caskb (calcium/calmodulin-dependent serine protein kinase b [Source:ZFIN;Acc:ZDB-GENE-030131-4473])

HSP 1 Score: 1140.56 bits (2949), Expect = 0.000e+0
Identity = 582/915 (63.61%), Postives = 715/915 (78.14%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQET-ANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI+++T QQFAVKIVD+  FT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++N+IHR                                              D+ + L      RVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W+ IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP    HD + D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLE ++    N    EA+EL+ I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMND   CIVARIMHGGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSYR   + C+I+V+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+KDE NGKNY+FVSH++MM+DI+NNEYLEYG+HE+AMYGT+L+TIR IH  G+++ILDVEPQAL+VLRTAEF+PYVVFIAAP   T+T   N  D SL+RL +ESE L+  Y HYFD+ I+NN+I+DTIR L+ +ID V ++AQWVPV+WVY
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRDTGQQFAVKIVDVASFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNVIHR----------------------------------------------DVKVRL-----SRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEEMHDFTEDP-----TSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTRSSPQIRNPPSDAVQRAKEVLETISCYPEN---MEAKELRRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESVNGDMDLENVTRVRLVQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRSQSLSCDIFVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLIAKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTRLETIRKIHEQGMVSILDVEPQALKVLRTAEFAPYVVFIAAP---TITPGMN-EDESLQRLQKESEALQKSYAHYFDMTIINNEIDDTIRLLEEAIDLVSTTAQWVPVSWVY 854          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Cavefish
Match: caska (calcium/calmodulin-dependent serine protein kinase a [Source:ZFIN;Acc:ZDB-GENE-020802-4])

HSP 1 Score: 1100.12 bits (2844), Expect = 0.000e+0
Identity = 554/863 (64.19%), Postives = 675/863 (78.22%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALR 2536
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++N+IHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W  IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP      + +     + +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++  S N    +A+EL+ I++ PHFMALL  HDV AH+++ D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMND   CIVARIMHGGMIHRQGTLHVGDEIREINS SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                                   IYV+A FEY+P  D+LIPC +AG+ F++GDI+QII+KDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+K+E NGKNY+FVSH++MM+DI NN+YLEYG+HE+AMYGT+L+TIR IH  GLI+ILDVEPQ ++
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNVIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWGHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPP-----EELAEFSEDPTSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVHRAKEVLEEISCYSENT---DAKELRRILTQPHFMALLQTHDVVAHEVFSDEALRVTPPPTSPYLNGDSPESTNGDMDIENVTRVRLVQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINSISVANQTVEQLQKMLREMRGSITFKIVPSYRTQQSSCEKESPTTSRQSPANGHSSINSSILDLPLTIQPKGRQIYVRAQFEYDPAKDELIPCKEAGIHFRVGDIIQIINKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACMAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKEEENGKNYYFVSHDQMMQDIANNDYLEYGSHEDAMYGTRLETIRKIHEQGLISILDVEPQVIK 837          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Cavefish
Match: caska (calcium/calmodulin-dependent serine protein kinase a [Source:ZFIN;Acc:ZDB-GENE-020802-4])

HSP 1 Score: 1098.19 bits (2839), Expect = 0.000e+0
Identity = 554/855 (64.80%), Postives = 675/855 (78.95%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKK---------------VLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALR 2536
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++N+IHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W  IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP      + +     + +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+               VLEE++  S N    +A+EL+ I++ PHFMALL  HDV AH+++ D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMND   CIVARIMHGGMIHRQGTLHVGDEIREINS SV  +T+E LQK+L+  RGS+T KIVPSYR     CE            IYV+A FEY+P  D+LIPC +AG+ F++GDI+QII+KDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+K+E NGKNY+FVSH++MM+DI NN+YLEYG+HE+AMYGT+L+TIR IH  GLI+ILDVEPQ ++
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNVIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWGHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPP-----EELAEFSEDPTSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVHRAKESGEDGADTALKLLECVLEEISCYSENT---DAKELRRILTQPHFMALLQTHDVVAHEVFSDEALRVTPPPTSPYLNGDSPESTNGDMDIENVTRVRLVQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINSISVANQTVEQLQKMLREMRGSITFKIVPSYRTQQSSCEDLPLTIQPKGRQIYVRAQFEYDPAKDELIPCKEAGIHFRVGDIIQIINKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACMAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKEEENGKNYYFVSHDQMMQDIANNDYLEYGSHEDAMYGTRLETIRKIHEQGLISILDVEPQVIK 829          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Cavefish
Match: caska (calcium/calmodulin-dependent serine protein kinase a [Source:ZFIN;Acc:ZDB-GENE-020802-4])

HSP 1 Score: 1089.72 bits (2817), Expect = 0.000e+0
Identity = 554/878 (63.10%), Postives = 675/878 (76.88%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKK---------------VLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALR 2536
            +++LF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ KFT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++N+IHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W  IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP      + +     + +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+               VLEE++  S N    +A+EL+ I++ PHFMALL  HDV AH+++ D A+RVTPPP S +LNGD  +S   +++  NVTRVRLVQFQKNTDEPMGITLKMND   CIVARIMHGGMIHRQGTLHVGDEIREINS SV  +T+E LQK+L+  RGS+T KIVPSYR     CE                                   IYV+A FEY+P  D+LIPC +AG+ F++GDI+QII+KDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTRPP+K+E NGKNY+FVSH++MM+DI NN+YLEYG+HE+AMYGT+L+TIR IH  GLI+ILDVEPQ ++
Sbjct:    4 DDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNVIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWGHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPP-----EELAEFSEDPTSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVHRAKESGEDGADTALKLLECVLEEISCYSENT---DAKELRRILTQPHFMALLQTHDVVAHEVFSDEALRVTPPPTSPYLNGDSPESTNGDMDIENVTRVRLVQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINSISVANQTVEQLQKMLREMRGSITFKIVPSYRTQQSSCEKESPTTSRQSPANGHSSINSSILDLPLTIQPKGRQIYVRAQFEYDPAKDELIPCKEAGIHFRVGDIIQIINKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACMAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKEEENGKNYYFVSHDQMMQDIANNDYLEYGSHEDAMYGTRLETIRKIHEQGLISILDVEPQVIK 852          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008487.1 (pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 gene:ENSPMAG00000007666.1 transcript:ENSPMAT00000008487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 360.147 bits (923), Expect = 1.252e-112
Identity = 215/562 (38.26%), Postives = 319/562 (56.76%), Query Frame = 2
Query: 1154 ILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVT-RVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFG--KKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVH-----------NLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +L +L +M       E D+ FL  + E   +  L +    +    +     + +++    K++LE+++ ++  +    A EL  I+  PHF +LL AHD  A   Y          P S  LN D  D     LE  VT  +R+V  +K   EP+G+T ++ +  + ++ARI+ GGMI +QG LHVGD IRE+N   V    +      L+ A GSV LKI+PSY        ++VK  F+YNP DD LIPC +AG+KF  GD+LQI+S+DD +WWQA    A    +AGL+PS  L+E R A +  E +    +  A  G    K++ K  Y +  +  FD+ +++ YEE+ ++P F+RKTLVL+GA GVGRR +KN L+ S P R+   IP T+R PR DE +G+ Y FV+  +M  DI +  YLE G +E  +YGTK+++   +  AG + ILDV PQAL++LRTAEF PYVVFIAAP +  +  +H           +L D  L++   ES  ++  Y HYFDL IVN+++++    L+  ++ +    QWVP+ WVY
Sbjct:    4 VLKTLPDMPRTASAKETDLIFLKGLMESPVVQCLAKAQGKLEEPKLEA---VSENNLELVKEILEDISPMTERD--NSAAELATILQEPHFQSLLGAHDSVASKSY-------ECLPCSPHLNADSGDELGA-LESGVTDAIRMVGIRKMEGEPLGVTFRV-ESNELVIARILRGGMIDQQGLLHVGDVIREVNGCDVSNDPV------LREATGSVVLKILPSYTLPQNPAPLFVKCQFDYNPADDQLIPCKEAGLKFSQGDVLQIVSQDDPDWWQA--CKAQDGGSAGLVPSQTLEEKRKAYVRQEMNFTSASGGALCGVLGGKKKKKLMYMSTKNAEFDRHEILIYEEMAKMPPFQRKTLVLIGAQGVGRRSLKNRLLVSEPSRYGMTIPFTSRRPRDDEKDGQGYHFVARADMEVDIKSGRYLESGEYEGNLYGTKIES-HGVVRAGKMCILDVNPQALKLLRTAEFMPYVVFIAAPSVEILRSMHKAALDAGLTAKHLTDADLKKTVDESTRIQRAYIHYFDLTIVNDNMDEAFANLRAYLERLVKEPQWVPIGWVY 542          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008482.1 (pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 gene:ENSPMAG00000007666.1 transcript:ENSPMAT00000008482.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 356.295 bits (913), Expect = 5.399e-111
Identity = 218/576 (37.85%), Postives = 322/576 (55.90%), Query Frame = 2
Query: 1154 ILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVT-RVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYR--HNPMQC------------EIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFG--KKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVH-----------NLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +L +L +M       E D+ FL  + E   +  L +    +    +     + +++    K++LE+++ ++  +    A EL  I+  PHF +LL AHD  A   Y          P S  LN D  D     LE  VT  +R+V  +K   EP+G+T ++ +  + ++ARI+ GGMI +QG LHVGD IRE+N   V           L+ A GSV LKI+PSY    NP               +++VK  F+YNP DD LIPC +AG+KF  GD+LQI+S+DD +WWQA    A    +AGL+PS  L+E R A +  E +    +  A  G    K++ K  Y +  +  FD+ +++ YEE+ ++P F+RKTLVL+GA GVGRR +KN L+ S P R+   IP T+R PR DE +G+ Y FV+  +M  DI +  YLE G +E  +YGTK+++I  +  AG + ILDV PQAL++LRTAEF PYVVFIAAP +  +  +H           +L D  L++   ES  ++  Y HYFDL IVN+++++    L+  ++ +    QWVP+ WVY
Sbjct:    4 VLKTLPDMPRTASAKETDLIFLKGLMESPVVQCLAKAQGKLEEPKLEA---VSENNLELVKEILEDISPMTERD--NSAAELATILQEPHFQSLLGAHDSVASKSY-------ECLPCSPHLNADSGDELG-ALESGVTDAIRMVGIRKMEGEPLGVTFRV-ESNELVIARILRGGMIDQQGLLHVGDVIREVNGCDVSN------DPYLREATGSVVLKILPSYTLPQNPAPVRTDRYPLHHVCQQLFVKCQFDYNPADDQLIPCKEAGLKFSQGDVLQIVSQDDPDWWQA--CKAQDGGSAGLVPSQTLEEKRKAYVRQEMNFTSASGGALCGVLGGKKKKKLMYMSTKNAEFDRHEILIYEEMAKMPPFQRKTLVLIGAQGVGRRSLKNRLLVSEPSRYGMTIPFTSRRPRDDEKDGQGYHFVARADMEVDIKSGRYLESGEYEGNLYGTKIESIGVVR-AGKMCILDVNPQALKLLRTAEFMPYVVFIAAPSVEILRSMHKAALDAGLTAKHLTDADLKKTVDESTRIQRAYIHYFDLTIVNDNMDEAFANLRAYLERLVKEPQWVPIGWVY 556          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004699.1 (pep scaffold:Pmarinus_7.0:GL501143:686031:770336:1 gene:ENSPMAG00000004247.1 transcript:ENSPMAT00000004699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 350.132 bits (897), Expect = 4.984e-110
Identity = 194/480 (40.42%), Postives = 283/480 (58.96%), Query Frame = 2
Query: 1424 FMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEP-------NVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIE----RSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVH-----------NLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
              +LL AHDV A   Y             +  +  G DS +   +P           +R+V  +K   +P+G+T ++ +  + ++ARI+ GGMI +QG LHVGD IRE+N   V       LQ+ L+ A GSV LKI+PSY  +    +++VK  F+YNPEDD LIPC +AG++F  GDILQI+S++D +WWQA         +AGLIPS  L+E R A +  E        E   C      K++ K  Y +  +  FD+ +++ YEEV ++P F+RKTL+L+GA GVGRR +KN L+ + P R+   +P T+RPPR DE  G+ Y+FVS  +M  DI    YLE G +E  +YGTK+++I  +   G + ILDV PQAL+VLRTAEF P+VVF+AAP L T+  +H           +L D  L++   ES  ++  Y H+FDLKIVNN+++    +L+ +++ +    QWVP++WVY
Sbjct:    1 LQSLLEAHDVVASQSY------------DNITSSTGNDSSDLWSDPAALDGAAGTDAIRMVGIRKVEGQPLGVTFRV-ESSELVIARILRGGMIDQQGLLHVGDVIREVNGRDVTNDPAG-LQRFLREATGSVVLKILPSYTRSSPPAQVFVKCYFDYNPEDDQLIPCKEAGLRFNRGDILQIVSQEDPDWWQA--LKVKDGGSAGLIPSQTLEEKRKAYVRHEWDYTGVSGERGFCGVL-GGKKKKKMMYMSTKNAEFDRHEILIYEEVAKMPPFQRKTLMLIGAQGVGRRSLKNRLLVANPSRYGMIVPFTSRPPRDDEKEGQGYYFVSRADMEADIRAGRYLESGEYEGNLYGTKIESIHGVVRTGKMCILDVNPQALKVLRTAEFMPFVVFVAAPTLETLRAMHRAALDAGATSKHLTDTDLKKTVDESVRIQRAYSHFFDLKIVNNNMDVAFAKLRAALEGLGKGPQWVPISWVY 463          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Sea Lamprey
Match: mpp7a (membrane protein, palmitoylated 7a (MAGUK p55 subfamily member 7) [Source:NCBI gene;Acc:30166])

HSP 1 Score: 285.419 bits (729), Expect = 1.088e-84
Identity = 184/582 (31.62%), Postives = 303/582 (52.06%), Query Frame = 2
Query: 1142 AVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQ-NISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDE-GKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQ--CEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSAS-------LAIERSKQETANCAWFGKKKRQSKDK----YRAKHSGVFDQLDLVTYEEVVRL---PVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDV-------------HNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWV 2794
            A+S +L +L         + +D+ FL  +  D  L +L++++D + S   IS    + + +TL    + EEL     N  +RE   L  ++S PH  A+L+AHD  A   +      V   P       D E+S           V++++  KN  EP+G T++ ++E G  +VARIM GG   R G ++VGDE++E+N   V  +  E + ++L  ++ ++T KIVP+++        +IY++  F+YNP  D  IPC +AG+ F  G++LQ++S+DD  WWQA+  +   N  AGLIPS    E R A+       +  + SK   +      +  RQS+      Y +K S  +D  ++ TYEEV++    P  K + +VL+G  GVG   +K  LI S P  ++  +P TTR  +  E + K Y+FVS      D+ NN ++EYG  +  +YGT +D IR + +AG + +LDV P A++ +RT EF P+V+F+  P L  +                 N  D   + +   +  +E Q+G+ FD  +VN+++    R+L+ + D ++    WVP++WV
Sbjct:   13 AMSDVLATLPSQLQEHGGSPEDMTFLRDICGDASLQSLVKVHDKLKSYIKISPAPMLANSATL-TDDLTEELQGQPTNSDVRE---LLTLLSKPHVKAVLSAHDSVAQKDF------VPVLPPLPDDLDDDEES-----------VKIIRLVKNK-EPLGATIRRHEETGAIVVARIMRGGAADRSGLINVGDELKEVNGVRVDNKEPEEVIQILAQSQSAITFKIVPAFKDESQSKDTKIYLRTFFDYNPRGDVAIPCKEAGLPFLRGEVLQVVSQDDSMWWQAK-RTEQSNMRAGLIPSKHYMERRLAARQPASPPIVQKSSKSRLSGLRRSFRLSRQSRKTSKLMYESKRSAEYDASEVSTYEEVLQYQHQPGDKYRVIVLVGPPGVGINELKRRLIASDPSLYSGTVPTTTRQKKSHEKDSKEYYFVSRHLFEADLHNNRFVEYGEFKGNLYGTSVDAIRSVVNAGKVCLLDVSPPAIKSIRTPEFKPFVIFVKPPSLERLRQTRGAAKSSGDKNPARNFTDEDFQEMLGTAARMEAQFGYLFDKTVVNDELAAAYRELRAAADSLERETMWVPLSWV 571          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 258.07 bits (658), Expect = 1.815e-77
Identity = 144/326 (44.17%), Postives = 206/326 (63.19%), Query Frame = 2
Query:   74 FDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGT-QETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAV 1045
            F + YQL E +GKG FS+VRRC+   T Q+FA KI++  K +         L+REA IC +LK+ +IV L E+ + +G  Y+VF+ + G +L  +IV R      YSEA ASH I+QI+E++ +CH+H I+HRDLKP  +LLA+K   A VKL  FG+A++       V GD   +             +G  GTP +++PEV+R++PYGKPVD W CGV+L+ILL G  PF+   Q  L+ QI  G Y   S  W+ ++ EA++L+ ++L ++P KR+T  EAL+HPWI Q++  A   H  ETVE L+KFN+RRKLKG +L  +
Sbjct:   10 FTDEYQLYEELGKGAFSVVRRCVKVSTGQEFAAKIINTKKLS---ARDHQKLEREARICRLLKHSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVARE----YYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAVKLADFGLAIE-------VQGDQQAW-------------FGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWICQRSTVASCMHRQETVECLRKFNARRKLKGAILTTM 308          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 136.346 bits (342), Expect = 8.072e-33
Identity = 105/346 (30.35%), Postives = 172/346 (49.71%), Query Frame = 2
Query:   86 YQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVD----------------------IVKFTNSPGLTTAD-----------LKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGI-AVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPY-GKPVDAWGCGVLLFILLSGSLPFYGTQ-ETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRR 1015
            ++L + +GKG    VR   + ET Q  A+KIV                       +    +SP + + +           ++RE  I  ++ + +++ LFE + +   LY+V EY++G +L   +V +        E  A HY +QI+E + YCH  NI HRDLKP  +LL  K     +K+  FG+ A++L  + LK +                       G+PH+ +PE+V   PY G P D W CG++LF LL+G LPF     + L  ++  G+Y M S     +S+EARDL+ ++L +DP+KR+T +E L+HP I +    P   +++ + +++K N  R
Sbjct:   81 WKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGK----LPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRR--IKIADFGMAALELPNKLLKTS----------------------CGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSN----LSSEARDLISKILVIDPEKRITTQEILKHPLIKKYDDLP---VNKVLRKMRKDNMAR 391          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 134.42 bits (337), Expect = 1.858e-32
Identity = 102/297 (34.34%), Postives = 149/297 (50.17%), Query Frame = 2
Query:   71 LFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVK-FTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIA-VQLDPQTLKVAGDTLPFVDRDIL----ISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYG-TQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWI 940
            +F +   + E++G+G F+ V++ I + T + FAVKI+   K   N  G+T     RE  +   L +P IV L   Y      YMV E++ G DL   +      G    E       RQI+ A++Y H   I HRDLKP  +L+  +++   VK+  FG+A VQ +   +K    TL +V  +++     S+ PD+Y               R  Y   VD W  G L++++L+G LPF G TQ+ L+ QI  G YH        IS EARD +  LL +DP+ R T  +AL HPWI
Sbjct:  193 IFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVT-----RELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVG----EDAGREISRQILTAIKYIHSMGISHRDLKPDNILIE-QDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEY-------------EERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWI 466          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 129.028 bits (323), Expect = 3.828e-31
Identity = 84/253 (33.20%), Postives = 127/253 (50.20%), Query Frame = 2
Query:   86 YQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLK----REASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIA-VQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKP-VDAWGCGVLLFILLSGSLPFYGTQ-ETLFAQIVMGRYHM 823
            YQ+ + +G+G F  V+   H  T Q+ A+KI+      N   L  +D++    RE S   +L++PHI++L++   S   + MV EY  G++L   IV+R       SE  A  + +QI+ A+ YCH H I+HRDLKP  +LL    N   VK+  FG++ +  D   LK +                       G+P++ APEV+  + Y  P VD W CGV+L+++L   LPF       LF  I  G Y +
Sbjct:   55 YQIVKTLGEGSFGKVKLAYHTTTGQKVALKII------NKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKM----SEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLN---VKIADFGLSNIMTDGNFLKTS----------------------CGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTL 271          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 125.946 bits (315), Expect = 5.206e-31
Identity = 97/321 (30.22%), Postives = 152/321 (47.35%), Query Frame = 2
Query:   86 YQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYG-TQETLFAQIVMGRY----HMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVV 1033
            Y     +G G F +VR+     T +  A+KI+ + K      +    L  E SI   L +P+IV   + + S    Y+V +   G +L   I+ R      ++E  A   I QI+ A+ Y H  N++HRDLKP  VL  +K  ++P+ +  FGIA QL  +              D++       Y   G+  ++APEV+ ++ +GKP D W  GV+ + LL G  PF   + E    +    RY    HM    W+ IS + +  +L+ L L+P  R T  E L  PWI  K R   +++   V+  K F+ R+KL+  +
Sbjct:   47 YIFGRTLGAGSFGVVRQARKLSTNEDVAIKIL-LKKALQGNNVQLQMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGK----FTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGE-------------EDLI-------YKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHM--PYWDNISIDVKRFILKALRLNPADRPTATELLDDPWITSK-RVETSNILPDVK--KGFSLRKKLRDAI 337          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 126.331 bits (316), Expect = 7.956e-30
Identity = 99/303 (32.67%), Postives = 155/303 (51.16%), Query Frame = 2
Query:   86 YQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKF-------TNSPGLTTAD-----LKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPY-GKPVDAWGCGVLLFILLSGSLPF---YGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQ 946
            ++L E +G G    V+   +  T Q+ AVK++    F       T+  G TT D     ++RE  I  +L +P+++ L++ + ++  LY+V EY E  +L   +V+R        E  A  + RQI+  + YCH   I+HRDLKP  +LL +K N   +K+  FG+A       L+  G  L                   G+PH+ APE+V   PY G   D W CGV+LF LL+G LPF    G   TL  ++  G + M S   + IS EA+DL+ ++L +DP++R+   + L+HP + +
Sbjct:   19 WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGP----LPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA------LETEGKLLETS---------------CGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD--DEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Nematostella
Match: EDO39364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAA1])

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 464/965 (48.08%), Postives = 604/965 (62.59%), Query Frame = 2
Query:   74 FDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHI------VE---LFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYG-DPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAE----ELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGM------------------------------------------IHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERS-KQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            F   + L E IGKG FS++++C  K+T +  AVKIVD+ K   S GLT  DL REA IC  L +PHI      +E   LFE     G   +    M+G+DLCFEIV R  AGFVYSEAVASHY+RQ++EA+ +CHE+ IIHRDLKPH VLLAN+ENSAP+K+  FG+AV+L P+    +G                    R+GTPHFM+PEVV R+PYGKPVD WGCG++LFILLSG+ PF+GT E ++  I  G+  M+ + W+ I+ EA+DL L +L  D D+R++  +AL+HPW+  +    + HL ETV+ELKKFN+RRKLKG VLAAV+S K+    G D    N DD  + ED +LS+ GA+  +LDSLEE+Q LT   + + DFL T FED+   ALLE+YD  + +   T    P  +T  A++  +++  V+  EF  E +    EL+ I+  PH MA+L AHD    +   D    + PP  +     D  D+  PE    +TRVRLVQF KN +EPMGITLK+NDEG+C+VARIM+GGM                                          IHRQGTLH GDEIREIN  +V  ++IE LQ +L++A G+VT KIVPS R      +++V+A+F+Y+P  DDLIPC +AG+ F   +ILQ+++K D  WWQA+   A     AGLIPSPELQEWR A +A E+S KQ  A+C WF +KK+  +D+Y AKH+ VFD+LDLVTYEEVV++  FKRKTLVLLGAHGVGRRHIKN LI    D+FAYPIPHTTR PR  E +GK+Y+FVS E MM DI +N YLEYGTHE AMYGTKLDTI  I     +AILDVEPQ   + R A+ S  +                                   YGH FDL IVNNDI++TI QL+ +++ + ++ QWVP++W+Y
Sbjct:    5 FPPRFDLQEQIGKGTFSVIKKCTDKKTNRVCAVKIVDVSKMRASSGLTEEDLNREAYICQKLTHPHIGGKQGLIERHGLFENIGYRGWGSLYEMGMDGADLCFEIVNRVNAGFVYSEAVASHYMRQVLEAVSFCHENGIIHRDLKPHNVLLANRENSAPIKVADFGVAVELPPEGCITSG--------------------RLGTPHFMSPEVVNRQPYGKPVDVWGCGIILFILLSGNYPFHGTGEKVYQSITKGQPVMRPRQWDQITDEAKDLCLNMLATDQDQRISAADALQHPWLKNREVPSRNHLQETVDELKKFNARRKLKGAVLAAVASRKFPVVNGIDVGTKNDDDVFECEDSDLSATGAIGQLLDSLEEIQLLTGARKAETDFLQTFFEDRHFQALLEVYDR-SQEWTETHESCPPFTTSEAEQNAKDV--VNLIEFRAEDDDDCYELQNILCDPHVMAMLQAHDGVLQEEKQD-ETSILPPDTTP---NDTIDNSIPERPEKLTRVRLVQFHKNPNEPMGITLKLNDEGRCVVARIMYGGMIHRQGENDPGILSAHIMYSGIIHRQGENNPGILSAHIMYGGMIHRQGTLHPGDEIREINGSNVADKSIEALQSMLRDASGNVTFKIVPSSRGLGTNTDVFVRALFDYDPRSDDLIPCQRAGMAFHCSEILQVVNKADCYWWQAKKPDAN-EEFAGLIPSPELQEWRVACIAAEKSKKQNGASCIWFSRKKKTYRDRYVAKHNAVFDRLDLVTYEEVVKMEKFKRKTLVLLGAHGVGRRHIKNTLINKFADKFAYPIPHTTRDPRAGEEDGKHYYFVSAEVMMSDIESNRYLEYGTHEGAMYGTKLDTITDIIENHKVAILDVEPQGESLKRLAKESDQL--------------------------------RQTYGHLFDLTIVNNDIDETIAQLEEALERLGTTPQWVPISWIY 909          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Nematostella
Match: EDO37538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE0])

HSP 1 Score: 374.785 bits (961), Expect = 2.435e-118
Identity = 202/507 (39.84%), Postives = 302/507 (59.57%), Query Frame = 2
Query: 1313 DDSTLRAKKVLEELN-MVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHN--LNDGXXXXXXXXXXXXXV---------QYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            DD+    K+VLEEL   V  ++    A EL  ++  PHF AL+  HD  A   Y    +   P P     NG     P          +R+V   K+ +E +G+TLK+ D  + I++RI+HGGMI RQG LHVGD I+E+N + + G   E LQ  L  + G +TLK++PSY  +P  C+++V+A F+Y+P  DD IPC  AG+ FK G++LQI+ ++D NWWQA+      +  AG+IPS   +E R A +     K++     +    K++ K  Y++  +  F++ +L  YEEV ++P F+RKTLV++GA GVGRR +KN LI S   RF   IPHT+R  R+ E +G+ YFFVS EEM RDI   +YLE+G +   MYGTK+DTIR +  +G + ++DV P AL+VL+T EF PY+V IA+P    + +  +  L++G + +   + E+ +           Y HYFDL I N+++E+   +L+ +I+ + +  QWVPV+WVY
Sbjct:   31 DDTNKLVKQVLEELEPQVGSDD---SAAELCGLLQEPHFRALMQTHDAVAFKTY----MPTPPSPGVDSFNGFAAGEP----------IRMVGLHKHANEHLGVTLKVED-NQLIISRIIHGGMIDRQGLLHVGDIIKEVNGKDMSGNPSE-LQDYLAKSTGKITLKVLPSYYESPALCQVFVRAHFDYDPSKDDQIPCQDAGLAFKQGEVLQIVDQEDANWWQAKKVDD--SRAAGIIPSQICEERRRAGV-----KKDKPGSKFLCGSKKKQKVMYKSSKNFDFEKHELPIYEEVAKMPPFQRKTLVMIGAQGVGRRTLKNKLIMSDRKRFGTTIPHTSRQMREGEQSGRGYFFVSREEMERDIRAGKYLEFGEYGGNMYGTKIDTIREVMRSGKMCVVDVNPTALKVLKTPEFMPYIVCIASPSFEELKEFQSKALSEGIVNKKRSDDELRKTVEDSERLYNSYAHYFDLTIANDNVEEAFNKLQNAIESLSTHPQWVPVSWVY 511          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Nematostella
Match: EDO33577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU3])

HSP 1 Score: 272.322 bits (695), Expect = 2.741e-79
Identity = 188/609 (30.87%), Postives = 305/609 (50.08%), Query Frame = 2
Query: 1043 VSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTA-HDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE---IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAI-----ERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRL---PVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHN-------------LNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWV 2794
            VS+ + S F   PA          E  E++   A+S  L S  + + L          +     D  +    +IYD I     +  G  P  S  ++       + +S     R+  EL  ++SSP    LL AHD  A  +   D         +S   + D + S + E +     V++V+  K+ D P+G T+K N++G  ++ RI+ GG   + G LH GDEI EIN   + G+++  + +LL +  G++T  +VP  R          ++V+A F+Y+P DD+ IPC + G+ F+ GDIL ++ ++D NWWQA          AGLIPS   Q+ R +         E++ +++  C    K+KR+ K  Y A+ + VF+   ++TY+EV  L   P  KR  +VL+G   +GR+ ++  LIQ  PDRFA  IPHT+RP +  E+N  +Y FV     + DI  ++++E+G  ++  YGT  D I+ + +AG   IL++  +AL+ LR +   PYV+FI++P    +  +               L D  +  +  ++  +E  YGHYFD  I N D E T  +L++ I  ++   QWVPV+W+
Sbjct:   40 VSTARPSTFSPLPA---------QESPEMACIEALSPKLTSAHDRENLAS--------VQRYLGDSDVQNATKIYDKIMDLKRARSG--PGFSRPQSTSAQNLTSQISAAPSTRDEVELASLLSSPTMQGLLLAHDRLAFREALPDENEENEGRELSRQNSSDADQSSQMEDD----SVKIVRIDKSCD-PLGATVK-NEDGAVLIGRIVKGGAAEKSGLLHEGDEILEINGVHMKGKSVSEVCELLADMNGTLTFLLVPKTRSIGTLSRDRAVHVRANFDYDPYDDEFIPCRELGLAFRRGDILHVVDQEDQNWWQAWRAGEEGKKLAGLIPSKHFQQQRESMKHTVPADNEKTTEKSKKCLCI-KRKRRKKVLYNAQQNEVFEVDQVLTYDEVDLLHPNPSRKR-PIVLIGPPKIGRKELRQRLIQYDPDRFAGAIPHTSRPIKPGEINDHDYHFVPRHTFVTDIVAHKFVEHGELQDHFYGTSFDAIKMVINAGKTCILNLHCEALKTLRASNIKPYVIFISSPSYERVRALRRGKIDPFNPKLNVALTDREIHEMVAKAREMEEAYGHYFDHTITNTDFERTFDELRQVIARLEDEPQWVPVSWL 621          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Nematostella
Match: EDO30537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0H5])

HSP 1 Score: 267.7 bits (683), Expect = 3.034e-79
Identity = 147/329 (44.68%), Postives = 213/329 (64.74%), Query Frame = 2
Query:   74 FDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLK---REASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGT-QETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAV 1045
            F + Y+L E +GKG FSIVRRCIHKE++ ++A KI+      N+  L++ DL+   REA IC +LK+P+IV L  + + +G  Y+VF+ + G +L  +IV R      YSEA ASH I+QI+E++++CH +N++HRDLKP  +LLA+KE +A VKL  FG+A++++ +                    K   YG  GTP +++PEV+++EPYGKPVD W CGV+L+ILL G  PF+   Q  L+AQI  G Y   S  W+ ++ EA+DL+  +L +D  KR+   EAL+HPWI  + R A K H  ET++ LKKFN+RRKLKG +L  +
Sbjct:    9 FHDTYELKEELGKGAFSIVRRCIHKESRIEYAAKII------NTRKLSSRDLQKLDREARICRLLKHPNIVRLHASIAEEGYHYLVFDLVTGGELFEDIVARE----YYSEADASHCIQQIIESVQHCHTNNVVHRDLKPENLLLASKEKNAAVKLADFGLAIEVEIE--------------------KTGWYGFAGTPGYLSPEVLKKEPYGKPVDLWACGVILYILLVGYPPFWDEDQHKLYAQIKTGNYDYPSPEWDTVTDEAKDLINMMLTVDQSKRIGAGEALKHPWIVNRERVASKVHRQETLDGLKKFNARRKLKGAILTTI 307          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Nematostella
Match: EDO49898 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF52])

HSP 1 Score: 253.832 bits (647), Expect = 2.846e-74
Identity = 156/413 (37.77%), Postives = 240/413 (58.11%), Query Frame = 2
Query:   74 FDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYG-TQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAV-SSMKWSAFYGDPAVINHDDSIDM---EDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLH-------TVFEDQQLHALLEIYDF 1273
            F+  Y+L E +GKG FS VR+C H+ETK ++AVKI+D    T         ++REA IC  L++P++V L     SDG  ++VF+ + G +L  +IV R      YSEA ASH I+Q++ ++++CHE+ I+HRDLKP  +LLA++E  A VKL  FG+A+++D + L                      YG  GTP +++PEV++++PYGKPVD W CGV+L+ILL G  PF+   Q+ L++QI  G Y   S  W+ ++ +A+DL+ ++L +D  KR+T  EAL+HPWI  + R A K H  +T++ LK+FN+RRKL+G + A + ++  +S+        + +DSI     ED E +       I+   +  Q +T  T +D D          T FE + L   +E  +F
Sbjct:   13 FNEKYELKEELGKGAFSTVRKCCHRETKIEYAVKILDTKNMTQR---DVHKVEREARICRHLRHPNVVRLHANIMSDGFYFLVFDLVTGGELFEDIVARE----YYSEADASHCIQQVLLSVQHCHENGIVHRDLKPENLLLASRERGAMVKLADFGLAIEVDGERL--------------------GWYGFAGTPGYLSPEVLKKDPYGKPVDLWACGVILYILLVGYPPFWDEEQQKLYSQIKAGTYDYPSPEWDTVTADAKDLIDKMLTVDAPKRITAAEALKHPWIVNRERIASKVHRQQTLDGLKRFNARRKLRGAIHATILATHNFSSGSRHKKKGSDEDSIATIIEEDTESTKTQREQEIIRLTQ--QLITSITAKDFDSYSKLVDPKITAFEPEALGNQVEGLEF 396          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Medaka
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:NCBI gene;Acc:101159232])

HSP 1 Score: 1191.79 bits (3082), Expect = 0.000e+0
Identity = 609/921 (66.12%), Postives = 741/921 (80.46%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            ++ILF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ +FT+SPGL+T DLKREASICH+LK+ HIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I  G+Y M  + WN IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP    HD S D      SS+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    EA+EL+ I++ PHFMALL AHDV AH++Y D A+RVTPPP S +LNGD  +S   +L+  NVTRVRLVQFQKNTDEPMGITLK+N+   CIVARIM+GGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSY+ +   CE      IYV+A FEY+P  D+LIPC +AGV+F++GDI+QIISKDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTR P+KDE NGKNY+FVSH++MM DI+NNEYLEYG+HE+AMYGT+L+TIR I+  GL+AILDVEPQAL+VLRTAEF+PYVVFIAAP +          D SL+RL +ESE+L+  Y H FD+ I+NN+I++TIR L+ ++D V +++QWVPV+WVY
Sbjct:    4 DDILFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAQFTSSPGLSTEDLKREASICHMLKHSHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFDSICKGKYKMNPRQWNQISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELHDFSEDP-----SSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRTPPSDAVQRAKEVLEEISCYPEN---HEAKELRRILTQPHFMALLQAHDVVAHEVYSDEALRVTPPPASPYLNGDSPESANGDLDLENVTRVRLVQFQKNTDEPMGITLKLNELNHCIVARIMYGGMIHRQGTLHVGDEIREINGISVFNQTVEQLQKMLREMRGSITFKIVPSYQMHGSSCEFSLSTQIYVRAQFEYDPSKDELIPCKEAGVRFRVGDIIQIISKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACMAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRLPKKDEENGKNYYFVSHDQMMLDISNNEYLEYGSHEDAMYGTRLETIRKINQQGLVAILDVEPQALKVLRTAEFAPYVVFIAAPTITPGIS----EDESLQRLQKESEILQKTYAHCFDMTIINNEIDETIRHLEEAMDAVSTTSQWVPVSWVY 891          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Medaka
Match: caskb (peripheral plasma membrane protein CASK [Source:NCBI gene;Acc:101172563])

HSP 1 Score: 1183.7 bits (3061), Expect = 0.000e+0
Identity = 609/964 (63.17%), Postives = 741/964 (76.87%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE------------------------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLAT-MTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            +++LF++VY+LCE+IGKGPFS+VRRCI+++T QQFAVKIVD+  FT+SPGL+T DLKREASICH+LK+PHIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++N+IHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I+ G+Y M  + W  IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K++++YGDP    HD S D      +S+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D   RAK+VLE   +  Y E L EA+EL+ I++ PHFMALL  HDV AH++Y D A+RVTPPP S +LNGD  DS   E++  NVTRVRLVQFQKNTDEPMGITLKMND   CIVARIMHGGMIHRQGTLHVGDEIREINS SV  +T+E LQK+L+  RGS+T KIVPSYR   M CE                                                IYV+A FEY+P  DDLIPC +AG++F++GDI+QIISKDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV++P FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTR P+KDE NG NY+FVSH++MM+DI+NN+YLEYG+HE+AMYGT+L+TIR IH+ G++AILDVEPQAL++LRTAEF+PYVV+IAAP L   +T+     D SL+RL  ESE L+  Y HYFD  ++NN+I+DTIR L+ ++D V ++ QWVPV+WVY
Sbjct:    6 DDVLFEDVYELCEVIGKGPFSVVRRCINRDTGQQFAVKIVDVASFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNVIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEAIIKGKYKMNPRQWAHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSYYGDPPEELHDFSDDP-----TSSGAVSQVLDSLEEIHALTDCSEKDMDFLHSVFQDQHLHTLLDLYDKINTKSSQQIRNPPSDGVQRAKEVLE--TIACYPENL-EAKELRRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPSSPYLNGDSPDSANGEMDLENVTRVRLVQFQKNTDEPMGITLKMNDLNHCIVARIMHGGMIHRQGTLHVGDEIREINSISVANQTVEQLQKMLREMRGSITFKIVPSYRSQSMSCEKESPDLSRQSPANGHASVTSSILDLPSTIQPKGRVVSRPAIKDKLSIKIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKVPFFKRKTLVLLGAHGVGRRHIKNTLIAKHPDRFAYPIPHTTRVPKKDEKNGTNYYFVSHDQMMQDISNNDYLEYGSHEDAMYGTRLETIRQIHAQGMMAILDVEPQALKILRTAEFAPYVVYIAAPTLTPGLTE-----DDSLQRLQLESETLQRTYAHYFDQTVINNEIDDTIRLLEEAVDLVSTAPQWVPVSWVY 935          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Medaka
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:NCBI gene;Acc:101159232])

HSP 1 Score: 1164.44 bits (3011), Expect = 0.000e+0
Identity = 601/932 (64.48%), Postives = 732/932 (78.54%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-----------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWV 2779
            ++ILF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ +FT+SPGL+T DLKREASICH+LK+ HIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I  G+Y M  + WN IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP    HD S D      SS+GAVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    EA+EL+ I++ PHFMALL AHDV AH++Y D A+RVTPPP S +LNGD  +S   +L+  NVTRVRLVQFQKNTDEPMGITLK+N+   CIVARIM+GGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSY+ +   CE                       IYV+A FEY+P  D+LIPC +AGV+F++GDI+QIISKDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTR P+KDE NGKNY+FVSH++MM DI+NNEYLEYG+HE+AMYGT+L+TIR I+  GL+AILDVEPQAL+VLRTAEF+PYVVFIAAP +          D SL+RL +ESE+L+  Y H FD+ I+NN+I++TIR L+ ++D V +   ++
Sbjct:    4 DDILFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAQFTSSPGLSTEDLKREASICHMLKHSHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFDSICKGKYKMNPRQWNQISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELHDFSEDP-----SSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRTPPSDAVQRAKEVLEEISCYPEN---HEAKELRRILTQPHFMALLQAHDVVAHEVYSDEALRVTPPPASPYLNGDSPESANGDLDLENVTRVRLVQFQKNTDEPMGITLKLNELNHCIVARIMYGGMIHRQGTLHVGDEIREINGISVFNQTVEQLQKMLREMRGSITFKIVPSYQMHGSSCEKESPTTSRQSPANGHSSINSSILIYVRAQFEYDPSKDELIPCKEAGVRFRVGDIIQIISKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACMAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRLPKKDEENGKNYYFVSHDQMMLDISNNEYLEYGSHEDAMYGTRLETIRKINQQGLVAILDVEPQALKVLRTAEFAPYVVFIAAPTITPGIS----EDESLQRLQKESEILQKTYAHCFDMTIINNEIDETIRHLEEAMDAVSAPPAFL 902          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Medaka
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:NCBI gene;Acc:101159232])

HSP 1 Score: 1151.73 bits (2978), Expect = 0.000e+0
Identity = 600/959 (62.57%), Postives = 732/959 (76.33%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSID-MEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE-------------------------------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWV 2779
            ++ILF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ +FT+SPGL+T DLKREASICH+LK+ HIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I  G+Y M  + WN IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP    HD S D    G L++  AVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+VLEE++    N    EA+EL+ I++ PHFMALL AHDV AH++Y D A+RVTPPP S +LNGD  +S   +L+  NVTRVRLVQFQKNTDEPMGITLK+N+   CIVARIM+GGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSY+ +   CE                                                 IYV+A FEY+P  D+LIPC +AGV+F++GDI+QIISKDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTR P+KDE NGKNY+FVSH++MM DI+NNEYLEYG+HE+AMYGT+L+TIR I+  GL+AILDVEPQAL+VLRTAEF+PYVVFIAAP +          D SL+RL +ESE+L+  Y H FD+ I+NN+I++TIR L+ ++D V +   ++
Sbjct:    4 DDILFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAQFTSSPGLSTEDLKREASICHMLKHSHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFDSICKGKYKMNPRQWNQISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELHDFSEDPSSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRTPPSDAVQRAKEVLEEISCYPEN---HEAKELRRILTQPHFMALLQAHDVVAHEVYSDEALRVTPPPASPYLNGDSPESANGDLDLENVTRVRLVQFQKNTDEPMGITLKLNELNHCIVARIMYGGMIHRQGTLHVGDEIREINGISVFNQTVEQLQKMLREMRGSITFKIVPSYQMHGSSCEKESPTTSRQSPANGHSSINSSILDLPSTIQPHGRQIVSRTPIKDKMSVKIYVRAQFEYDPSKDELIPCKEAGVRFRVGDIIQIISKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACMAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRLPKKDEENGKNYYFVSHDQMMLDISNNEYLEYGSHEDAMYGTRLETIRKINQQGLVAILDVEPQALKVLRTAEFAPYVVFIAAPTITPGIS----EDESLQRLQKESEILQKTYAHCFDMTIINNEIDETIRHLEEAMDAVSAPPAFL 934          
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Medaka
Match: CASK (calcium/calmodulin dependent serine protein kinase [Source:NCBI gene;Acc:101159232])

HSP 1 Score: 1150.58 bits (2975), Expect = 0.000e+0
Identity = 600/952 (63.03%), Postives = 732/952 (76.89%), Query Frame = 2
Query:   62 EEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKAR-APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSID-MEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKK----------------VLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELE-PNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCE--------------------------IYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQE-TANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWV 2779
            ++ILF++VY+LCE+IGKGPFS+VRRCI++ET QQFAVKIVD+ +FT+SPGL+T DLKREASICH+LK+ HIVEL ETYSSDGMLYMVFE+M+G+DLCFEIVKRA AGFVYSEAVASHY+RQI+EALRYCH++NIIHRD+KPHCVLLA+KENSAPVKLGGFG+A+QL    L VAG                   GRVGTPHFMAPEVV+REPYGKPVD WGCGV+LFILLSG LPFYGT+E LF  I  G+Y M  + WN IS  A+DLV R+L LDP +R+T+ EAL HPW+ ++ R A K HL ETVE+L+KFN+RRKLKG VLAAVSS K+++FYGDP    HD S D    G L++  AVS +LDSLEE+  LT+C+E+D+DFLH+VF+DQ LH LL++YD IN+++       P D+  RAK+                VLEE++    N    EA+EL+ I++ PHFMALL AHDV AH++Y D A+RVTPPP S +LNGD  +S   +L+  NVTRVRLVQFQKNTDEPMGITLK+N+   CIVARIM+GGMIHRQGTLHVGDEIREIN  SV  +T+E LQK+L+  RGS+T KIVPSY+ +   CE                          IYV+A FEY+P  D+LIPC +AGV+F++GDI+QIISKDDHNWWQ +L +   N TAGLIPSPELQEWR A +A+E++KQE  A+C WFGKKK+Q KDKY AKH+ VFDQLDLVTYEEVV+LP FKRKTLVLLGAHGVGRRHIKN LI   PDRFAYPIPHTTR P+KDE NGKNY+FVSH++MM DI+NNEYLEYG+HE+AMYGT+L+TIR I+  GL+AILDVEPQAL+VLRTAEF+PYVVFIAAP +          D SL+RL +ESE+L+  Y H FD+ I+NN+I++TIR L+ ++D V +   ++
Sbjct:    4 DDILFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAQFTSSPGLSTEDLKREASICHMLKHSHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL-VAG-------------------GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFDSICKGKYKMNPRQWNQISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELHDFSEDPSSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRTPPSDAVQRAKENSFRDGASDALMHLECVLEEISCYPEN---HEAKELRRILTQPHFMALLQAHDVVAHEVYSDEALRVTPPPASPYLNGDSPESANGDLDLENVTRVRLVQFQKNTDEPMGITLKLNELNHCIVARIMYGGMIHRQGTLHVGDEIREINGISVFNQTVEQLQKMLREMRGSITFKIVPSYQMHGSSCEDLPSTIQPHGRQIVSRTPIKDKMSVKIYVRAQFEYDPSKDELIPCKEAGVRFRVGDIIQIISKDDHNWWQGKLENTK-NGTAGLIPSPELQEWRVACMAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRLPKKDEENGKNYYFVSHDQMMLDISNNEYLEYGSHEDAMYGTRLETIRKINQQGLVAILDVEPQALKVLRTAEFAPYVVFIAAPTITPGIS----EDESLQRLQKESEILQKTYAHCFDMTIINNEIDETIRHLEEAMDAVSAPPAFL 927          
BLAST of Peripheral plasma membrane protein CASK vs. Planmine SMEST
Match: SMESG000060582.1 (SMESG000060582.1)

HSP 1 Score: 1803.11 bits (4669), Expect = 0.000e+0
Identity = 899/914 (98.36%), Postives = 899/914 (98.36%), Query Frame = 2
Query:   56 MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEARDLVLRLLDLDPDKRLTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSA               EWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY
Sbjct:    1 MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEARDLVLRLLDLDPDKRLTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSA---------------EWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 899          
BLAST of Peripheral plasma membrane protein CASK vs. Planmine SMEST
Match: SMESG000060582.1 (SMESG000060582.1)

HSP 1 Score: 1753.41 bits (4540), Expect = 0.000e+0
Identity = 880/914 (96.28%), Postives = 880/914 (96.28%), Query Frame = 2
Query:   56 MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAG                   GRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEARDLVLRLLDLDPDKRLTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSA               EWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY
Sbjct:    1 MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAG-------------------GRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEARDLVLRLLDLDPDKRLTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSA---------------EWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 880          
BLAST of Peripheral plasma membrane protein CASK vs. Planmine SMEST
Match: SMESG000060582.1 (SMESG000060582.1)

HSP 1 Score: 1645.17 bits (4259), Expect = 0.000e+0
Identity = 839/918 (91.39%), Postives = 852/918 (92.81%), Query Frame = 2
Query:   56 MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFK----RKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAG                   GRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEARDLVLRLLDLDPDKRLTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIP   ++ +R+    + + K+          K+ Q+         G+  + D      V  +PV+      KTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY
Sbjct:    1 MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNSPGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAG-------------------GRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEARDLVLRLLDLDPDKRLTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIP---VRNYRNGDRQVWQLKE--------ANKRLQTA-------LGLAKRNDRAKISIVPNIPVYSINWIWKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 881          
BLAST of Peripheral plasma membrane protein CASK vs. Planmine SMEST
Match: SMESG000060582.1 (SMESG000060582.1)

HSP 1 Score: 1610.12 bits (4168), Expect = 0.000e+0
Identity = 807/822 (98.18%), Postives = 807/822 (98.18%), Query Frame = 2
Query:  332 MEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            MEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEARDLVLRLLDLDPDKRLTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSA               EWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY
Sbjct:   23 MEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEARDLVLRLLDLDPDKRLTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSA---------------EWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 829          
BLAST of Peripheral plasma membrane protein CASK vs. Planmine SMEST
Match: SMESG000060582.1 (SMESG000060582.1)

HSP 1 Score: 1503.03 bits (3890), Expect = 0.000e+0
Identity = 766/826 (92.74%), Postives = 779/826 (94.31%), Query Frame = 2
Query:  332 MEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEAXXXXXXXXXXXXXXXXTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKHSGVFDQLDLVTYEEVVRLPVFK----RKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGXXXXXXXXXXXXXVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 2797
            MEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEARDLVLRLLDLDPDKRLTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIP   ++ +R+    + + K+          K+ Q+         G+  + D      V  +PV+      KTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY
Sbjct:   23 MEGSDLCFEIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLANKENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVGTPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIVMGRYHMKSQVWNMISTEARDLVLRLLDLDPDKRLTIEEALRHPWIAQKARAPKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDSIDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHALLEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKFIVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPELEPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVINNTAGLIP---VRNYRNGDRQVWQLKE--------ANKRLQTA-------LGLAKRNDRAKISIVPNIPVYSINWIWKTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMTDVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWVY 830          
The following BLAST results are available for this feature:
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CASK0.000e+066.24calcium/calmodulin dependent serine protein kinase... [more]
CASK0.000e+065.46calcium/calmodulin dependent serine protein kinase... [more]
CASK0.000e+064.63calcium/calmodulin dependent serine protein kinase... [more]
CASK0.000e+064.56calcium/calmodulin dependent serine protein kinase... [more]
CASK0.000e+065.70calcium/calmodulin dependent serine protein kinase... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-20.000e+046.99pep chromosome:WBcel235:X:12399517:12414037:-1 gen... [more]
lin-20.000e+057.20pep chromosome:WBcel235:X:12399517:12406131:-1 gen... [more]
unc-432.528e-7140.48Calcium/calmodulin-dependent protein kinase type I... [more]
unc-432.528e-7140.48Calcium/calmodulin-dependent protein kinase type I... [more]
unc-432.528e-7140.48Calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CASK0.000e+059.24gene:FBgn0013759 transcript:FBtr0084161[more]
CASK0.000e+059.24gene:FBgn0013759 transcript:FBtr0330368[more]
CASK0.000e+058.10gene:FBgn0013759 transcript:FBtr0301327[more]
CASK0.000e+065.53gene:FBgn0013759 transcript:FBtr0112873[more]
CASK0.000e+065.53gene:FBgn0013759 transcript:FBtr0112872[more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
caska0.000e+064.63calcium/calmodulin-dependent serine protein kinase... [more]
caska0.000e+064.63calcium/calmodulin-dependent serine protein kinase... [more]
caskb0.000e+063.97calcium/calmodulin-dependent serine protein kinase... [more]
mpp12.113e-14953.03membrane protein, palmitoylated 1 [Source:ZFIN;Acc... [more]
mpp14.121e-14252.61membrane protein, palmitoylated 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wbp110.000e+067.32WW domain binding protein 11 [Source:Xenbase;Acc:X... [more]
wbp110.000e+066.38WW domain binding protein 11 [Source:Xenbase;Acc:X... [more]
wbp110.000e+064.77WW domain binding protein 11 [Source:Xenbase;Acc:X... [more]
wbp110.000e+064.84WW domain binding protein 11 [Source:Xenbase;Acc:X... [more]
wbp110.000e+064.86WW domain binding protein 11 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cask0.000e+066.24calcium/calmodulin-dependent serine protein kinase... [more]
Cask0.000e+065.46calcium/calmodulin-dependent serine protein kinase... [more]
Cask0.000e+064.63calcium/calmodulin-dependent serine protein kinase... [more]
Cask0.000e+066.26calcium/calmodulin-dependent serine protein kinase... [more]
Mpp13.227e-15350.66membrane protein, palmitoylated [Source:MGI Symbol... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70589|CSKP_MOUSE0.000e+064.56Peripheral plasma membrane protein CASK OS=Mus mus... [more]
sp|O14936|CSKP_HUMAN0.000e+064.56Peripheral plasma membrane protein CASK OS=Homo sa... [more]
sp|Q62915|CSKP_RAT0.000e+064.64Peripheral plasma membrane protein CASK OS=Rattus ... [more]
sp|Q24210|CSKP_DROME0.000e+059.24Peripheral plasma membrane protein CASK OS=Drosoph... [more]
sp|P54936|LIN2_CAEEL0.000e+046.99Protein lin-2 OS=Caenorhabditis elegans OX=6239 GN... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2KYG70.000e+071.71Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A075A3590.000e+071.38Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A1S8X8D30.000e+070.26Kinase domain protein (Fragment) OS=Opisthorchis v... [more]
A0A0X3P2P40.000e+068.38Peripheral plasma membrane protein CASK OS=Schisto... [more]
A0A267G9S70.000e+069.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
caska0.000e+066.01calcium/calmodulin-dependent serine protein kinase... [more]
caskb0.000e+063.61calcium/calmodulin-dependent serine protein kinase... [more]
caska0.000e+064.19calcium/calmodulin-dependent serine protein kinase... [more]
caska0.000e+064.80calcium/calmodulin-dependent serine protein kinase... [more]
caska0.000e+063.10calcium/calmodulin-dependent serine protein kinase... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008487.11.252e-11238.26pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 ge... [more]
ENSPMAT00000008482.15.399e-11137.85pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 ge... [more]
ENSPMAT00000004699.14.984e-11040.42pep scaffold:Pmarinus_7.0:GL501143:686031:770336:1... [more]
mpp7a1.088e-8431.62membrane protein, palmitoylated 7a (MAGUK p55 subf... [more]
ENSPMAT00000008748.11.815e-7744.17pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HSL18.072e-3330.35Nim1p-related protein kinase; septin-binding kinas... [more]
RAD531.858e-3234.34DNA damage response protein kinase; required for c... [more]
SNF13.828e-3133.20AMP-activated S/T protein kinase; forms a complex ... [more]
CMK25.206e-3130.22Calmodulin-dependent protein kinase; may play a ro... [more]
GIN47.956e-3032.67Protein kinase involved in bud growth and assembly... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO393640.000e+048.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375382.435e-11839.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335772.741e-7930.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305373.034e-7944.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498982.846e-7437.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CASK0.000e+066.12calcium/calmodulin dependent serine protein kinase... [more]
caskb0.000e+063.17peripheral plasma membrane protein CASK [Source:NC... [more]
CASK0.000e+064.48calcium/calmodulin dependent serine protein kinase... [more]
CASK0.000e+062.57calcium/calmodulin dependent serine protein kinase... [more]
CASK0.000e+063.03calcium/calmodulin dependent serine protein kinase... [more]
back to top
BLAST of Peripheral plasma membrane protein CASK vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060582.10.000e+098.36SMESG000060582.1[more]
SMESG000060582.10.000e+096.28SMESG000060582.1[more]
SMESG000060582.10.000e+091.39SMESG000060582.1[more]
SMESG000060582.10.000e+098.18SMESG000060582.1[more]
SMESG000060582.10.000e+092.74SMESG000060582.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007389 ID=SMED30007389|Name=Peripheral plasma membrane protein CASK|organism=Schmidtea mediterranea sexual|type=transcript|length=3368bp
ATGAAGGTGAATAAATATAAATAATTTGAATATTCTCTAACTTCAATATA
TTCTAATGGCTGAAGAAATTCTTTTTGATAATGTTTATCAGCTATGCGAA
ATGATTGGGAAGGGCCCTTTCAGTATAGTGAGACGATGTATACACAAAGA
AACGAAACAGCAATTTGCTGTAAAAATTGTAGATATTGTGAAATTCACAA
ACAGTCCAGGTTTAACAACAGCAGATTTAAAGCGAGAAGCCAGTATTTGT
CACATTCTCAAATATCCCCATATTGTGGAGCTATTTGAGACCTACAGTAG
CGATGGAATGTTGTATATGGTATTTGAATACATGGAAGGATCTGATTTGT
GTTTTGAAATAGTGAAAAGAGCTACAGCAGGATTCGTGTACAGTGAAGCT
GTCGCAAGTCATTATATTCGTCAGATAATGGAAGCCTTACGGTACTGTCA
TGAACATAATATAATCCATCGAGACCTGAAGCCACATTGTGTCCTACTGG
CCAATAAAGAAAACTCAGCTCCAGTAAAATTAGGTGGATTTGGTATCGCT
GTGCAATTGGATCCCCAGACCTTGAAAGTCGCTGGAGACACTTTACCTTT
TGTTGACCGGGACATTCTCATTTCCTTGAAACCGGACCAATACGGTCGTG
TGGGAACACCACATTTCATGGCTCCAGAAGTCGTTAGACGTGAACCATAT
GGGAAACCTGTGGATGCTTGGGGATGCGGGGTTTTGTTATTTATTCTTTT
AAGTGGATCTTTGCCATTTTATGGCACTCAGGAGACCTTATTCGCTCAAA
TAGTCATGGGTAGATATCATATGAAATCTCAAGTTTGGAACATGATTAGC
ACAGAGGCTCGAGATCTTGTTCTGCGTTTACTCGACCTTGATCCAGACAA
ACGGCTAACAATCGAAGAGGCCCTCAGACATCCATGGATCGCTCAGAAAG
CCCGAGCACCAAAAACTCATTTGCATGAAACTGTTGAAGAATTAAAAAAA
TTTAATTCTCGCAGAAAATTAAAAGGTGTAGTTTTGGCTGCCGTTTCCAG
TATGAAATGGTCAGCTTTCTATGGAGATCCTGCTGTTATCAATCACGATG
ATTCGATTGATATGGAAGATGGAGAATTAAGTTCGGCGGGTGCAGTAAGT
GCAATTCTCGATAGCTTGGAGGAAATGCAATGCCTTACAGAATGCACAGA
GCAAGACATTGATTTCCTCCACACGGTTTTCGAAGATCAACAGCTTCATG
CACTATTGGAGATCTATGATTTCATAAACAGCCAAAATATCAGCACCTTC
GGCAGAATCCCAGACGATTCCACCCTCAGAGCCAAAAAAGTACTTGAGGA
ATTGAATATGGTATCCTACAATGAGTTTTTGCGAGAAGCTGAAGAATTAA
AGTTTATTGTTTCATCTCCGCATTTTATGGCCTTGCTCAATGCCCATGAT
GTGACTGCACATGATATCTATGGAGATGGTGCTATCAGAGTTACTCCTCC
TCCAATGTCGTCTTTTCTCAATGGCGATGGTGAGGATAGTCCAGAACCCG
AATTGGAGCCAAATGTGACACGAGTTAGACTCGTTCAATTCCAAAAGAAT
ACCGATGAGCCAATGGGTATTACATTGAAAATGAATGACGAAGGCAAATG
TATAGTTGCGCGTATTATGCACGGGGGCATGATCCATAGACAAGGCACTT
TACATGTAGGCGATGAAATACGTGAAATCAATTCTGAGTCTGTTGTTGGG
AGAACGATTGAATATTTGCAAAAATTACTAAAAAACGCTAGAGGCAGTGT
TACACTGAAAATAGTGCCGAGCTACAGACATAATCCTATGCAGTGTGAGA
TATATGTGAAAGCGATGTTTGAGTATAATCCAGAAGATGACGACTTGATC
CCATGCTCGCAAGCTGGGGTGAAGTTCAAAATCGGTGACATACTTCAAAT
TATCAGTAAAGACGATCATAATTGGTGGCAGGCCCGACTGTGGTCTGCTG
TCATTAACAACACAGCGGGACTCATTCCCAGTCCGGAACTACAGGAATGG
CGATCGGCAAGTTTGGCAATTGAAAGAAGCAAACAAGAGACTGCAAACTG
CGCTTGGTTTGGCAAAAAGAAACGACAGAGCAAAGATAAGTATCGTGCCA
AACATTCCGGTGTATTCGATCAACTGGATTTGGTGACATATGAAGAAGTT
GTACGGCTGCCAGTTTTCAAAAGGAAAACACTAGTTTTACTCGGAGCTCA
TGGAGTCGGAAGGAGGCACATAAAAAACTGTTTGATTCAGAGCGCTCCTG
ACAGATTTGCTTATCCAATACCTCATACTACCAGACCTCCGCGAAAAGAT
GAAGTCAATGGGAAAAATTATTTTTTCGTAAGCCATGAAGAAATGATGAG
AGATATCACAAATAATGAATACCTTGAGTATGGCACACATGAAGAAGCCA
TGTATGGAACTAAACTTGATACAATTCGTCACATTCATTCTGCAGGTCTC
ATAGCTATACTCGATGTTGAACCACAAGCTTTAAGAGTTTTGAGAACTGC
TGAATTTTCTCCTTATGTCGTATTTATCGCTGCCCCATGCCTCGCAACCA
TGACAGACGTACACAACCTCAATGATGGAAGTCTCGAAAGATTGTCTCGT
GAAAGTGAAATGTTAGAAGTTCAATATGGGCATTATTTCGATTTGAAAAT
TGTCAACAATGACATAGAAGATACGATCCGTCAATTGAAGCGTTCAATTG
ATGAAGTCCAATCAAGTGCTCAATGGGTCCCGGTCAACTGGGTATACTGA
TGGCGGGAGAGTGTTTGTTCGCGTTCTGTCATAAATTCTGTGATCAGAAA
CTTTAGAAGGATCTCAACTGTTGAACTGTTGCGTCTGACAATTTTTATTA
TAATGGCAACAACTACGACAACATGGTATAATTATGTACAATTTACTCTA
TATTTGTTTGTCAGGTTTCTTAGCTGATTCAATTTTGCATGTTGCCGCAT
TTATCGGTGGTCGGTTGGTTATTTTATGGCAATAATGATTTCTGCATGTC
TTGAGATATTCTTTTATCTTTATTATTTACTACGATTCTCTTCTGTTAAT
TGCCTGATGTCAAATCGCTTTTAATAGATTTCCTTCTTTACCGTTTGCTG
CTATACAGGTCTCATTGAAAATACCATTGGACTCTCTCTCGCTCTCTCTA
CTCTCTCTCTCTCTCTCTATCTATCTATTCTAGCCATAGATTTATTCGAC
AATTTCCTGTATAAAGCAGAAATGTGTGATTGTGTTATAAATTTGTTCTA
ATTCATATTTTCCAATTATTTTCATTTATTTGTAATTCGAAGAATTAAAT
ATTTAGTTCAGAAAAAAA
back to top

protein sequence of SMED30007389-orf-1

>SMED30007389-orf-1 ID=SMED30007389-orf-1|Name=SMED30007389-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=915bp
MAEEILFDNVYQLCEMIGKGPFSIVRRCIHKETKQQFAVKIVDIVKFTNS
PGLTTADLKREASICHILKYPHIVELFETYSSDGMLYMVFEYMEGSDLCF
EIVKRATAGFVYSEAVASHYIRQIMEALRYCHEHNIIHRDLKPHCVLLAN
KENSAPVKLGGFGIAVQLDPQTLKVAGDTLPFVDRDILISLKPDQYGRVG
TPHFMAPEVVRREPYGKPVDAWGCGVLLFILLSGSLPFYGTQETLFAQIV
MGRYHMKSQVWNMISTEARDLVLRLLDLDPDKRLTIEEALRHPWIAQKAR
APKTHLHETVEELKKFNSRRKLKGVVLAAVSSMKWSAFYGDPAVINHDDS
IDMEDGELSSAGAVSAILDSLEEMQCLTECTEQDIDFLHTVFEDQQLHAL
LEIYDFINSQNISTFGRIPDDSTLRAKKVLEELNMVSYNEFLREAEELKF
IVSSPHFMALLNAHDVTAHDIYGDGAIRVTPPPMSSFLNGDGEDSPEPEL
EPNVTRVRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLH
VGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVPSYRHNPMQCEIY
VKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLWSAVI
NNTAGLIPSPELQEWRSASLAIERSKQETANCAWFGKKKRQSKDKYRAKH
SGVFDQLDLVTYEEVVRLPVFKRKTLVLLGAHGVGRRHIKNCLIQSAPDR
FAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMY
GTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPCLATMT
DVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDE
VQSSAQWVPVNWVY*
back to top
Aliases
The feature 'Peripheral plasma membrane protein CASK' has the following synonyms
Synonym
maguk
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR004172L27_dom
IPR000719Prot_kinase_dom
IPR001478PDZ
IPR008145GK/Ca_channel_bsu
IPR001452SH3_domain
IPR014775L27_C
IPR027417P-loop_NTPase
IPR011511SH3_2
IPR020590Guanylate_kinase_CS
IPR008144Guanylate_kin-like_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
GO:0004672protein kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation