GCR103

Overview
NameGCR103
Smed IDSMED30007383
Length (bp)1497
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR103 (SMED30007383) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR103 (SMED30007383) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR103 (SMED30007383) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR103 (SMED30007383) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007383

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007383SMESG000061776.1 PL05003B2C01ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007383SMESG000061776.1 PL030009B10H11ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30007383SMESG000061776.1 dd_Smed_v4_7534_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30007383SMESG000061776.1 dd_Smed_v4_7534_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30007383SMESG000061776.1 dd_Smed_v4_7534_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30007383SMESG000061776.1 dd_Smed_v4_7534_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30007383SMESG000061776.1 dd_Smed_v4_7534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007383SMESG000061776.1 dd_Smed_v4_7534_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30007383SMESG000061776.1 dd_Smed_v4_7534_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR103 vs. TrEMBL
Match: A0A1I8HY28 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.036e-40
Identity = 109/327 (33.33%), Postives = 165/327 (50.46%), Query Frame = 3
Query:  294 YRFFVSWFVPLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLVGLSIFYSSRIHFIFPTLFREDEAI-QFDMRQRSAFNCYFLNGLVYFGLLVSTWIQVGIXXXXXXXXXXXXPNPHSRKTKKYAI---ALGVCVTSCVIITCILIGVNIEY--------TFPKPCPLHKVCRLSIVKSRYFFYSSLTIKVLLPTIFLLACSILIINHLKKFKXXXXXXXXXXXXXXXXXXXXXXKQKYISYTLLGMNFTFFLLTLPFEVYKIHFFYRTDAIN---TKNVALIRTVDKLLNIVLYTNNATNWLFYFMLGQRFRQSM 1229
            Y++  +W VPLL + G  GT++C+ VLL+R +   E R WFIALS+ D+  L VGL I Y + +  I          +  +D R  +A  CY L  L Y+GL+ S+W+QVGIS+ R LS          R+   YA    AL V +   +++    +  +++Y                  VC     KS Y+FYS+L ++V  P + L   S  I+  L +FK                  R   +Q+ IS  L+GMN TF L  LP+E+Y I+   R   +      + A ++  +++  +++YTNNATNW+FYF+LG RFRQ +
Sbjct:  132 YKYLFAWLVPLLYVSGCAGTIVCVTVLLRRGSTQKEARPWFIALSLTDLCVLSVGLPIMYLNIVRAIVKAELSPTATVGSYDPRSWNAPACYGLTILQYYGLIASSWVQVGISLTRCLSAVMPLA---CRRRLNYAASKRALAVTLAVPIVLAVAAVTSSVKYYERSEANNGTGGGGGSGGVCAQKW-KSPYYFYSTLVLRVFFPAVCLAVSSAGIMYSLHRFK----------RTFPTDQARLSQQQRRISIALIGMNSTFLLFALPYELYLIYATERRADLQRGGPAHAAALKIAERVFAVLMYTNNATNWIFYFVLGHRFRQEL 444          
BLAST of GCR103 vs. TrEMBL
Match: A0A193KUC5 (GCR103 OS=Schmidtea mediterranea OX=79327 GN=gcr103 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.149e-29
Identity = 109/330 (33.03%), Postives = 179/330 (54.24%), Query Frame = 3
Query:  285 INFYRFFVSWFVPLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLVGLSIFYSSRIHFIFPTLFREDEAIQFDMRQRSAFNCYFLNGLVYFGLLVSTWIQVGIXXXXXXXXX--XXXPNPHSRKTKKYAIALGVCVTSCVIITCILIGVNIEYTFPKPCPLHK--VCRLSIVKSRYFFYSSLTIKVLLPTIFLLACSILIINHL------KKFKXXXXXXXXXXXXXXXXXXXXXXK-QKYISYTLLGMNFTFFLLTLPFEVYKIHFFYRTDAINT-------KNVALIRTVDKLLNIVLYTNNATNWLFYFMLGQRFR 1220
            I FY + VSW VP++++FG  GT +C++VL+K     A+   WF+ LS  D+ SL++GL+  Y ++++ I         +I  D R  + F C+FL+  +YF L +S+W+QVGISV+R +S+          +    + A+ + + +T  ++ + IL+   + Y         +   C+LS      F++ SL  KV++PT+ L+  SI+I  +L      + F    S +  N+    +S   +R+   + +S TLLGMN TF L  LPFE++K+    R   IN        ++   +R +DK  NI +Y N ATNW+FYF+LG+ FR
Sbjct:   21 IYFYHYVVSWLVPVILLFGCSGTSICIVVLVKTAKRRAKIWSWFLVLSTNDIISLILGLTSLYLNKLYLI----TNRASSISEDFRSSNIFVCHFLSTGLYFTLFLSSWMQVGISVIRTISISCPLFIKTRFTASVARKALVIHISIT--LLFSIILVNSTLIYDEVYSGNFSRGFRCKLSNKYDDLFYFVSLVFKVIIPTLILILSSIIIWRNLSSQYDSRDFNNTDSIKFTNSDTPQHSEHSRRISINRNLSLTLLGMNLTFLLSNLPFEIFKV--INRNFNINKIKLPKDFEDFLTMRILDKSFNISVYFNQATNWMFYFLLGKSFR 342          
BLAST of GCR103 vs. TrEMBL
Match: K1P9R6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10005970 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.676e-9
Identity = 79/327 (24.16%), Postives = 145/327 (44.34%), Query Frame = 3
Query:  321 PLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLVGLSIFYSSRIHFIFPTLFREDEAIQFDMRQRSAFNCYFLNGLVYFGLLVSTWIQVGIXXXXXXXXXXXXPNPHSRKTK----KYAIALGVCVTSCVIITCILI-GVNIEYTFPKPCPLHKVCRLSIVKSRYFF-----YSSLTIKVLLPTIFLLACSILIINHLKKFKXXXXXXXXXXXXXXXXXXXXXXKQKYISYTLLGMNFTFFLLTLPFEVYKIHFFYRTDAINTKNVALIRTVDKLLNIVLYTNNATNWLFYFMLGQRFRQSMVHLICQKYSISCTS 1271
            P++I  G +G + C++ LL++      T ++ +ALS+ D+  L  GL        H+I        ++   D+R  S  +C     +VY  L  S WI V +++ RV  V      PH+ K +      A  LGV + S ++I   LI G+           + K C       + FF     +  L     +P + +L  +++II  + K     + ++           ++  K   ++ TL+ +N  F L T P  VY   +   ++  +   +A +     ++N+++Y+NN  N+L Y + G  FR+ + HL C++Y  + T 
Sbjct:   26 PIMIALGTVGNIFCIVTLLRKNLRQQTTVIYLVALSLNDLLVLYSGL------LRHWII-------KSFDVDVRLLSELSCKLHLWVVYMSLDTSGWILVAVTIERVALVWF----PHASKARCNRTVAACILGVLIGSTMLINSHLIYGIGDVTNIENNETVVKHCYYESDSYKRFFIDIWPWIDLAKFNAIPFLLILIGNVIIITSVVK-----NHQKLRRTVVPQGTRKRMKKVNSMTATLIVLNTAFLLSTTPISVYLAFYEEWSENASHHTIARLTLSWAVVNLLMYSNNTLNFLLYCVSGGNFRKEIRHL-CKRYPAAHTE 329          
BLAST of GCR103 vs. TrEMBL
Match: A0A210QZM9 (Orexin receptor type 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15225 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 4.156e-9
Identity = 79/313 (25.24%), Postives = 131/313 (41.85%), Query Frame = 3
Query:  321 PLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLVGLSIFYSSRIHFIFPTLFREDEAIQFDMRQRSAFNCYFLNGLVYFGLLVSTWIQVGIXXXXXXXXXXXXPNPHSRKTKKYAIALGVCVTSCVIITCILIGVNIEYTFPKPCPLHK-----VCRLSIVKSRYFF-----YSSLTIKVLLPTIFLLACSILIINHLKKFKXXXXXXXXXXXXXXXXXXXXXXKQKYISYTLLGMNFTFFLLTLPFEVYKIHFFYRTDAINTKNVALIRTVDKLLNIVLYTNNATNWLFYFMLGQRFRQSM 1229
            P +I+FG  G +L + +L ++    +   ++ + L+ +D+  L  GL   + S                Q D+R  ++  C     LVY  L  S WI V ++  RV  V      PH  K K    +    +T  + +  +LI  +I Y   +   +       +C       RYFF     +  LTI   LP  FL+A ++LII    K      +     V +  +   +R +   +S  L+ +N  F L T P  +Y I + +     +    A +     L+N+++Y NN  N+L Y M G RFR  +
Sbjct:   17 PFMIVFGTFGNILSIFILTRKNIRQSTCTVYLVVLACSDLVVLYTGLLRTWIS-------------ATFQNDIRTHTSGLCKVHTWLVYVSLDFSAWILVAVTAERVALVWF----PHKAKAKCTKKSAAFVITP-IFVCLMLINSHILYGMDRVVKVDGNSTSILCDFVTENYRYFFDELWPWVDLTIFCGLPFCFLVAGNVLIIT---KVFASQRAARRQVVPHDPNSRAQRSQMSSMSIMLICLNCVFMLCTTPVSIYLIGYIHWYRGASESIKATLSLFWTLVNVLMYANNTFNFLLYCMSGSRFRAEV 308          
BLAST of GCR103 vs. Planmine SMEST
Match: SMESG000061776.1 (SMESG000061776.1)

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 440/441 (99.77%), Postives = 440/441 (99.77%), Query Frame = 3
Query:  156 MDNGLPQTFEIFGNNSAKYVNAVLVYCSKQMDLVNEGNNFQIYINFYRFFVSWFVPLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLVGLSIFYSSRIHFIFPTLFREDEAIQFDMRQRSAFNCYFLNGLVYFGLLVSTWIQVGIXXXXXXXXXXXXPNPHSRKTKKYAIALGVCVTSCVIITCILIGVNIEYTFPKPCPLHKVCRLSIVKSRYFFYSSLTIKVLLPTIFLLACSILIINHLKKFKXXXXXXXXXXXXXXXXXXXXXXKQKYISYTLLGMNFTFFLLTLPFEVYKIHFFYRTDAINTKNVALIRTVDKLLNIVLYTNNATNWLFYFMLGQRFRQSMVHLICQKYSISCTSFVSTFXXXXXXXXXXXXXKSTPVGCTAGKQTNRLLKPTESPEEMFTLVASQPKFHCTFPAAQNTFPKFY 1478
            MDNGLPQTFEIFGNNSAKYVNAVLVYCSKQMDLVNEGNNFQIYINFYRFFVSWFVPLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLVGLSIFYSSRIHFIFPTLFREDEAIQFDMRQRSAFNCYFLNGLVYFGLLVSTWIQVGISVLRVLSVKSKSPNPHSRKTKKYAIALGVCVTSCVIITCILIGVNIEYTFPKPCPLHKVCRLSIVKSRYFFYSSLTIKVLLPTIFLLACSILIINHLKKFKRRFSSRENNNVNNINSVIRKRVKQKYISYTLLGMNFTFFLLTLPFEVYKIHFFYRTDAINTKNVALIRTVDKLLNIVLYTNNATNWLFYFMLGQRFRQSMVHLICQKYSISCTSFVSTFRRLNTSLRSNRRTKSTPV CTAGKQTNRLLKPTESPEEMFTLVASQPKFHCTFPAAQNTFPKFY
Sbjct:    1 MDNGLPQTFEIFGNNSAKYVNAVLVYCSKQMDLVNEGNNFQIYINFYRFFVSWFVPLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLVGLSIFYSSRIHFIFPTLFREDEAIQFDMRQRSAFNCYFLNGLVYFGLLVSTWIQVGISVLRVLSVKSKSPNPHSRKTKKYAIALGVCVTSCVIITCILIGVNIEYTFPKPCPLHKVCRLSIVKSRYFFYSSLTIKVLLPTIFLLACSILIINHLKKFKRRFSSRENNNVNNINSVIRKRVKQKYISYTLLGMNFTFFLLTLPFEVYKIHFFYRTDAINTKNVALIRTVDKLLNIVLYTNNATNWLFYFMLGQRFRQSMVHLICQKYSISCTSFVSTFRRLNTSLRSNRRTKSTPVVCTAGKQTNRLLKPTESPEEMFTLVASQPKFHCTFPAAQNTFPKFY 441          
BLAST of GCR103 vs. Planmine SMEST
Match: SMESG000064805.1 (SMESG000064805.1)

HSP 1 Score: 267.314 bits (682), Expect = 4.774e-85
Identity = 160/359 (44.57%), Postives = 222/359 (61.84%), Query Frame = 3
Query:  222 VLVYCSKQMDLVNEGNNFQIYINFYRFFVSWFVPLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLVGLSIFYSSRIHFIFPTLFREDEAIQFDMRQRSAFNCYFLNGLVYFGLLVSTWIQVGIXXXXXXXXXX-XXPNPHSRKTKKYAIALGVCVTSCVIITCILIGVNIEYTFPKPCPLHKVCRLSIVKSRYFFYSSLTIKVLLPTIFLLACSILIINHLKKFKXXXXXXXXXXXXXXXXXXXXXXKQKYISYTLLGMNFTFFLLTLPFEVYK-IHFFYRTDAINTKNV--------ALIRTVDKLLNIVLYTNNATNWLFYFMLGQRFRQSMVHLICQKYSISCT 1268
            VL  C  Q  L++  +++ I  NFY+FFVSW+ P L++FG  GT++CLIV+ K R+G  E R WFIALS+ D+YSL VGLSI Y SRI FIFP         Q  ++  + ++C+ +N +VY GLL+S W+QVGIS+ R +++K    P  +S + +    AL  C+  C+ I  +LI  ++EY     CP+ K+C++   K R FFY SLT+KV++P I LL+ S +I   LK  +   + R N +  N      K+++Q++IS TLLGMN T  L  LPFEVYK IHF++  D   TK             R  DKLLNI+LYTNNATNWLFYFMLG+RFR+ + H +  K  + CT
Sbjct:   14 VLAICHNQTKLLDNNDSWLILTNFYKFFVSWYTPCLLIFGVSGTVICLIVINKHRSGQHELRAWFIALSVVDIYSLCVGLSILYISRISFIFPFSQNSTNIFQDGIKNSNKYSCFIINYMVYVGLLLSVWVQVGISMSRAVALKWPNIPRNNSIRLRNSYYALIFCIFMCLSIAFVLIFDSLEYRGTDRCPIFKICKVKSSKFRKFFYFSLTVKVIVPIILLLSSSYVITQKLK--QSVDNYRRNFDRYNYYFSRLKKMQQRHISLTLLGMNSTLLLFVLPFEVYKIIHFYHYEDIKETKPDLKAGQSPHVTARLFDKLLNIILYTNNATNWLFYFMLGKRFRREVSHFLSMKTFLKCT 370          
BLAST of GCR103 vs. Planmine SMEST
Match: SMESG000078225.1 (SMESG000078225.1)

HSP 1 Score: 163.31 bits (412), Expect = 4.284e-45
Identity = 118/343 (34.40%), Postives = 181/343 (52.77%), Query Frame = 3
Query:  291 FYRFFVSWFVPLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLVGLSIFYSSRIHFIFPTLFREDEAIQFDMRQRSAFNCYFLNGLVYFGLLVSTWIQVGIXXXXXXXXXXXXPNPHSRKTKKYAIALGVCVTSCVIITCILIGVNIEY--TFPKPCPLHKVCRLSIVKSRYFFYSSLTIKVLLPTIFLLACSILIINHLKKFKXXXXXXXXXXXXXXXXXXXX-----------XXKQKYISYTLLGMNFTFFLLTLPFEVYKIHFF-YRTDAINTKNVA----LIRTVDKLLNIVLYTNNATNWLFYFMLGQRFRQSMVHLI-CQKYSIS 1262
            FY++FVSWFVP++I FG  GT++ +IVLL RRT   E R WF+ALS  D++ L+ GLS  Y S+++ I            FD++    F CYF +  ++F LL+S+W+Q GIS LR +S            T    I L + + + +I++ +++ + +EY   + +       CRL       FF  SL ++V++P + LL  S +I   L + +           +++++                   + IS  LL MN  F L  LPFE++KI +  Y   +I TKN      L R  DK  NI++Y N +TNWLFYFMLG+ FR+ +V L  C+K++ S
Sbjct:   15 FYKYFVSWFVPVVICFGSSGTIVSIIVLLLRRTTQPEIRCWFLALSANDLFGLIFGLSTLYLSKLNLIL-----SKPMWNFDIKSSQEFVCYFNSNCIFFSLLLSSWLQAGISALRAVSTSQPLKLRTKITTSSARIYLILLIGTALILSLLIVNITVEYKEEYLRNRTQGHRCRLKKKFINTFFVFSLIVRVIIPILLLLLSSFMIWKSLNRQQHERRQSCLLGNHDLSASRNSPSPRGKRIHSPHSNHRNISCMLLWMNLAFLLANLPFEIFKIIYKNYDVLSIKTKNEMYLYILSRIFDKFFNILVYLNQSTNWLFYFMLGKNFRKDLVILFRCKKHNWS 352          
BLAST of GCR103 vs. Planmine SMEST
Match: SMESG000075889.1 (SMESG000075889.1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.675e-13
Identity = 57/205 (27.80%), Postives = 103/205 (50.24%), Query Frame = 3
Query:  285 INFYRFFVSWFVPLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLVGLSIFYSSRIHFIFPTLFREDEAIQFDMRQRSAFNCYFLNGLVYFGLLVSTWIQVGIXXXXXXXXX--XXXPNPHSRKTKKYAIALGVCVTSCVIITCILIGVNIEYTFPKPCPLHK--VCRLSIVKSRYFFYSSLTIKVLLPTIFLL 887
            I FY + VSW VP++++FG  GT +C++VL+K  T     ++W               L+  Y ++++ I         +I  D R  + F C+FL+  +YF L +S+W+QVGISV+R +S+          +    + A+ + + +T  ++ + IL+   + Y         +   C+LS      F++ SL  KV++PT+ L+
Sbjct:   21 IYFYHYVVSWLVPVILLFGCSGTSICIVVLVK--TAKRRAKIW--------------SLTSLYLNKLYLI----TNRASSISEDFRSSNIFVCHFLSTGLYFTLFLSSWMQVGISVIRTISISCPLFIKTRFTASVARKALVIHISIT--LLFSIILVNSTLIYDEVYSGNFSRGFRCKLSNKYDDLFYFVSLVFKVIIPTLILI 203          
BLAST of GCR103 vs. Planmine SMEST
Match: SMESG000061235.1 (SMESG000061235.1)

HSP 1 Score: 53.1434 bits (126), Expect = 2.881e-7
Identity = 81/338 (23.96%), Postives = 151/338 (44.67%), Query Frame = 3
Query:  291 FYRFFVSWFVPLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLVGLSIFYSSRIHFIFPTLFREDEAIQFDMRQRSAFNCYFLNGLVYFGLLVSTWIQVGIXXXXXXXXXXXXPNPHSRKTKKYAIALGVCVTSCVIITCIL-------IGVNIEYTFPKPCPLHKVCRLSIVKSRYFFYSSLTI-----KVLLPTIFLLACSILIINHLKKFKXXXXXXXXX-XXXXXXXXXXXXXKQKYISYTLLGMNFTFFLLTLPFEVYKIHFFYRTDAINTKNVALIRTVDKLLNIVLYTNNATNWLFYFMLGQRFRQSMVH-LICQKYSIS 1262
             Y  F +   P++++ G IG +L  IVL         + ++   + I D   L+ GL   Y   I +IF     E+E++ F         C     +     LVS W+ V   +     +    P    + T+K  IA  V ++S +I + ++       +  ++   F K   +H     +     ++FY   TI       L+P   L++ ++LI+  + + K   S   NN N     S+ +      ++S TL+ ++F F + T P  V+K+   +R D     +  +I+ +D +  +++YTN++ N+L Y   G RFRQ ++  L+C+  S++
Sbjct:   66 LYHIFWTVIPPIILLIGSIGNVLACIVLCCYLIDKCSSYIYLAVMVIVDEMILVTGLLRRY---IGYIFIKHI-ENESVLF---------CRLTQFIGVSSSLVSVWLIV--VMTIERVIIIYLPLRAKQITQK-KIARAV-ISSTIICSSLVASHFFFTVDTHVTKQFNKTNLIH-FGECTAKPQFHYFYRVWTILDASLYSLIPFCVLISLNVLIVREILRSKNNRSILMNNFNQACSKSIKKVSTDTHHLSVTLIAVSFIFLITTTPLVVHKLLIHFR-DKDEVYHSGIIQFLDVIFEMLMYTNHSINFLLYCATGNRFRQHVLSLLLCRTLSLN 384          
The following BLAST results are available for this feature:
BLAST of GCR103 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
A0A1I8HY283.036e-4033.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A193KUC51.149e-2933.03GCR103 OS=Schmidtea mediterranea OX=79327 GN=gcr10... [more]
K1P9R62.676e-924.16G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A210QZM94.156e-925.24Orexin receptor type 2 OS=Mizuhopecten yessoensis ... [more]
back to top
BLAST of GCR103 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR103 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061776.10.000e+099.77SMESG000061776.1[more]
SMESG000064805.14.774e-8544.57SMESG000064805.1[more]
SMESG000078225.14.284e-4534.40SMESG000078225.1[more]
SMESG000075889.15.675e-1327.80SMESG000075889.1[more]
SMESG000061235.12.881e-723.96SMESG000061235.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007383 ID=SMED30007383|Name=GCR103|organism=Schmidtea mediterranea sexual|type=transcript|length=1497bp
TCAACAAATAAAATCGATGCAAATCATCAACTGCTATAAATAGCCGACCA
ATAGAAATCATTGTGAAATATACTAATTCCAATTCTAGCAAATCAATGTG
AAATCAAGTCATTGTACAGTAGCAGAAAATAATAATTTTTTTCACAAAAA
GCCCTATGGATAACGGTCTACCTCAAACGTTTGAAATATTTGGAAACAAT
TCAGCAAAATATGTCAATGCCGTTCTAGTTTATTGTTCGAAACAAATGGA
TTTAGTCAACGAGGGTAACAATTTTCAAATATATATCAATTTCTATAGAT
TTTTCGTTTCCTGGTTTGTACCATTGTTAATCATGTTCGGTGAAATCGGA
ACTCTGCTTTGTTTGATCGTTCTCTTGAAACGACGAACTGGAAACGCTGA
AACCCGAATGTGGTTTATCGCTCTATCAATAGCCGACATGTATTCTCTGC
TTGTTGGATTGTCTATTTTTTATTCATCGAGAATTCATTTTATTTTTCCA
ACTCTATTTCGCGAAGATGAAGCAATTCAATTCGACATGAGACAAAGAAG
TGCATTCAATTGTTATTTTCTTAATGGATTGGTTTACTTCGGTTTGTTGG
TGTCGACTTGGATTCAAGTCGGAATTTCCGTGTTGAGAGTACTGTCAGTA
AAATCCAAATCACCGAATCCCCATTCGAGAAAAACGAAAAAATACGCAAT
CGCATTGGGAGTTTGTGTTACGAGTTGCGTCATTATCACCTGCATTCTGA
TTGGTGTAAATATCGAATACACTTTTCCGAAACCGTGTCCATTGCATAAG
GTTTGTCGATTGTCGATTGTTAAGTCCAGATATTTTTTCTATTCGAGCTT
GACGATAAAAGTTCTCCTGCCAACGATATTTCTTCTTGCTTGTTCGATTT
TAATTATCAATCACTTGAAGAAGTTTAAACGAAGATTCTCCAGCCGGGAA
AACAACAATGTCAACAATATCAATTCTGTGATCAGAAAACGAGTAAAGCA
GAAATACATTTCCTACACTTTGTTGGGAATGAATTTCACTTTCTTCTTGT
TAACTTTACCATTTGAAGTTTATAAAATTCATTTCTTTTATCGTACTGAT
GCTATTAATACTAAAAATGTTGCGTTAATTAGAACCGTTGATAAATTGCT
TAATATCGTTCTCTATACGAACAACGCAACGAATTGGTTGTTTTATTTTA
TGCTTGGCCAAAGATTTAGACAGAGCATGGTCCATTTGATTTGTCAGAAA
TATTCCATCAGTTGCACTTCATTTGTGTCGACTTTCAGGAGGCTCAATAC
TTCCTTGAGGTCGAATCGACGAACGAAAAGCACTCCAGTCGGGTGCACGG
CTGGCAAACAAACAAACAGATTATTAAAACCAACAGAATCCCCAGAGGAA
ATGTTTACTTTGGTAGCCAGTCAGCCAAAATTTCATTGCACATTTCCTGC
AGCCCAGAATACATTTCCGAAATTTTATTAAGTACATTTTTGAGATC
back to top

protein sequence of SMED30007383-orf-1

>SMED30007383-orf-1 ID=SMED30007383-orf-1|Name=SMED30007383-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=442bp
MDNGLPQTFEIFGNNSAKYVNAVLVYCSKQMDLVNEGNNFQIYINFYRFF
VSWFVPLLIMFGEIGTLLCLIVLLKRRTGNAETRMWFIALSIADMYSLLV
GLSIFYSSRIHFIFPTLFREDEAIQFDMRQRSAFNCYFLNGLVYFGLLVS
TWIQVGISVLRVLSVKSKSPNPHSRKTKKYAIALGVCVTSCVIITCILIG
VNIEYTFPKPCPLHKVCRLSIVKSRYFFYSSLTIKVLLPTIFLLACSILI
INHLKKFKRRFSSRENNNVNNINSVIRKRVKQKYISYTLLGMNFTFFLLT
LPFEVYKIHFFYRTDAINTKNVALIRTVDKLLNIVLYTNNATNWLFYFML
GQRFRQSMVHLICQKYSISCTSFVSTFRRLNTSLRSNRRTKSTPVGCTAG
KQTNRLLKPTESPEEMFTLVASQPKFHCTFPAAQNTFPKFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 39..370
e-value: 1.5E-28
score: 101.6
NoneNo IPR availablePANTHERPTHR24228:SF59NEUROPEPTIDE RECEPTOR FAMILYcoord: 57..362
NoneNo IPR availablePANTHERPTHR24228B2 BRADYKININ RECEPTOR/ANGIOTENSIN II RECEPTORcoord: 57..362
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 49..358
e-value: 9.92721E-17
score: 78.4436
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 43..376
NoneNo IPR availableTMHMMTMhelixcoord: 138..160
NoneNo IPR availableTMHMMTMhelixcoord: 52..74
NoneNo IPR availableTMHMMTMhelixcoord: 232..254
NoneNo IPR availableTMHMMTMhelixcoord: 86..108
NoneNo IPR availableTMHMMTMhelixcoord: 181..203
NoneNo IPR availableTMHMMTMhelixcoord: 284..306
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 67..347
e-value: 7.9E-9
score: 35.2
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 65..347
score: 19.79