YTH domain-containing family protein 2

Overview
NameYTH domain-containing family protein 2
Smed IDSMED30007379
Length (bp)1694
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of YTH domain-containing family protein 2 (SMED30007379) t-SNE clustered cells

Violin plots show distribution of expression levels for YTH domain-containing family protein 2 (SMED30007379) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of YTH domain-containing family protein 2 (SMED30007379) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for YTH domain-containing family protein 2 (SMED30007379) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007379

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30007379h1SMcG0000898 dd_Smed_v4_7891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30007379h1SMcG0000898 dd_Smed_v4_7891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007379h1SMcG0000898 dd_Smed_v4_7891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of YTH domain-containing family protein 2 vs. Ensembl Human
Match: YTHDF2 (YTH N6-methyladenosine RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:31675])

HSP 1 Score: 264.618 bits (675), Expect = 7.021e-81
Identity = 121/177 (68.36%), Postives = 142/177 (80.23%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            +INN    N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PLEK +QVLKIIA++K T+SI+DDF HYE+R+  E
Sbjct:  344 SINN---YNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEE 517          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Human
Match: YTHDF2 (YTH N6-methyladenosine RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:31675])

HSP 1 Score: 265.003 bits (676), Expect = 1.475e-80
Identity = 121/177 (68.36%), Postives = 142/177 (80.23%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            +INN    N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PLEK +QVLKIIA++K T+SI+DDF HYE+R+  E
Sbjct:  394 SINN---YNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEE 567          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Human
Match: YTHDF2 (YTH N6-methyladenosine RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:31675])

HSP 1 Score: 265.003 bits (676), Expect = 1.475e-80
Identity = 121/177 (68.36%), Postives = 142/177 (80.23%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            +INN    N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PLEK +QVLKIIA++K T+SI+DDF HYE+R+  E
Sbjct:  394 SINN---YNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEE 567          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Human
Match: YTHDF3 (YTH N6-methyladenosine RNA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:26465])

HSP 1 Score: 256.914 bits (655), Expect = 6.693e-78
Identity = 118/172 (68.60%), Postives = 137/172 (79.65%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQ 1511
            AINN    N  DFD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD    A VW+Q KWKG+F V+W+FVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA FK T+SI+DDF HYE+
Sbjct:  349 AINN---YNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEK 517          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Human
Match: YTHDF3 (YTH N6-methyladenosine RNA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:26465])

HSP 1 Score: 256.914 bits (655), Expect = 6.693e-78
Identity = 118/172 (68.60%), Postives = 137/172 (79.65%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQ 1511
            AINN    N  DFD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD    A VW+Q KWKG+F V+W+FVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA FK T+SI+DDF HYE+
Sbjct:  349 AINN---YNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEK 517          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Fly
Match: Ythdf (gene:FBgn0039261 transcript:FBtr0084795)

HSP 1 Score: 223.016 bits (567), Expect = 4.554e-64
Identity = 97/161 (60.25%), Postives = 133/161 (82.61%), Query Frame = 3
Query: 1053 AKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSS---AGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            A+FFVIKSYSEDD++RSIKY+IWCST+ GN+RLD+A+      GG+  I LFFSVNGSGHFCG+A+M++PVD  + +SVW+Q KW+G+F+V+W++VKDVPN  LRHIR+E NENK VTNSRD  E+P +KG +VL+I+ ++  ++SI+DDF HYE+++  E
Sbjct:  381 ARFFVIKSYSEDDIHRSIKYEIWCSTDHGNKRLDDAFKERHEEGGN--IMLFFSVNGSGHFCGMAQMMTPVDYNSTSSVWSQDKWRGKFKVKWIYVKDVPNGTLRHIRLENNENKSVTNSRDTQEVPNDKGIEVLQILHSYNHSTSIFDDFFHYEKKQEEE 539          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Fly
Match: Ythdf (gene:FBgn0039261 transcript:FBtr0113281)

HSP 1 Score: 222.631 bits (566), Expect = 5.257e-64
Identity = 97/161 (60.25%), Postives = 133/161 (82.61%), Query Frame = 3
Query: 1053 AKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSS---AGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            A+FFVIKSYSEDD++RSIKY+IWCST+ GN+RLD+A+      GG+  I LFFSVNGSGHFCG+A+M++PVD  + +SVW+Q KW+G+F+V+W++VKDVPN  LRHIR+E NENK VTNSRD  E+P +KG +VL+I+ ++  ++SI+DDF HYE+++  E
Sbjct:  376 ARFFVIKSYSEDDIHRSIKYEIWCSTDHGNKRLDDAFKERHEEGGN--IMLFFSVNGSGHFCGMAQMMTPVDYNSTSSVWSQDKWRGKFKVKWIYVKDVPNGTLRHIRLENNENKSVTNSRDTQEVPNDKGIEVLQILHSYNHSTSIFDDFFHYEKKQEEE 534          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Fly
Match: Ythdf (gene:FBgn0039261 transcript:FBtr0084794)

HSP 1 Score: 222.631 bits (566), Expect = 5.674e-64
Identity = 97/161 (60.25%), Postives = 133/161 (82.61%), Query Frame = 3
Query: 1053 AKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSS---AGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            A+FFVIKSYSEDD++RSIKY+IWCST+ GN+RLD+A+      GG+  I LFFSVNGSGHFCG+A+M++PVD  + +SVW+Q KW+G+F+V+W++VKDVPN  LRHIR+E NENK VTNSRD  E+P +KG +VL+I+ ++  ++SI+DDF HYE+++  E
Sbjct:  382 ARFFVIKSYSEDDIHRSIKYEIWCSTDHGNKRLDDAFKERHEEGGN--IMLFFSVNGSGHFCGMAQMMTPVDYNSTSSVWSQDKWRGKFKVKWIYVKDVPNGTLRHIRLENNENKSVTNSRDTQEVPNDKGIEVLQILHSYNHSTSIFDDFFHYEKKQEEE 540          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Fly
Match: Ythdf (gene:FBgn0039261 transcript:FBtr0334507)

HSP 1 Score: 222.631 bits (566), Expect = 5.674e-64
Identity = 97/161 (60.25%), Postives = 133/161 (82.61%), Query Frame = 3
Query: 1053 AKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSS---AGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            A+FFVIKSYSEDD++RSIKY+IWCST+ GN+RLD+A+      GG+  I LFFSVNGSGHFCG+A+M++PVD  + +SVW+Q KW+G+F+V+W++VKDVPN  LRHIR+E NENK VTNSRD  E+P +KG +VL+I+ ++  ++SI+DDF HYE+++  E
Sbjct:  382 ARFFVIKSYSEDDIHRSIKYEIWCSTDHGNKRLDDAFKERHEEGGN--IMLFFSVNGSGHFCGMAQMMTPVDYNSTSSVWSQDKWRGKFKVKWIYVKDVPNGTLRHIRLENNENKSVTNSRDTQEVPNDKGIEVLQILHSYNHSTSIFDDFFHYEKKQEEE 540          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Fly
Match: Ythdc1 (gene:FBgn0027616 transcript:FBtr0073079)

HSP 1 Score: 60.4622 bits (145), Expect = 3.049e-9
Identity = 40/144 (27.78%), Postives = 65/144 (45.14%), Query Frame = 3
Query: 1044 FKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVW------AQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKII 1457
            F++ +FF+IKS + D+V  S    +W +    +  L+ A+  A     + L FSVN SG F G A M +P         W      +     G   + W+  K++  +   H+    NE KPV   RD  EI  + G ++ ++ 
Sbjct:  240 FRDTRFFLIKSNNSDNVQLSKNKSVWATLPQNDANLNQAFKEARN---VLLIFSVNESGKFAGFARMAAPSRRDIPQVAWVLPPSISPKALGGVIELDWICRKELSFNATLHLHNTWNEGKPVKIGRDGQEIEPKIGGELCRLF 380          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Zebrafish
Match: ythdf1 (YTH N(6)-methyladenosine RNA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2786])

HSP 1 Score: 264.233 bits (674), Expect = 4.399e-80
Identity = 117/171 (68.42%), Postives = 139/171 (81.29%), Query Frame = 3
Query: 1014 SLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            S N  +FD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD+A+ +  G  P++L FSVNGSGHFCGVAEM SPVD  T A VWAQ KWKG+F V W+FVKDVPNSQLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA +K T+SI+DDF HYE+R+  E
Sbjct:  416 SYNPKEFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRAINGKGPVYLLFSVNGSGHFCGVAEMRSPVDYGTSAGVWAQDKWKGKFDVDWLFVKDVPNSQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATYKHTTSIFDDFSHYEKRQEEE 586          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Zebrafish
Match: ythdf1 (YTH N(6)-methyladenosine RNA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2786])

HSP 1 Score: 264.233 bits (674), Expect = 4.399e-80
Identity = 117/171 (68.42%), Postives = 139/171 (81.29%), Query Frame = 3
Query: 1014 SLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            S N  +FD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD+A+ +  G  P++L FSVNGSGHFCGVAEM SPVD  T A VWAQ KWKG+F V W+FVKDVPNSQLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA +K T+SI+DDF HYE+R+  E
Sbjct:  416 SYNPKEFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRAINGKGPVYLLFSVNGSGHFCGVAEMRSPVDYGTSAGVWAQDKWKGKFDVDWLFVKDVPNSQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATYKHTTSIFDDFSHYEKRQEEE 586          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Zebrafish
Match: ythdf2 (YTH N(6)-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:393220])

HSP 1 Score: 264.233 bits (674), Expect = 4.676e-80
Identity = 117/166 (70.48%), Postives = 137/166 (82.53%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRE 1517
            N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S     P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PL+K RQVLKIIA++K T+SI+DDF HYE+R+
Sbjct:  412 NPKDFDWNPKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSLANKGPLYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLDKARQVLKIIASYKHTTSIFDDFSHYEKRQ 577          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Zebrafish
Match: ythdf2 (YTH N(6)-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:393220])

HSP 1 Score: 263.462 bits (672), Expect = 7.644e-80
Identity = 117/166 (70.48%), Postives = 137/166 (82.53%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRE 1517
            N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S     P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PL+K RQVLKIIA++K T+SI+DDF HYE+R+
Sbjct:  411 NPKDFDWNPKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSLANKGPLYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLDKARQVLKIIASYKHTTSIFDDFSHYEKRQ 576          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Zebrafish
Match: BX649452.1 (pep chromosome:GRCz11:CHR_ALT_CTG24_1_13:24286156:24288928:1 gene:ENSDARG00000114758.1 transcript:ENSDART00000185566.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX649452.1)

HSP 1 Score: 256.914 bits (655), Expect = 1.477e-77
Identity = 117/177 (66.10%), Postives = 138/177 (77.97%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            A+NN    N  DFD   KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S     P++L FSVNGSGHFCGVAEM S VD    A VW+Q KWKG+F V+W+FVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA FK T+SI+DDF HYE+R+  E
Sbjct:  406 ALNN---YNPKDFDWTLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDGAYRSLSAKGPLYLLFSVNGSGHFCGVAEMKSTVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQEEE 579          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Xenopus
Match: ythdf1 (YTH N(6)-methyladenosine RNA binding protein 1 [Source:NCBI gene;Acc:395029])

HSP 1 Score: 261.151 bits (666), Expect = 7.881e-80
Identity = 115/168 (68.45%), Postives = 138/168 (82.14%), Query Frame = 3
Query: 1014 SLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRE 1517
            S N  DFD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD+A+ S  G  P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F V+W+FVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK + VLKIIA +K T+SI+DDF HYE+R+
Sbjct:  332 SYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRSMNGKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWLFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKLVLKIIATYKHTTSIFDDFSHYEKRQ 499          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Xenopus
Match: ythdf1 (YTH N(6)-methyladenosine RNA binding protein 1 [Source:NCBI gene;Acc:395029])

HSP 1 Score: 261.536 bits (667), Expect = 1.760e-79
Identity = 116/171 (67.84%), Postives = 139/171 (81.29%), Query Frame = 3
Query: 1014 SLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            S N  DFD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD+A+ S  G  P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F V+W+FVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK + VLKIIA +K T+SI+DDF HYE+R+  E
Sbjct:  375 SYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRSMNGKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWLFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKLVLKIIATYKHTTSIFDDFSHYEKRQEEE 545          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Xenopus
Match: adk (adenosine kinase [Source:Xenbase;Acc:XB-GENE-997225])

HSP 1 Score: 258.07 bits (658), Expect = 4.808e-78
Identity = 120/177 (67.80%), Postives = 140/177 (79.10%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            AINN    N  DFD + KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD    A VW+Q KWKG+F V+WVFVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA FK T+SI+DDF HYE+R+  E
Sbjct:  388 AINN---YNPKDFDWSLKNGRVFIIKSYSEDDIHRSIKYTIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFDVKWVFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQEEE 561          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Xenopus
Match: lmo7 (LIM domain 7 protein [Source:Xenbase;Acc:XB-GENE-949056])

HSP 1 Score: 255.758 bits (652), Expect = 4.919e-78
Identity = 113/169 (66.86%), Postives = 136/169 (80.47%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            N  DFD + K  + F++KSYSEDD++RSIKY +WCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD  T A VW+Q KWKG+F VRW+FVKDVPN QLRHIR+E N+NKPVTNSRD  E+PLEK RQVL+IIA++K T+SI+DDF HYE+R+  E
Sbjct:  316 NPKDFDFSLKLGRVFIVKSYSEDDIHRSIKYNVWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMRSAVDYNTCAGVWSQDKWKGRFDVRWLFVKDVPNGQLRHIRLENNDNKPVTNSRDTQEVPLEKARQVLRIIASYKHTTSIFDDFSHYEKRQEEE 484          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Xenopus
Match: adk (adenosine kinase [Source:Xenbase;Acc:XB-GENE-997225])

HSP 1 Score: 254.988 bits (650), Expect = 6.986e-77
Identity = 118/172 (68.60%), Postives = 137/172 (79.65%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQ 1511
            AINN    N  DFD + KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD    A VW+Q KWKG+F V+WVFVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA FK T+SI+DDF HYE+
Sbjct:  387 AINN---YNPKDFDWSLKNGRVFIIKSYSEDDIHRSIKYTIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFDVKWVFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEK 555          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Mouse
Match: Ythdf2 (YTH N6-methyladenosine RNA binding protein 2 [Source:MGI Symbol;Acc:MGI:2444233])

HSP 1 Score: 265.388 bits (677), Expect = 7.946e-81
Identity = 121/177 (68.36%), Postives = 142/177 (80.23%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            +INN    N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PLEK +QVLKIIA++K T+SI+DDF HYE+R+  E
Sbjct:  394 SINN---YNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEE 567          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Mouse
Match: Ythdf1 (YTH N6-methyladenosine RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1917431])

HSP 1 Score: 259.61 bits (662), Expect = 8.628e-79
Identity = 113/168 (67.26%), Postives = 138/168 (82.14%), Query Frame = 3
Query: 1014 SLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRE 1517
            S N  +FD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD A+ S     P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F V+W+FVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA++K T+SI+DDF HYE+R+
Sbjct:  376 SYNPKEFDWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDGAFRSMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 543          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Mouse
Match: Ythdf1 (YTH N6-methyladenosine RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1917431])

HSP 1 Score: 259.61 bits (662), Expect = 1.446e-78
Identity = 113/168 (67.26%), Postives = 138/168 (82.14%), Query Frame = 3
Query: 1014 SLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRE 1517
            S N  +FD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD A+ S     P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F V+W+FVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA++K T+SI+DDF HYE+R+
Sbjct:  403 SYNPKEFDWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDGAFRSMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 570          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Mouse
Match: Ythdf3 (YTH N6-methyladenosine RNA binding protein 3 [Source:MGI Symbol;Acc:MGI:1918850])

HSP 1 Score: 257.684 bits (657), Expect = 7.582e-78
Identity = 118/172 (68.60%), Postives = 137/172 (79.65%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQ 1511
            AINN    N  DFD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD    A VW+Q KWKG+F V+W+FVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA FK T+SI+DDF HYE+
Sbjct:  400 AINN---YNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEK 568          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Mouse
Match: Ythdf3 (YTH N6-methyladenosine RNA binding protein 3 [Source:MGI Symbol;Acc:MGI:1918850])

HSP 1 Score: 257.299 bits (656), Expect = 1.320e-77
Identity = 118/172 (68.60%), Postives = 137/172 (79.65%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQ 1511
            AINN    N  DFD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD    A VW+Q KWKG+F V+W+FVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA FK T+SI+DDF HYE+
Sbjct:  404 AINN---YNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEK 572          
BLAST of YTH domain-containing family protein 2 vs. UniProt/SwissProt
Match: sp|Q91YT7|YTHD2_MOUSE (YTH domain-containing family protein 2 OS=Mus musculus OX=10090 GN=Ythdf2 PE=1 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 5.558e-80
Identity = 121/177 (68.36%), Postives = 142/177 (80.23%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            +INN    N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PLEK +QVLKIIA++K T+SI+DDF HYE+R+  E
Sbjct:  394 SINN---YNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEE 567          
BLAST of YTH domain-containing family protein 2 vs. UniProt/SwissProt
Match: sp|Q4R5D9|YTHD2_MACFA (YTH domain-containing family protein 2 OS=Macaca fascicularis OX=9541 GN=YTHDF2 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 6.861e-80
Identity = 121/177 (68.36%), Postives = 142/177 (80.23%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            +INN    N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PLEK +QVLKIIA++K T+SI+DDF HYE+R+  E
Sbjct:  394 SINN---YNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEE 567          
BLAST of YTH domain-containing family protein 2 vs. UniProt/SwissProt
Match: sp|Q9Y5A9|YTHD2_HUMAN (YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2)

HSP 1 Score: 265.003 bits (676), Expect = 7.081e-80
Identity = 121/177 (68.36%), Postives = 142/177 (80.23%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            +INN    N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PLEK +QVLKIIA++K T+SI+DDF HYE+R+  E
Sbjct:  394 SINN---YNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEE 567          
BLAST of YTH domain-containing family protein 2 vs. UniProt/SwissProt
Match: sp|Q0VCZ3|YTHD2_BOVIN (YTH domain-containing family protein 2 OS=Bos taurus OX=9913 GN=YTHDF2 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 7.330e-80
Identity = 121/177 (68.36%), Postives = 142/177 (80.23%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            +INN    N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S  G  P++L FSVNGSGHFCGVAEM S VD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PLEK +QVLKIIA++K T+SI+DDF HYE+R+  E
Sbjct:  395 SINN---YNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEE 568          
BLAST of YTH domain-containing family protein 2 vs. UniProt/SwissProt
Match: sp|E7F1H9|YTHD2_DANRE (YTH domain-containing family protein 2 OS=Danio rerio OX=7955 GN=ythdf2 PE=1 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 3.530e-79
Identity = 117/166 (70.48%), Postives = 137/166 (82.53%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRE 1517
            N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S     P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PL+K RQVLKIIA++K T+SI+DDF HYE+R+
Sbjct:  412 NPKDFDWNPKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSLANKGPLYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLDKARQVLKIIASYKHTTSIFDDFSHYEKRQ 577          
BLAST of YTH domain-containing family protein 2 vs. TrEMBL
Match: G9KYE5 (YTH domain family, member 1 (Fragment) OS=Mustela putorius furo OX=9669 PE=2 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 2.024e-80
Identity = 115/168 (68.45%), Postives = 139/168 (82.74%), Query Frame = 3
Query: 1014 SLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRE 1517
            S N  +FD N K+ + F+IKSYSEDDV+RSIKY IWCSTE GNRRLD A+ +AG   P++L FSVNGSGHFCG+AEM SPVD    A VWAQ KWKG+F V+W+FVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA++K T+SI+DDF HYE+R+
Sbjct:   87 SYNPKEFDWNLKSGRVFIIKSYSEDDVHRSIKYSIWCSTEHGNRRLDGAFRAAGSRAPVYLLFSVNGSGHFCGLAEMKSPVDYGASAGVWAQDKWKGKFDVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 254          
BLAST of YTH domain-containing family protein 2 vs. TrEMBL
Match: A0A293M0I9 (YTH domain protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 4.118e-80
Identity = 123/174 (70.69%), Postives = 142/174 (81.61%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSESNQ*F 1541
            N  DFD   K A++F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY  A G  P+ LFFSVNGSGHFCG+AEMVSPVD    ASVWAQ KWKGQFRVRWV+VKDVPNSQLRHIR+E NENKPVTNSRD  E+P EKGRQVLKII N++ T+SI+DDF HYE+R+  +  + F
Sbjct:  312 NPKDFDMEPKGARYFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDGAYRDAQG--PVLLFFSVNGSGHFCGMAEMVSPVDYSATASVWAQDKWKGQFRVRWVYVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPPEKGRQVLKIIHNYRHTTSIFDDFLHYEKRQEEDEQREF 483          
BLAST of YTH domain-containing family protein 2 vs. TrEMBL
Match: A0A3P9B6W4 (YTH N(6)-methyladenosine RNA binding protein 2 OS=Maylandia zebra OX=106582 PE=4 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 4.808e-80
Identity = 121/171 (70.76%), Postives = 139/171 (81.29%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSESN 1532
            N  DFD N K  + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S GG  P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PL+K RQVLKIIA +K T+SI+DDF HYE+R+  E N
Sbjct:  408 NPKDFDWNPKQGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSLGGKGPLYLLFSVNGSGHFCGVAEMRSPVDYNTSAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLDKARQVLKIIAGYKHTTSIFDDFSHYEKRQEEEEN 578          
BLAST of YTH domain-containing family protein 2 vs. TrEMBL
Match: A0A3Q2WJ57 (YTH N(6)-methyladenosine RNA binding protein 2 OS=Haplochromis burtoni OX=8153 PE=4 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 4.808e-80
Identity = 121/171 (70.76%), Postives = 139/171 (81.29%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSESN 1532
            N  DFD N K  + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S GG  P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PL+K RQVLKIIA +K T+SI+DDF HYE+R+  E N
Sbjct:  408 NPKDFDWNPKQGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSLGGKGPLYLLFSVNGSGHFCGVAEMRSPVDYNTSAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLDKARQVLKIIAGYKHTTSIFDDFSHYEKRQEEEEN 578          
BLAST of YTH domain-containing family protein 2 vs. TrEMBL
Match: A0A3B4GSU3 (YTH N(6)-methyladenosine RNA binding protein 2 OS=Pundamilia nyererei OX=303518 PE=4 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 5.480e-80
Identity = 121/171 (70.76%), Postives = 139/171 (81.29%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSESN 1532
            N  DFD N K  + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S GG  P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PL+K RQVLKIIA +K T+SI+DDF HYE+R+  E N
Sbjct:  406 NPKDFDWNPKQGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSLGGKGPLYLLFSVNGSGHFCGVAEMRSPVDYNTSAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLDKARQVLKIIAGYKHTTSIFDDFSHYEKRQEEEEN 576          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Cavefish
Match: ythdf2 (YTH N6-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:103025866])

HSP 1 Score: 269.24 bits (687), Expect = 1.472e-82
Identity = 121/169 (71.60%), Postives = 139/169 (82.25%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            N  DFD N K  + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S GG  P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PLEK RQVLKIIA++K T+SI+DDF HYE+R+  E
Sbjct:  374 NPKDFDWNPKQGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSLGGKGPLYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKARQVLKIIASYKHTTSIFDDFSHYEKRQEEE 542          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Cavefish
Match: ythdf2 (YTH N6-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:103025866])

HSP 1 Score: 269.626 bits (688), Expect = 3.096e-82
Identity = 120/166 (72.29%), Postives = 138/166 (83.13%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRE 1517
            N  DFD N K  + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S GG  P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PLEK RQVLKIIA++K T+SI+DDF HYE+R+
Sbjct:  413 NPKDFDWNPKQGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSLGGKGPLYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKARQVLKIIASYKHTTSIFDDFSHYEKRQ 578          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Cavefish
Match: ythdf2 (YTH N6-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:103025866])

HSP 1 Score: 269.626 bits (688), Expect = 3.256e-82
Identity = 120/166 (72.29%), Postives = 138/166 (83.13%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRE 1517
            N  DFD N K  + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S GG  P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PLEK RQVLKIIA++K T+SI+DDF HYE+R+
Sbjct:  412 NPKDFDWNPKQGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSLGGKGPLYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKARQVLKIIASYKHTTSIFDDFSHYEKRQ 577          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Cavefish
Match: ythdf3 (YTH N6-methyladenosine RNA binding protein 3 [Source:NCBI gene;Acc:103047574])

HSP 1 Score: 262.307 bits (669), Expect = 8.511e-80
Identity = 119/177 (67.23%), Postives = 140/177 (79.10%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            A+NN    N  DFD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S G   P++L FSVNGSGHFCGVAEM S VD    A VW+Q KWKG+F V+W+FVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA FK T+SI+DDF HYE+R+  E
Sbjct:  391 ALNN---YNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLGAKGPLYLLFSVNGSGHFCGVAEMKSTVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQEEE 564          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Cavefish
Match: ythdf3 (YTH N6-methyladenosine RNA binding protein 3 [Source:NCBI gene;Acc:103047574])

HSP 1 Score: 258.455 bits (659), Expect = 5.702e-78
Identity = 117/172 (68.02%), Postives = 137/172 (79.65%), Query Frame = 3
Query:  996 AINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQ 1511
            A+NN    N  DFD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S G   P++L FSVNGSGHFCGVAEM S VD    A VW+Q KWKG+F V+W+FVKDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA FK T+SI+DDF HYE+
Sbjct:  427 ALNN---YNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLGAKGPLYLLFSVNGSGHFCGVAEMKSTVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEK 595          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Sea Lamprey
Match: ythdf2 (YTH N(6)-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:393220])

HSP 1 Score: 269.626 bits (688), Expect = 4.424e-83
Identity = 119/173 (68.79%), Postives = 143/173 (82.66%), Query Frame = 3
Query: 1014 SLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSESN 1532
            S N  DFD + KNA+ F+IKSYSEDD++RSIKY IWCSTE GN+RLD+AY S     PI+L FSVNGSGHFCGVAEM+SPVD +T A VW+Q KWKG+F V+W++VKDVPN+QLRHIR+E NENKPVTNSRD  E+PLEK +QVLKIIA +K T+SI+DDF HYE+R+  E N
Sbjct:  410 SYNPRDFDCSPKNARVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAYRSLQSKGPIYLLFSVNGSGHFCGVAEMMSPVDYQTCAGVWSQDKWKGKFEVKWIYVKDVPNAQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIAAYKHTTSIFDDFGHYEKRQEEEDN 582          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004771.1 (pep scaffold:Pmarinus_7.0:GL488602:889:1863:1 gene:ENSPMAG00000004347.1 transcript:ENSPMAT00000004771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 252.677 bits (644), Expect = 4.034e-82
Identity = 110/163 (67.48%), Postives = 136/163 (83.44%), Query Frame = 3
Query: 1029 DFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRE 1517
            DFD + ++ + F+IKSYSEDDV+RS+KY IWCSTE GNRRLD AY +  G  P++L FSVNGSGHFCGVA+M SPVD +T A VW+Q KWKG+F V+W+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PL+K RQ L++IA F+ T+SI+DDF HYE+R+
Sbjct:    2 DFDCSPRDLRAFIIKSYSEDDVHRSVKYSIWCSTEHGNRRLDGAYRAMQGKGPVYLLFSVNGSGHFCGVAQMTSPVDYQTCAGVWSQDKWKGKFEVQWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLDKARQALRVIAAFRHTTSIFDDFAHYERRQ 164          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Sea Lamprey
Match: YTHDC2 (YTH domain containing 2 [Source:HGNC Symbol;Acc:HGNC:24721])

HSP 1 Score: 82.0333 bits (201), Expect = 1.796e-16
Identity = 45/129 (34.88%), Postives = 71/129 (55.04%), Query Frame = 3
Query: 1056 KFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQ 1442
            ++FV+KS +  ++  S +  IW +T    ++L+ A+        ++L FSV GSGHF G A MVSP+  + R   W      G FRV W+++  +P  Q++H+    N+NK V  SRD  E+  + G Q
Sbjct: 1290 RYFVMKSSNMRNLELSQQRGIWSTTPANEQKLNRAFLLCP---VVYLVFSVQGSGHFQGYARMVSPI-GQERCQEWGSPALGGVFRVLWLYLGGIPFQQVQHLLNPWNDNKRVQISRDGQELETQVGEQ 1414          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Yeast
Match: PHO92 (Posttranscriptional regulator of phosphate metabolism; facilitates PHO4 mRNA degradation by interacting with Pop2p; regulates PHO4 mRNA stability by binding to PHO4's 3'UTR in a phosphate-dependent manner; contains highly conserved YTH (YT521-B Homology) domain that exhibits RNA-binding activity; human homolog YTHDF2 can complement yeast null mutant [Source:SGD;Acc:S000002782])

HSP 1 Score: 127.102 bits (318), Expect = 3.004e-33
Identity = 68/146 (46.58%), Postives = 86/146 (58.90%), Query Frame = 3
Query: 1047 KNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWA-QGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSS 1481
            +N++FFVIKS S   V RS    IW ST  GN+RL  AY        +FLFFS+N SG FCGVAEMVS +      S+W  + K+   F+VRWV V+D+ N  L+   I +NE KP+T+SRD  EIP   G   + II  FK   S
Sbjct:  153 ENSRFFVIKSSSLKHVKRSFYNGIWSSTHFGNKRLSEAYKKLNSGAKVFLFFSINTSGRFCGVAEMVSDLKMDLDTSIWEDEQKYGKAFKVRWVIVRDINNRSLKRFLIPSNEMKPITHSRDTQEIPYSIG---ISIINLFKTQDS 295          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Nematostella
Match: EDO40126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S845])

HSP 1 Score: 216.853 bits (551), Expect = 5.910e-68
Identity = 97/158 (61.39%), Postives = 125/158 (79.11%), Query Frame = 3
Query: 1053 AKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            A+FF+IKSYSEDD++RSIKY +W STE GNRRL+ A+       PI+LFFSVNGSGHFCG+A+M+S V+      +W+Q KWKG+F V+W +VKDVPN+ LRHIR+E N+NKPVTNSRD  E+P EK RQV+KII ++K  +SI+DDF HYE+R+  E
Sbjct:    5 ARFFIIKSYSEDDIHRSIKYCVWTSTEHGNRRLNEAFREQRHG-PIYLFFSVNGSGHFCGIAQMMSEVNLDIETGIWSQDKWKGKFEVKWYYVKDVPNNALRHIRLENNDNKPVTNSRDTQEVPPEKARQVVKIIHSYKHQTSIFDDFAHYEKRQDEE 161          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Nematostella
Match: EDO40330 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7H4])

HSP 1 Score: 73.1738 bits (178), Expect = 1.817e-13
Identity = 42/137 (30.66%), Postives = 73/137 (53.28%), Query Frame = 3
Query: 1044 FKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKI 1454
            F +A+FF++K  ++ ++  S+   IW +T    ++L+ A+  +     + L FSV GSGHF GVA M SP+  + ++  +      G F V W+   ++P  Q  H+    N++K V  SRD  E+    G ++ K+
Sbjct: 1269 FLSARFFIMKCNNQRNLDISMAKGIWATTIANEKKLNRAFKESKK---VVLIFSVQGSGHFQGVAHMTSPI-GREKSPEFGSSSLGGVFTVEWITKANIPFQQAHHLVNPWNDHKKVQISRDGQELEPSIGAELCKL 1401          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Nematostella
Match: EDO39495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9W8])

HSP 1 Score: 48.521 bits (114), Expect = 6.468e-7
Identity = 35/139 (25.18%), Postives = 62/139 (44.60%), Query Frame = 3
Query: 1056 KFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWA------QGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKI 1454
            ++FV+KS + ++V  S    +W +  T  ++L+ A+        + L FSV  SG F G A ++           W            G F++ W+   D+  S+  H+R   N+NK V   RD  E+    G ++ ++
Sbjct:    1 RYFVMKSNNAENVLLSKAKGVWSTPRTNEKKLNAAFKRYKN---VILIFSVKESGKFQGFARLLGEAKHGEHFVPWVLPPGMNAKALGGVFKLEWLNRHDLWFSKCIHLRNPWNDNKEVKICRDGQEVEPGVGEELCRL 136          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Medaka
Match: ythdf2 (YTH N6-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:101163288])

HSP 1 Score: 271.937 bits (694), Expect = 6.504e-83
Identity = 119/166 (71.69%), Postives = 138/166 (83.13%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRE 1517
            N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD AY S GG  P++L FSVNGSGHFCGVAEM SPVD  T A VW+Q KWKG+F VRW+FVKDVPNSQLRHIR+E NENKPVTNSRD  E+PL+K RQVLKIIA +K T+SI+DDF HYE+R+
Sbjct:  434 NPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDGAYRSLGGKGPLYLLFSVNGSGHFCGVAEMRSPVDYNTSAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLDKARQVLKIIAGYKHTTSIFDDFTHYEKRQ 599          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Medaka
Match: YTHDF1 (YTH domain-containing family protein 1-like [Source:NCBI gene;Acc:101163899])

HSP 1 Score: 264.618 bits (675), Expect = 3.024e-80
Identity = 117/168 (69.64%), Postives = 138/168 (82.14%), Query Frame = 3
Query: 1014 SLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRE 1517
            S N  DFD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD+A+ +  G  P++L FSVNGSGHFCGVAEM SPVD  T A VWAQ KWKG+F V W+FVKDVPNSQLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA +K T+SI+DDF HYE+R+
Sbjct:  414 SYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRAMNGKGPVYLLFSVNGSGHFCGVAEMRSPVDYGTSAGVWAQDKWKGKFDVDWLFVKDVPNSQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATYKHTTSIFDDFSHYEKRQ 581          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Medaka
Match: ythdf3 (YTH N6-methyladenosine RNA binding protein 3 [Source:NCBI gene;Acc:101158487])

HSP 1 Score: 263.462 bits (672), Expect = 5.563e-80
Identity = 115/169 (68.05%), Postives = 138/169 (81.66%), Query Frame = 3
Query: 1020 NTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSE 1526
            N  DFD N K+ + F+IKSYSEDD++RSIKY IWCSTE GN+RLD+AY S G   P++L FSVNGSGHFCGVAEM SPVD    A VW+Q KWKG+F V+WVF+KDVPN+QLRHIR+E N+NKPVTNSRD  E+PLEK +QVLK+IA FK T+SI+DDF HYE+R+  E
Sbjct:  422 NPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAYRSLGNKGPLYLLFSVNGSGHFCGVAEMRSPVDYNAYAGVWSQDKWKGKFEVKWVFIKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKVIATFKHTTSIFDDFAHYEKRQEEE 590          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Medaka
Match: YTHDF1 (YTH domain-containing family protein 1-like [Source:NCBI gene;Acc:101163899])

HSP 1 Score: 258.455 bits (659), Expect = 1.598e-78
Identity = 115/164 (70.12%), Postives = 134/164 (81.71%), Query Frame = 3
Query: 1014 SLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHY 1505
            S N  DFD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD+A+ +  G  P++L FSVNGSGHFCGVAEM SPVD  T A VWAQ KWKG+F V W+FVKDVPNSQLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA +K T+SI+DDF HY
Sbjct:  373 SYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRAMNGKGPVYLLFSVNGSGHFCGVAEMRSPVDYGTSAGVWAQDKWKGKFDVDWLFVKDVPNSQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATYKHTTSIFDDFSHY 536          
BLAST of YTH domain-containing family protein 2 vs. Ensembl Medaka
Match: ythdf1 (YTH domain-containing family protein 1 [Source:NCBI gene;Acc:101169361])

HSP 1 Score: 256.914 bits (655), Expect = 1.965e-77
Identity = 114/164 (69.51%), Postives = 132/164 (80.49%), Query Frame = 3
Query: 1014 SLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHY 1505
            S N  DFD N KN + F+IKSYSEDD++RSIKY IWCSTE GN+RLD A+ +     P++L FSVNGSGHFCGVAEM SPVD  T A VWAQ KWKG+F V W+FVKDVPNSQLRHIR+E N+NKPVTNSRD  E+PLEK +QVLKIIA +K T+SI+DDF HY
Sbjct:  416 SYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDTAFRAMNSKGPVYLLFSVNGSGHFCGVAEMRSPVDYSTSAGVWAQDKWKGKFDVNWLFVKDVPNSQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIAQYKHTTSIFDDFSHY 579          
BLAST of YTH domain-containing family protein 2 vs. Planmine SMEST
Match: SMESG000008619.1 (SMESG000008619.1)

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 461/461 (100.00%), Postives = 461/461 (100.00%), Query Frame = 3
Query:  153 MHWSNNCSNPFSYGYNSTIESRLDCPNYNTFNDQYYYHQGNNSKSLSPINSKFDNSLNSAYSRFSNFQSSPNQIKMWTELDPHTKAAAEASWGIVFPMQVQTSANNKLQWSCDIMNSNKNINSSDREKGVSSDKYKANNGLYSANDFMIPQTNMKSYLNGFNHSSKGLRTNSQIKSFESNIESYPHLTATSVNSLNIETLEQTLSNVNLADXXXXXXXXXXXXQAPSPSKKTWALIVGKQDKSSNLTFSNLPNFSLRQNNKPELKFDXXXXXXXXXXXXQIAINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSESNQ 1535
            MHWSNNCSNPFSYGYNSTIESRLDCPNYNTFNDQYYYHQGNNSKSLSPINSKFDNSLNSAYSRFSNFQSSPNQIKMWTELDPHTKAAAEASWGIVFPMQVQTSANNKLQWSCDIMNSNKNINSSDREKGVSSDKYKANNGLYSANDFMIPQTNMKSYLNGFNHSSKGLRTNSQIKSFESNIESYPHLTATSVNSLNIETLEQTLSNVNLADNHFNTFNNISNNQAPSPSKKTWALIVGKQDKSSNLTFSNLPNFSLRQNNKPELKFDSKSKTNENNNSSQIAINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSESNQ
Sbjct:    1 MHWSNNCSNPFSYGYNSTIESRLDCPNYNTFNDQYYYHQGNNSKSLSPINSKFDNSLNSAYSRFSNFQSSPNQIKMWTELDPHTKAAAEASWGIVFPMQVQTSANNKLQWSCDIMNSNKNINSSDREKGVSSDKYKANNGLYSANDFMIPQTNMKSYLNGFNHSSKGLRTNSQIKSFESNIESYPHLTATSVNSLNIETLEQTLSNVNLADNHFNTFNNISNNQAPSPSKKTWALIVGKQDKSSNLTFSNLPNFSLRQNNKPELKFDSKSKTNENNNSSQIAINNKMSLNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSESNQ 461          
BLAST of YTH domain-containing family protein 2 vs. Planmine SMEST
Match: SMESG000039495.1 (SMESG000039495.1)

HSP 1 Score: 206.453 bits (524), Expect = 2.207e-58
Identity = 102/191 (53.40%), Postives = 130/191 (68.06%), Query Frame = 3
Query: 1017 LNTCDFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSA---GGDMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETN----------ENKPVTNSRDVTEIPLEK----------GRQVLKIIANFKATSSIYDDFDHYEQREL 1520
            +N   F+ NF+ A++FVIKSYSEDDV+RSIKY+IWCST+ GN+RL+ A+ +A   GG   I LFFSVNGSGHFCG+AEM S VD      VW Q KW+G+F V+W+FVKDVPN+QLRHI  + N          E KP+TN RD TE+  E+          G Q L+II + K+  SI+DD+ HYE+REL
Sbjct:  473 INPKRFEINFEKARYFVIKSYSEDDVHRSIKYKIWCSTKEGNKRLNEAFQNAQKIGGH--ILLFFSVNGSGHFCGMAEMTSCVDEGVLTKVWCQDKWRGKFSVKWIFVKDVPNTQLRHISTKVNTPKPNSEFMTEIKPITNLRDATELKSERTSGSSYKDDPGYQALRIIMDCKSNMSIFDDYLHYEKREL 661          
BLAST of YTH domain-containing family protein 2 vs. Planmine SMEST
Match: SMESG000001953.1 (SMESG000001953.1)

HSP 1 Score: 201.445 bits (511), Expect = 6.465e-58
Identity = 92/168 (54.76%), Postives = 124/168 (73.81%), Query Frame = 3
Query: 1041 NFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYS-----SAGGDMP--IFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEI-PLEKGRQVLKIIANFKATSSIYDDFDHYEQREL 1520
            N   A+FFVIKSYSEDD++R+IKY +WCST+TGN +LD+AY      S+    P  +FLFFSVNGSG F G+AEM+S V+++     W+Q KW G+F+++W +VKDV NS LRHIR E NENKPVTNSRD  E+ P E G + +K+  + K  +S++DDF+HYE+RE+
Sbjct:  315 NVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERREM 482          
BLAST of YTH domain-containing family protein 2 vs. Planmine SMEST
Match: SMESG000075874.1 (SMESG000075874.1)

HSP 1 Score: 191.045 bits (484), Expect = 2.756e-55
Identity = 93/170 (54.71%), Postives = 119/170 (70.00%), Query Frame = 3
Query: 1029 DFDTNFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGG-DMPIFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEI-PLEKGRQVLKIIANFKATSSIYDDFDHYEQRELSESN 1532
            DF  +   +KF+VIKSY+ED V+RSIKY  WCST+ GN  L+ AY+S    +  ++LFFSVNGSG+FCGVAEM S  D+  R + W   KW G F V W++VKDVPN  L+HI +E N+N+P+TNSRD TEI P  KG + L+II  +   SS++DDFD YE RE  ESN
Sbjct:  195 DFSLDVNKSKFYVIKSYTEDHVHRSIKYGQWCSTQRGNDILNTAYNSVKSQNGHVYLFFSVNGSGYFCGVAEMTSQFDTNNRVAHWNDDKWLGGFSVEWLYVKDVPNKYLKHIILEYNDNRPITNSRDATEIKPPTKGYETLRIIHEYHHNSSLFDDFDFYESRE-RESN 363          
BLAST of YTH domain-containing family protein 2 vs. Planmine SMEST
Match: SMESG000003195.1 (SMESG000003195.1)

HSP 1 Score: 177.948 bits (450), Expect = 1.310e-49
Identity = 83/160 (51.88%), Postives = 114/160 (71.25%), Query Frame = 3
Query: 1050 NAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGG-DMP--------IFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEI-PLEKGRQVLKIIANFKATSSIYDDFD 1499
            N++FFVIKS++ED++Y+SI++ +WCST  GN  L  AY      + P        ++LFFSVNGSG+FCGVAEM S +   + +S+W Q KW+ QF V W+++KDVPNS LR I++E+NEN+PVTN RD TEI PLEKG +VLKII N    + + +DF+
Sbjct:  273 NSRFFVIKSFTEDNIYQSIRHGVWCSTPVGNDALVQAYKHVKSREKPNDETTKAHVYLFFSVNGSGYFCGVAEMTSELHPPSSSSIWNQKKWQNQFSVDWLYIKDVPNSYLRQIKLESNENRPVTNCRDSTEILPLEKGIEVLKIIHNIHYDTCLLNDFN 432          
The following BLAST results are available for this feature:
BLAST of YTH domain-containing family protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YTHDF27.021e-8168.36YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
YTHDF21.475e-8068.36YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
YTHDF21.475e-8068.36YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
YTHDF36.693e-7868.60YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
YTHDF36.693e-7868.60YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
back to top
BLAST of YTH domain-containing family protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of YTH domain-containing family protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ythdf4.554e-6460.25gene:FBgn0039261 transcript:FBtr0084795[more]
Ythdf5.257e-6460.25gene:FBgn0039261 transcript:FBtr0113281[more]
Ythdf5.674e-6460.25gene:FBgn0039261 transcript:FBtr0084794[more]
Ythdf5.674e-6460.25gene:FBgn0039261 transcript:FBtr0334507[more]
Ythdc13.049e-927.78gene:FBgn0027616 transcript:FBtr0073079[more]
back to top
BLAST of YTH domain-containing family protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ythdf14.399e-8068.42YTH N(6)-methyladenosine RNA binding protein 1 [So... [more]
ythdf14.399e-8068.42YTH N(6)-methyladenosine RNA binding protein 1 [So... [more]
ythdf24.676e-8070.48YTH N(6)-methyladenosine RNA binding protein 2 [So... [more]
ythdf27.644e-8070.48YTH N(6)-methyladenosine RNA binding protein 2 [So... [more]
BX649452.11.477e-7766.10pep chromosome:GRCz11:CHR_ALT_CTG24_1_13:24286156:... [more]
back to top
BLAST of YTH domain-containing family protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ythdf17.881e-8068.45YTH N(6)-methyladenosine RNA binding protein 1 [So... [more]
ythdf11.760e-7967.84YTH N(6)-methyladenosine RNA binding protein 1 [So... [more]
adk4.808e-7867.80adenosine kinase [Source:Xenbase;Acc:XB-GENE-99722... [more]
lmo74.919e-7866.86LIM domain 7 protein [Source:Xenbase;Acc:XB-GENE-9... [more]
adk6.986e-7768.60adenosine kinase [Source:Xenbase;Acc:XB-GENE-99722... [more]
back to top
BLAST of YTH domain-containing family protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ythdf27.946e-8168.36YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
Ythdf18.628e-7967.26YTH N6-methyladenosine RNA binding protein 1 [Sour... [more]
Ythdf11.446e-7867.26YTH N6-methyladenosine RNA binding protein 1 [Sour... [more]
Ythdf37.582e-7868.60YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
Ythdf31.320e-7768.60YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
back to top
BLAST of YTH domain-containing family protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91YT7|YTHD2_MOUSE5.558e-8068.36YTH domain-containing family protein 2 OS=Mus musc... [more]
sp|Q4R5D9|YTHD2_MACFA6.861e-8068.36YTH domain-containing family protein 2 OS=Macaca f... [more]
sp|Q9Y5A9|YTHD2_HUMAN7.081e-8068.36YTH domain-containing family protein 2 OS=Homo sap... [more]
sp|Q0VCZ3|YTHD2_BOVIN7.330e-8068.36YTH domain-containing family protein 2 OS=Bos taur... [more]
sp|E7F1H9|YTHD2_DANRE3.530e-7970.48YTH domain-containing family protein 2 OS=Danio re... [more]
back to top
BLAST of YTH domain-containing family protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G9KYE52.024e-8068.45YTH domain family, member 1 (Fragment) OS=Mustela ... [more]
A0A293M0I94.118e-8070.69YTH domain protein (Fragment) OS=Ornithodoros erra... [more]
A0A3P9B6W44.808e-8070.76YTH N(6)-methyladenosine RNA binding protein 2 OS=... [more]
A0A3Q2WJ574.808e-8070.76YTH N(6)-methyladenosine RNA binding protein 2 OS=... [more]
A0A3B4GSU35.480e-8070.76YTH N(6)-methyladenosine RNA binding protein 2 OS=... [more]
back to top
BLAST of YTH domain-containing family protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ythdf21.472e-8271.60YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
ythdf23.096e-8272.29YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
ythdf23.256e-8272.29YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
ythdf38.511e-8067.23YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
ythdf35.702e-7868.02YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
back to top
BLAST of YTH domain-containing family protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ythdf24.424e-8368.79YTH N(6)-methyladenosine RNA binding protein 2 [So... [more]
ENSPMAT00000004771.14.034e-8267.48pep scaffold:Pmarinus_7.0:GL488602:889:1863:1 gene... [more]
YTHDC21.796e-1634.88YTH domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of YTH domain-containing family protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO923.004e-3346.58Posttranscriptional regulator of phosphate metabol... [more]
back to top
BLAST of YTH domain-containing family protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO401265.910e-6861.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403301.817e-1330.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394956.468e-725.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of YTH domain-containing family protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ythdf26.504e-8371.69YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
YTHDF13.024e-8069.64YTH domain-containing family protein 1-like [Sourc... [more]
ythdf35.563e-8068.05YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
YTHDF11.598e-7870.12YTH domain-containing family protein 1-like [Sourc... [more]
ythdf11.965e-7769.51YTH domain-containing family protein 1 [Source:NCB... [more]
back to top
BLAST of YTH domain-containing family protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008619.10.000e+0100.00SMESG000008619.1[more]
SMESG000039495.12.207e-5853.40SMESG000039495.1[more]
SMESG000001953.16.465e-5854.76SMESG000001953.1[more]
SMESG000075874.12.756e-5554.71SMESG000075874.1[more]
SMESG000003195.11.310e-4951.88SMESG000003195.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007379 ID=SMED30007379|Name=YTH domain-containing family protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1694bp
ACTGTTTTGCAAATTTTTCATGTCTGACATTAAAAAATTTAATTTATTAC
ATAATAATCTAAATTTATTAAGATAATTCTGCATATCATAATTCTCTCAA
TTCTTCAAATCCATTTTGTGAATCAGGAATAATAAATAACAAAAAGTGGT
CAATGCATTGGTCAAATAATTGTTCAAATCCATTTTCTTATGGTTATAAC
TCAACTATAGAATCTAGATTAGATTGCCCTAATTATAATACGTTTAATGA
TCAGTATTATTACCACCAAGGAAATAACTCCAAGTCATTATCACCAATCA
ATTCAAAATTTGATAATTCACTAAATTCAGCTTATAGTCGTTTCTCTAAT
TTTCAATCATCCCCGAATCAAATTAAAATGTGGACAGAATTAGATCCTCA
TACTAAAGCAGCAGCTGAAGCTTCGTGGGGAATTGTATTTCCTATGCAAG
TGCAAACTAGTGCGAATAATAAACTTCAGTGGTCATGTGATATTATGAAT
TCTAATAAAAATATTAACTCTTCTGATAGAGAGAAAGGTGTGTCATCTGA
TAAATATAAAGCAAATAATGGTCTTTATTCTGCAAATGATTTTATGATTC
CACAAACTAATATGAAATCTTACTTAAATGGATTTAATCATTCATCAAAA
GGTCTAAGAACAAATAGCCAAATTAAATCATTCGAAAGTAACATCGAATC
TTATCCTCATTTAACAGCGACATCTGTGAATTCCCTCAATATTGAAACTC
TAGAACAAACTTTATCAAATGTCAATTTAGCTGACAACCATTTTAACACA
TTCAATAATATCTCAAACAATCAAGCTCCATCTCCATCTAAGAAAACCTG
GGCTCTTATTGTAGGAAAGCAAGACAAATCATCAAATTTAACGTTTTCTA
ATTTACCGAATTTCTCGTTACGACAAAACAATAAACCGGAATTGAAATTT
GATTCGAAATCGAAAACTAATGAGAATAACAATTCCTCTCAAATCGCAAT
CAACAACAAAATGAGTCTAAATACTTGCGATTTTGACACAAATTTTAAGA
ATGCTAAATTTTTTGTGATTAAATCGTATTCTGAAGACGATGTATATCGA
TCGATCAAATATCAGATCTGGTGTTCCACTGAAACCGGAAACAGGCGTCT
CGATAATGCCTACTCGAGTGCCGGAGGAGATATGCCGATATTTTTGTTTT
TCTCAGTCAACGGTAGTGGCCATTTCTGTGGCGTAGCGGAAATGGTGAGT
CCTGTTGACTCTAAAACAAGAGCCAGCGTTTGGGCTCAAGGCAAGTGGAA
GGGACAATTTCGTGTCAGGTGGGTCTTTGTAAAGGATGTTCCGAATTCAC
AATTGAGACACATTCGAATCGAAACCAACGAAAACAAACCCGTAACAAAT
TCTCGAGATGTCACTGAAATACCATTGGAAAAAGGCCGACAAGTACTGAA
AATAATTGCAAATTTCAAAGCTACTTCTTCAATTTACGATGATTTTGATC
ACTATGAACAACGAGAATTATCGGAATCAAATCAATAATTTCTGAAAATT
GTATAAATTGAATATAGTCGTTAATTTATCCCGGCTGTTAATATTGATTT
GATTATTCTGAAACTGACTGGAGTACTATTTATTGATTTTCAGTTTTTCG
TGGAAATCATGCACTAATTATACTATTATTATTAATATTATTAT
back to top

protein sequence of SMED30007379-orf-1

>SMED30007379-orf-1 ID=SMED30007379-orf-1|Name=SMED30007379-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=462bp
MHWSNNCSNPFSYGYNSTIESRLDCPNYNTFNDQYYYHQGNNSKSLSPIN
SKFDNSLNSAYSRFSNFQSSPNQIKMWTELDPHTKAAAEASWGIVFPMQV
QTSANNKLQWSCDIMNSNKNINSSDREKGVSSDKYKANNGLYSANDFMIP
QTNMKSYLNGFNHSSKGLRTNSQIKSFESNIESYPHLTATSVNSLNIETL
EQTLSNVNLADNHFNTFNNISNNQAPSPSKKTWALIVGKQDKSSNLTFSN
LPNFSLRQNNKPELKFDSKSKTNENNNSSQIAINNKMSLNTCDFDTNFKN
AKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYSSAGGDMPIFLFF
SVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQ
LRHIRIETNENKPVTNSRDVTEIPLEKGRQVLKIIANFKATSSIYDDFDH
YEQRELSESNQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR007275YTH_domain
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:1990247N6-methyladenosine-containing RNA binding
Vocabulary: cellular component
TermDefinition
GO:0000932P-body
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0043488regulation of mRNA stability
GO:1903679positive regulation of cap-independent translational initiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.590.10coord: 276..450
e-value: 2.2E-66
score: 224.3
NoneNo IPR availablePANTHERPTHR12357YTH YT521-B HOMOLOGY DOMAIN-CONTAININGcoord: 11..456
NoneNo IPR availablePANTHERPTHR12357:SF15METHYLATED RNA-BINDING PROTEIN 1coord: 11..456
IPR007275YTH domainPFAMPF04146YTHcoord: 302..435
e-value: 1.6E-40
score: 138.7
IPR007275YTH domainPROSITEPS50882YTHcoord: 301..435
score: 46.794