nuclear mitotic apparatus protein 1 isoform X2

Overview
Namenuclear mitotic apparatus protein 1 isoform X2
Smed IDSMED30007371
Length (bp)3059
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nuclear mitotic apparatus protein 1 isoform X2 (SMED30007371) t-SNE clustered cells

Violin plots show distribution of expression levels for nuclear mitotic apparatus protein 1 isoform X2 (SMED30007371) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nuclear mitotic apparatus protein 1 isoform X2 (SMED30007371) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nuclear mitotic apparatus protein 1 isoform X2 (SMED30007371) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007371

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007371SMESG000071994.1 SmedASXL_017575SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30007371SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007371SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007371SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30007371SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30007371SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007371SMESG000071994.1 dd_Smed_v6_10823_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007371SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30007371SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. TrEMBL
Match: A0A1S3K4N9 (nuclear mitotic apparatus protein 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106178794 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 6.997e-40
Identity = 128/396 (32.32%), Postives = 211/396 (53.28%), Query Frame = 3
Query:   60 LDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQS-------ELAQSQMKLDQ--TKTLDAAQRANAEEIALEFQDKY-------KNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNEN 1199
            LD  D  +  V++KNA + +QR A + KEEL KV+ RV++IYG +E                + E          +E + D+  LE LL     ++KY QQVT+F+VGY  ++  RL+L+Q+VN+FF+ + + FD           EE L +   +   ++ D          E+A  +  ++ +  +LT R+ DLN EM++    YAQ KAGNKGRKK+EKAL  A  + + L+EKL  +   + EK+ ++  L KQ E K+ E  ++K AAE  K+ A  +E L+E+L  K A++ +L+        E AQ+    ++  T+ ++AAQ   +++I  E Q          ++L+++ E Q  +  +  +  I+   LK+QHE E+++L A+ E 
Sbjct:   31 LDRGDSPAQLVLDKNARSFAQRMADDTKEELEKVMKRVDHIYGTYE----------------YGEALMEGAGKNNMEYLSDIMELEELLRDTVKKRKYQQQVTIFVVGYKNVSDQRLKLLQQVNEFFIENSSTFD-----------EEDLRKGSPD---IDLD----------EVAVKITDSLNTAAELTQRISDLNKEMVEYLTNYAQAKAGNKGRKKLEKALNMAKEDIVTLSEKLMAAQTDLEEKEDKMQQLFKQIEIKTMEATRYKTAAEVAKRNAAGTEALQEELGKKNAELEELKKLVKDMEFEAAQNAYAKEKSDTRLMEAAQANKSDQIQEEIQKAQLSADATKRDLQQLYEKQISDLVKYHQEEIDQ--LKKQHEAEIRKLTAELEG 384          

HSP 2 Score: 87.4261 bits (215), Expect = 1.720e-13
Identity = 87/328 (26.52%), Postives = 155/328 (47.26%), Query Frame = 2
Query: 2135 LDEEKDIMFPEEIDSDKSTRSVAISASPTLVRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLI----------------KALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLE-----IRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERI 3055
            +DE+ D+ FPE++   K+T  V  S      +  + L  HP+V +Y+ +Y+ I+ FK+    +L  L+K  L+    L E+  V      ++ PQIE++ K++  + +    +L  I++      +     V S L+ ++     P+   T+ R   SL+   R  +  I                + L+Q Y    NL      K +    V H Q V    + D   I+ LE     +R  +  + P    Q+   L++   +++FTR DS+RN   +++A+ ++     LYK+AV++M  YV +PA++L  LVRK++H   M+ I
Sbjct: 1166 VDEDGDMPFPEDV---KTTLDVGTSPMSLHTKRHMALADHPIVNEYMKTYNGIVKFKDDVAQVL--LNKEMLQASQMLSEIEGVLFDRGEKVIPQIEKMTKNVYTLFEEITSLLSSIII------NDRGPVVSSILNVSRD----PTRTMTRERSSESLRGATRDSQRTIGTKMTPTSADSGNRRIQELEQQYDHLQNLFQDETKKHQD--EVNHNQVV-MMGMQD--TIKELEKELSGLRKSLAQS-PG---QYSTQLEHPDSAVMFTRLDSDRNSRAMKSAVNDSKLSPDLYKDAVDQMQAYVSLPAQRLAHLVRKFVHHCRMKEI 1469          

HSP 3 Score: 87.4261 bits (215), Expect = 1.749e-13
Identity = 49/146 (33.56%), Postives = 85/146 (58.22%), Query Frame = 3
Query: 1365 KKSTSNSGSPSRFGSGKNGSRQPTTSGRSSG------KDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIV 1784
            KKS + S   SR  + + G  + T+  R+        +  + F DAPDL NEE WS++P   L GRF QYRQL+   +  + +Q      K+ +++ +LK+Q Q+H+  W++ER +L++ V   ++ + +A+K AD AM ++E+ +
Sbjct:  531 KKSGAKSRQTSRTDTREEGEAEETSQSRAKSTLEPVQEVTVEFEDAPDLRNEEAWSNIPVQQLPGRFLQYRQLTKKKLDEIEEQMRVNTVKTQKKVNTLKAQFQEHKSKWEQERNILVQQVDQAQRLQTEAEKEADSAMTQLEDFI 676          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. TrEMBL
Match: A0A1S3K513 (uncharacterized protein LOC106178794 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106178794 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.610e-38
Identity = 128/410 (31.22%), Postives = 212/410 (51.71%), Query Frame = 3
Query:   60 LDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQS-------ELAQSQMKLDQ--TKTLDAAQRANAEEI---------------------ALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNEN 1199
            LD  D  +  V++KNA + +QR A + KEEL KV+ RV++IYG +E                + E          +E + D+  LE LL     ++KY QQVT+F+VGY  ++  RL+L+Q+VN+FF+ + + FD           EE L +   +   ++ D          E+A  +  ++ +  +LT R+ DLN EM++    YAQ KAGNKGRKK+EKAL  A  + + L+EKL  +   + EK+ ++  L KQ E K+ E  ++K AAE  K+ A  +E L+E+L  K A++ +L+        E AQ+    ++  T+ ++AAQ   +++I                      LE++    +L+++ E Q  +  +  +  I+   LK+QHE E+++L A+ E 
Sbjct:   31 LDRGDSPAQLVLDKNARSFAQRMADDTKEELEKVMKRVDHIYGTYE----------------YGEALMEGAGKNNMEYLSDIMELEELLRDTVKKRKYQQQVTIFVVGYKNVSDQRLKLLQQVNEFFIENSSTFD-----------EEDLRKGSPD---IDLD----------EVAVKITDSLNTAAELTQRISDLNKEMVEYLTNYAQAKAGNKGRKKLEKALNMAKEDIVTLSEKLMAAQTDLEEKEDKMQQLFKQIEIKTMEATRYKTAAEVAKRNAAGTEALQEELGKKNAELEELKKLVKDMEFEAAQNAYAKEKSDTRLMEAAQANKSDQIQEEIQKAQLSADATKREETAVVLEWKISKPDLQQLYEKQISDLVKYHQEEIDQ--LKKQHEAEIRKLTAELEG 398          

HSP 2 Score: 87.4261 bits (215), Expect = 1.556e-13
Identity = 49/146 (33.56%), Postives = 85/146 (58.22%), Query Frame = 3
Query: 1365 KKSTSNSGSPSRFGSGKNGSRQPTTSGRSSG------KDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIV 1784
            KKS + S   SR  + + G  + T+  R+        +  + F DAPDL NEE WS++P   L GRF QYRQL+   +  + +Q      K+ +++ +LK+Q Q+H+  W++ER +L++ V   ++ + +A+K AD AM ++E+ +
Sbjct:  545 KKSGAKSRQTSRTDTREEGEAEETSQSRAKSTLEPVQEVTVEFEDAPDLRNEEAWSNIPVQQLPGRFLQYRQLTKKKLDEIEEQMRVNTVKTQKKVNTLKAQFQEHKSKWEQERNILVQQVDQAQRLQTEAEKEADSAMTQLEDFI 690          

HSP 3 Score: 87.4261 bits (215), Expect = 1.638e-13
Identity = 87/328 (26.52%), Postives = 155/328 (47.26%), Query Frame = 2
Query: 2135 LDEEKDIMFPEEIDSDKSTRSVAISASPTLVRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLI----------------KALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLE-----IRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERI 3055
            +DE+ D+ FPE++   K+T  V  S      +  + L  HP+V +Y+ +Y+ I+ FK+    +L  L+K  L+    L E+  V      ++ PQIE++ K++  + +    +L  I++      +     V S L+ ++     P+   T+ R   SL+   R  +  I                + L+Q Y    NL      K +    V H Q V    + D   I+ LE     +R  +  + P    Q+   L++   +++FTR DS+RN   +++A+ ++     LYK+AV++M  YV +PA++L  LVRK++H   M+ I
Sbjct: 1180 VDEDGDMPFPEDV---KTTLDVGTSPMSLHTKRHMALADHPIVNEYMKTYNGIVKFKDDVAQVL--LNKEMLQASQMLSEIEGVLFDRGEKVIPQIEKMTKNVYTLFEEITSLLSSIII------NDRGPVVSSILNVSRD----PTRTMTRERSSESLRGATRDSQRTIGTKMTPTSADSGNRRIQELEQQYDHLQNLFQDETKKHQD--EVNHNQVV-MMGMQD--TIKELEKELSGLRKSLAQS-PG---QYSTQLEHPDSAVMFTRLDSDRNSRAMKSAVNDSKLSPDLYKDAVDQMQAYVSLPAQRLAHLVRKFVHHCRMKEI 1483          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. TrEMBL
Match: A0A267H9Y6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000311g9 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 2.470e-38
Identity = 173/655 (26.41%), Postives = 302/655 (46.11%), Query Frame = 3
Query:   39 LNQMYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMES-------EKLKEQLSAKEAQI----LQLQSELAQSQMKL----DQTKTLDA------AQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLKSSEFDENAIALHWSEPEDDDNKPXXXXXXXXXXNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLK-------VDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKT-NDLLK 1916
            L  + ++LD +D  +  V+++NA     R A ER++EL +VL RV+NI   FE    +G                 NG +++V+ V  +  LE ++   Q+++KYL  VT+F+VGY      RL L+++V++F + +E +FD                          SD   DE     EL  +V+  I S  +L +RLGDL+  +++  A +  +K   K +KK+EK LE    +  +L++KL      + ++D +   + +Q E K+ E+ K +AA E  K AA +        ++  E++ A +A +    L+   E+ + +M++    DQT  L A      AQ  +A       Q++ + L    E++    +   R  I +   K++HE E  +LQ   +  F                SEFDEN   +    P+DD+                                     SR PT       +DV+ F      D++  W +VPRSH  GRF QYR L+ A ++   +Q ++   ++ R+I  LKS+  + +  WD ER+ L  +V+  E++ +DA++ A+LA+ ++E +    K        D ++     G++  + D+T+L  +V++++  L+  N LLK
Sbjct:    5 LASLSAELDYVDQAARDVLDRNAREAHDRMANERRDELNRVLRRVDNICSNFENYEAYG-----------------NGKTSVVQFVSGLAELEKIVSDPQAKKKYLDDVTIFVVGYENKCNSRLHLIEQVSEFLLENEALFD--------------------------SDLNSDEPVNFEELNASVESTIASVGELNSRLGDLHRGVVEGLAAHYNSKGAQKQKKKLEKELEALRKDFGELSDKLVHLNSELQDRDLKAQQMARQIENKNAELHKLRAAVEINKAAAAQLAELQAEHDRRGEEIEAVKADLERLKLETGEEMHRDKMEIELLRDQTGKLQAEIDDLKAQLNDAHAQYRAAQNELEELRLNNESRLASMKAKYRRQIAS--AKKRHEDESAKLQRRIKEEFYGPDNRSFSAASSRAESEFDENKQTIFV--PDDDERV-----------------------------------SRMPTE------EDVMEFDTEIAFDDDSAWDAVPRSHRRGRFTQYRNLARAKLAQEAEQSKQ---RADRKILQLKSRFNEFKAQWDEERQGLELSVQEAERETEDAKRKAELAVRKLEELYERFKDTQSLSTADSSELHSRIGQL--QVDKTQLETRVEELEHELRVINQLLK 566          

HSP 2 Score: 88.1965 bits (217), Expect = 9.121e-14
Identity = 84/326 (25.77%), Postives = 148/326 (45.40%), Query Frame = 2
Query: 2138 DEEK---DIMFPEEIDSDKSTRSVAISASPTLVRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLN-LKELSPVSIR--SQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIP-SEKTTKVREMRSLQ--EDCRQMKLLIKALQQSYQSKFNL-----------LNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERI 3055
            DEE    DI FP++   D           P     GL L  HP+V +++ +Y+ I+  K +   +L E D    +EV N L  L   +++   ++RITPQIE++G+++  +      ++E+++L    IE+   ++ +S   PT      P ++  TK +E   ++  E+ +   L +  L Q  ++KF             L QS+ +L+  LS        R     +V +QN                           S++FT+ D+ERN   ++ A+      E  Y+ AVE M +Y  +PA++L  + R+ LHR  +E++
Sbjct:  609 DEEGSSVDIPFPDDAGGD----------GP-----GLHLADHPIVGEFIRTYNHIMKSKTRLSELLSENDSY--KEVANNLANLGQEALKLDRESRITPQIEDLGRNLTFVSDQIFLLVENVILS---IENLRRQQQQSSSEPTVASAASPEADAATKQKEEELMKQIEELKNKYLSVGRLMQEKEAKFQSELAERDVEIRELQQSVAQLQSDLS--------RLRAEQQVDLQN---------------------------SLMFTKLDAERNTKTLKRALASRRIGEAAYETAVEAMEEYASVPARRLLTMARRLLHRRTVEQL 879          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. TrEMBL
Match: V4BLR6 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_164724 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 2.514e-38
Identity = 103/317 (32.49%), Postives = 171/317 (53.94%), Query Frame = 3
Query:   54 SDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTK 1004
            S LD  D  +  VI++N+   +QR A E KEEL KV+ RVENI   FE    +  +F S                  +E V D+  L  LL     ++KY  QVTVFIVG+ +++T +L+L+Q+VN+FF++S   F++                          D P   +    ++ + + +++   + L  RLGD+N ++I+    YA+NKA NKGRKK+EKAL+ A ++   L+EKL      + EKD ++  L KQ E K+ E QK+++AAE  KK  +++EKLK+ +  ++ ++  ++  +++ ++ L Q +
Sbjct:    8 SILDRGDAPAQAVIDRNSRALAQRVANETKEELEKVMHRVENICENFEMTNEYYADFGS-----------------NMEFVSDIAELAELLQDQVKKKKYQAQVTVFIVGFQEVSTQKLKLLQQVNEFFLDSIRNFED--------------------------DVPNTPDVDLEDVTHKIDESLDVARGLATRLGDINQDIIEYLLNYAENKAKNKGRKKLEKALQAAKDDLSSLSEKLLGVQSDLEEKDEKMQQLYKQLEIKTLENQKYRSAAEVAKKNLLDAEKLKDDIVMRDEKLRDMRQVISRLEIDLTQAR 281          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. TrEMBL
Match: A0A1I8I3K4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 1.810e-36
Identity = 165/659 (25.04%), Postives = 294/659 (44.61%), Query Frame = 3
Query:   39 LNQMYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAA---------------------AESIKKAAMESEKLK----EQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLKSSEFDENAIALHWSEPEDDDNKPXXXXXXXXXXNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLK-------VDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKT-NDLLK 1916
            L  + ++LD +D  +  V+++NA     R A ER++EL +VL RV+NI   FE    +G                 NG +++V+ V  +  LE ++   Q+++KYL  VT+F+VGY      RL L+++V++F + +E +FD                          SD   DE     EL  +V+  I S  +L +RLGDL+  +++  A +  +K   K +KK+EK LE    +  +L++KL      + ++D +   + +Q E K+ E+ K +AA                      E I+    + E+LK    E++   + +I  L+ +  + Q ++D  KT      A       E ++   N E  L + K ++     S       K++HE E  +LQ +   ++ ++             SEFDEN   +      DDD +P                                            + +DV+ F      D++  W +VPRSH  GRF QYR L+ A ++   +Q ++   ++ R+I  LKS+  + +  WD ER+ L  +V+  E++ +DA++ A+LA+ ++E +    K        D ++     G++  + D+T+L  +V++++  L+  N LLK
Sbjct:    5 LASLSAELDYVDQAARDVLDRNAREAHDRMANERRDELNRVLRRVDNICSNFENYEAYG-----------------NGKTSVVQFVSGLAELEKIVSDPQAKKKYLDDVTIFVVGYENKCNSRLHLIEQVSEFLLENEALFD--------------------------SDLNSDEPVNFEELNASVESTITSVGELNSRLGDLHRGVVEGLAAHYNSKGAQKQKKKLEKELEALRKDFGELSDKLVHLNSELQDRDLKAQQMARQIENKNAELHKLRAAVEINKAAAAQLAELQAEHDRRGEEIEAVKTDLERLKLETGEEMHRDKMEIELLRDQTGKLQAEIDDLKTQLNDAHAQYRAAQNELEELRLNNESRLASMKAKYRRQIASA------KKRHEDESAKLQEELRKAYAEMSRAE---------SEFDENKQTIFVP---DDDERP--------------------------------------------TEEDVMEFDTEIAFDDDSAWDAVPRSHRRGRFTQYRNLARAKLAQEAEQSKQ---RADRKILQLKSRFNEFKAQWDEERQGLELSVQEAERETEDAKRKAELAVRKLEELYERFKDTQSLSTADSSELHSRIGQL--QVDKTQLETRVEELEHELRVINQLLK 553          

HSP 2 Score: 86.2705 bits (212), Expect = 2.860e-13
Identity = 75/291 (25.77%), Postives = 137/291 (47.08%), Query Frame = 2
Query: 2234 GLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLN-LKELSPVSIR--SQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIP-SEKTTKVREMRSLQ--EDCRQMKLLIKALQQSYQSKFNL-----------LNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERI 3055
            GL L  HP+V +++ +Y+ I+  K +   +L E D    +EV N L  L   +++   ++RITPQIE++G+++  +      ++E+++L    IE+   ++ +S   PT      P ++  TK +E   ++  E+ +   L +  L Q  ++KF             L QS+ +L+  LS        R     +V +QN                           S++FT+ D+ERN   ++ A+      E  Y+ AVE M +Y  +PA++L  + R+ LHR  +E++
Sbjct:  615 GLHLADHPIVGEFIRTYNHIMKSKTRLSELLSENDSY--KEVANNLASLGQEALKLDRESRITPQIEDLGRNLTFVSDQIFLLVENVILS---IENLRRQQQQSSSEPTVASAASPEADAATKQKEEELIKQIEELKNKYLSVGRLMQEKEAKFQSELAERDVEIRELQQSVAQLQSDLS--------RLRAEQQVDLQN---------------------------SLMFTKLDAERNTKTLKRALASRRIGEAAYETAVEAMEEYASVPARRLLTMARRLLHRRTVEQL 865          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Nematostella
Match: EDO32181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVS8])

HSP 1 Score: 59.6918 bits (143), Expect = 3.877e-9
Identity = 93/391 (23.79%), Postives = 173/391 (44.25%), Query Frame = 3
Query:   90 VIEKNAITKSQRQATERKEELTKV---LTRVENIYGEFEKPTNF--GREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNF----IEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSEL-AQSQMKLDQTKTLDAAQRANAEEIAL---------EFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSF 1205
            +++ N+  ++ R+ATE +EELTK+   +TR  + Y   EK +      E   +     R++ T       +E V D+  L  +L    +++KY Q VTVFIVGY  +   R +L+ ++ +FF  +    D F    IE +   + E+   + K E +                     QQ+ Q    LT +L  L  ++ +      +NK G     +M+K++E                              MKQ      E+Q+ K  A++ KKA+  + +LK +L+AK+   L+LQ  L A ++M+L+  +  D   R    +  +         E++ K ++L++ +E+ + E ++   S ++   ++ +HE  +  L  D+E + 
Sbjct:   25 ILQANSRAQALRKATETQEELTKIRERVTRTLDTYDLSEKLSAGVDKAEVERITDEFLRQQAT-------LEFVDDMTQLMVILGDPVAKRKYQQHVTVFIVGYENLCGRRAKLLAQLQEFFTQNMADDDKFELEPIEFDLEDVGEQVRGKKKLEKSL--------------------QQSHQDIMSLTEKLLKLQNDLDEN-----ENKLG-----QMQKSME------------------------------MKQV-----EIQRLKVQADNGKKASDLANELKAELAAKD---LELQQHLKAMNEMELNIAQIEDKQDRDFERQKKIKEENQREKEEYEQKIRDLQQYVESVRTEMQQHYDSELKK--VRHEHEMTLYYLNQDHETAL 338          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Nematostella
Match: EDO32182 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT0])

HSP 1 Score: 56.225 bits (134), Expect = 6.484e-8
Identity = 73/300 (24.33%), Postives = 126/300 (42.00%), Query Frame = 2
Query: 2240 TLIQHPVVTDYLHSYDQILTFKEQFLAMLE---------ELDKIDLREVLNLKELSPVSIRSQNRITPQIE-EIGKSIEKILQ-MSLQIL--EHILLPRKKIESKTN----------KEVKSRLS-----PTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERI 3055
             L  HPV ++ L +YD ++ FK+     L+         EL  +D+  V+N ++L+ V  R      P+I   IG+ +EK+   ++ Q L  E    P  + E ++            E + R S     P++ K  I S     ++E   L E    ++  +    + +Q + +     M +++  ++ L  Q  D  A                   +PA            S SI+F+R D+ERN   +  A+ E    +    + V  M+ YV +PAK+L  +VR+Y H  AM+ I
Sbjct:  210 ALRDHPVASESLRTYDSVMRFKDSVTRWLDREGVTEGADELKGLDM-TVINREDLAQVIER-----LPEIRYSIGQVLEKVDDILASQSLRREVTFAPSTRTEGESTFHELTGIRDTAESEERGSSPADEPSRDKSDIQSSYVKLLKEYNDLAEGYESLRRHMDEETKFHQEQTSQNAALMAEMQDTINQLRLQLADAMAGR---------------TGSPA----------RASSSIMFSRLDAERNAKILTRAMNERRIQQENVTDVVNTMSDYVSLPAKRLAHMVRRYSHHRAMQEI 478          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Planmine SMEST
Match: SMESG000071994.1 (SMESG000071994.1)

HSP 1 Score: 1258.43 bits (3255), Expect = 0.000e+0
Identity = 641/641 (100.00%), Postives = 641/641 (100.00%), Query Frame = 3
Query:   48 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLKSSEFDENAIALHWSEPEDDDNKPXXXXXXXXXXNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ 1970
            MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ
Sbjct:    1 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ 641          

HSP 2 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 358/395 (90.63%), Postives = 358/395 (90.63%), Query Frame = 2
Query: 1985 ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVR-------------------------------------TGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS 3058
            ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVR                                     TGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS
Sbjct:  642 ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS 1036          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Planmine SMEST
Match: SMESG000071994.1 (SMESG000071994.1)

HSP 1 Score: 1247.26 bits (3226), Expect = 0.000e+0
Identity = 641/656 (97.71%), Postives = 641/656 (97.71%), Query Frame = 3
Query:   48 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLK---------------SSEFDENAIALHWSEPEDDDNKPXXXXXXXXXXNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ 1970
            MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLK               SSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ
Sbjct:    1 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKISLTGNDHRIRSLELSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ 656          

HSP 2 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 358/395 (90.63%), Postives = 358/395 (90.63%), Query Frame = 2
Query: 1985 ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVR-------------------------------------TGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS 3058
            ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVR                                     TGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS
Sbjct:  657 ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS 1051          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Planmine SMEST
Match: SMESG000071994.1 (SMESG000071994.1)

HSP 1 Score: 1245.72 bits (3222), Expect = 0.000e+0
Identity = 641/664 (96.54%), Postives = 641/664 (96.54%), Query Frame = 3
Query:   48 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLKSSEFDENAIALHWSEPEDDDNKPXXXXXXXXXXN-----------------------DNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ 1970
            MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRN                       DNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ
Sbjct:    1 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNFSDILSSPRGDLSPINNGSNSASDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ 664          

HSP 2 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 358/395 (90.63%), Postives = 358/395 (90.63%), Query Frame = 2
Query: 1985 ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVR-------------------------------------TGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS 3058
            ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVR                                     TGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS
Sbjct:  665 ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS 1059          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Planmine SMEST
Match: SMESG000071994.1 (SMESG000071994.1)

HSP 1 Score: 1240.33 bits (3208), Expect = 0.000e+0
Identity = 641/673 (95.25%), Postives = 641/673 (95.25%), Query Frame = 3
Query:   48 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLK--------------------------------SSEFDENAIALHWSEPEDDDNKPXXXXXXXXXXNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ 1970
            MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLK                                SSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ
Sbjct:    1 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKISLTGNDHRIRSLELELNECKQLTVLKSNTKMSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ 673          

HSP 2 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 358/395 (90.63%), Postives = 358/395 (90.63%), Query Frame = 2
Query: 1985 ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVR-------------------------------------TGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS 3058
            ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVR                                     TGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS
Sbjct:  674 ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS 1068          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Planmine SMEST
Match: SMESG000071994.1 (SMESG000071994.1)

HSP 1 Score: 1237.25 bits (3200), Expect = 0.000e+0
Identity = 634/641 (98.91%), Postives = 635/641 (99.06%), Query Frame = 3
Query:   48 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLKSSEFDENAIALHWSEPEDDDNKPXXXXXXXXXXNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ 1970
            MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKR      +LKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ
Sbjct:    1 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKR------NLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ 635          

HSP 2 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 358/395 (90.63%), Postives = 358/395 (90.63%), Query Frame = 2
Query: 1985 ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVR-------------------------------------TGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS 3058
            ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVR                                     TGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS
Sbjct:  636 ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS 1030          
The following BLAST results are available for this feature:
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K4N96.997e-4032.32nuclear mitotic apparatus protein 1 isoform X2 OS=... [more]
A0A1S3K5131.610e-3831.22uncharacterized protein LOC106178794 isoform X1 OS... [more]
A0A267H9Y62.470e-3826.41Uncharacterized protein OS=Macrostomum lignano OX=... [more]
V4BLR62.514e-3832.49Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1I8I3K41.810e-3625.04Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO321813.877e-923.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321826.484e-824.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071994.10.000e+0100.00SMESG000071994.1[more]
SMESG000071994.10.000e+097.71SMESG000071994.1[more]
SMESG000071994.10.000e+096.54SMESG000071994.1[more]
SMESG000071994.10.000e+095.25SMESG000071994.1[more]
SMESG000071994.10.000e+098.91SMESG000071994.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007371 ID=SMED30007371|Name=nuclear mitotic apparatus protein 1 isoform X2|organism=Schmidtea mediterranea sexual|type=transcript|length=3059bp
CATGACTTAAAATCTGCATAGTTTCGATTCCGCGAGTTTTAAATCAAATG
TACAGCGATTTGGATGAAATAGATTTCGTTTCTCTAAAAGTTATTGAAAA
AAATGCAATTACAAAATCCCAAAGACAAGCCACTGAACGAAAAGAAGAAT
TAACGAAAGTCTTAACTCGGGTTGAAAATATTTACGGTGAATTTGAAAAG
CCTACAAATTTCGGCAGAGAATTTTCGTCATTAAATCCGGCAATTTTCCG
TGAAAAAACCACAGCAAACGGCGATTCGACAATTGTGGAATGCGTGAAAG
ATGTGCCTGCCCTCGAAAACCTTCTCGACAGTTATCAGAGCAGGCAGAAA
TATTTGCAGCAAGTTACCGTGTTCATTGTGGGCTATTCTAAAATGGCCAC
AGATCGTCTGAGATTAATGCAGGAAGTCAATCAGTTTTTCGTAAATAGTG
AAACTATTTTCGACAATTTTATTGAAAGAGAAGATAGAATTCTCAATGAG
GAAGCCTTAGAGCGTGACAAAACCGAAAACGCCTTTGTAAATTCTGACTA
TCCAGAGGATGAAGAATATACGACTTCCGAATTGGCAAACAATGTCCAAC
AGGCCATTCAATCATGTCAGGACTTGACAAATCGCCTTGGAGATTTAAAC
ATTGAAATGATAGATTGTTTTGCTAAATACGCTCAAAACAAAGCCGGAAA
TAAAGGAAGAAAAAAAATGGAAAAAGCGTTGGAAAATGCAACAAATGAAA
CTTTAAAACTTAATGAAAAATTGACTCAATCATTGAAAGTAATATCAGAA
AAAGATTCACGAATAGATAACCTAATGAAACAATGTGAAACTAAATCAAA
AGAAGTACAAAAATTCAAGGCTGCCGCTGAATCCATAAAGAAAGCTGCTA
TGGAATCTGAAAAGTTGAAAGAACAGTTAAGTGCCAAAGAAGCCCAAATA
TTACAATTGCAATCTGAATTAGCTCAATCGCAGATGAAATTAGACCAAAC
TAAAACTCTAGATGCAGCTCAAAGAGCGAACGCCGAAGAAATAGCTCTCG
AATTTCAGGATAAATATAAAAATCTTGAAAAGGTTTTGGAAGCTCAGAAA
ATAGAATTTGAAGAAACGAAAAGAAGCCCCATAGAAAACAATGATTTGAA
ACGGCAACACGAAACTGAAATGAAGCAACTTCAGGCAGACAACGAGAACA
GCTTCCAGCAAATTAGAATTGAACACCAACAGGAAATACAGCAATTGAAG
TCTAGTGAATTTGATGAGAACGCAATTGCTTTACATTGGAGTGAGCCAGA
AGATGATGACAATAAACCAAGCCGGCGGTCACTCAGCAGCCTATCTAGAA
ATGACAACGAAAAGAAAAAATCAACTAGTAATAGTGGATCACCTTCAAGA
TTTGGAAGTGGAAAAAATGGGTCTCGTCAGCCCACTACTTCCGGTCGTTC
TTCAGGCAAGGATGTTTTGACATTCAGTGATGCTCCTGATCTTGACAATG
AAGAATTCTGGTCAAGCGTTCCTCGCAGTCATTTGCTGGGCCGTTTTTTT
CAATACAGACAATTGAGCATGGCTTCAATGTCGAATTTATTAGACCAACA
TGAAAAGCTTCAAGGCAAAAGTACTCGTCAAATATATTCATTGAAATCGC
AACACCAACAGCACCAACAAATATGGGATAGAGAGCGAGAATTGTTAATT
GAAGCTGTGCGTAACACAGAAAAAGACAGGAAAGATGCACAAAAATATGC
CGACTTAGCCATGGAAGAAATGGAAAATATTGTCACTTCATTGAAGGTGG
ATAAAAATCAAAAATTAGATGGGACTGGGGAAATTTTGGAAGAAACTGAT
GAAACGAAGTTGATTGAAAAAGTGGATCAAATAAAAGAATACCTGAAAAC
AAATGATTTACTCAAAGATCCTATTGGTAAAATGATTGGAGATTTACGGA
AAATGTGCCAATTATTTCAATTTTTAAAAAATAAGAGCGATCTCGAATCT
CTGTACCCAAATATGTTACAATGGTCGATTTGCGAAAAAGTGAGGAGCTT
AAGCAAAATCTCATGGCTAATGCAACTCAGACGGAAGATGAAAACTATAG
GTTAATCTCAAGAATTGGATCACATGGACCTATTTTGGACGAGGAGAAAG
ATATAATGTTTCCAGAAGAAATTGATAGTGATAAGAGCACTCGAAGTGTT
GCTATATCTGCCAGTCCAACCTTAGTGAGGACCGGGTTGACTTTGATACA
ACATCCAGTCGTAACGGACTATTTACACAGCTACGATCAAATATTAACGT
TCAAGGAACAGTTTTTAGCTATGTTAGAAGAACTGGACAAAATTGATTTG
AGAGAAGTTCTCAATTTGAAGGAACTGAGTCCAGTTTCAATCCGGTCTCA
AAATAGAATAACTCCTCAAATTGAAGAGATTGGTAAATCCATTGAAAAAA
TTTTGCAAATGTCACTGCAAATTCTCGAGCATATTTTACTACCACGAAAG
AAGATAGAATCGAAAACAAACAAAGAGGTAAAATCTCGACTGTCACCCAC
AAAAGGAAAGCAACCAATACCATCAGAGAAGACGACAAAAGTTAGAGAAA
TGAGATCCTTACAAGAAGATTGCCGACAAATGAAATTATTGATAAAAGCA
CTTCAACAATCATATCAATCGAAGTTCAATTTACTCAACCAATCAATGTT
GAAATTAAAACAAATGTTATCCGTTTTACATAAACAGTGTGTTGATAGAT
TCGCCGTCCATGACGAAGTTCATATTCAAAATCTAGAAATTCGTACTGAC
GTGACAAACACAAACCCTGCTGACAACCTTCAACACCAACCTCCTCTTGA
TTACGATTCAATATCTATTCTCTTTACAAGGCGAGATTCTGAAAGAAATA
TTGGAAGGATTCAAAACGCAATTTTGGAAAATGGGTTTCCTGAGACTCTT
TACAAAGAAGCAGTCGAAAAAATGGCGCAATACGTCGAAATTCCCGCTAA
ACAGTTGTACATTTTAGTGAGAAAATATTTACACAGAGATGCTATGGAAA
GGATTTCAT
back to top

protein sequence of SMED30007371-orf-1

>SMED30007371-orf-1 ID=SMED30007371-orf-1|Name=SMED30007371-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=346bp
MVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEE
IDSDKSTRSVAISASPTLVRTGLTLIQHPVVTDYLHSYDQILTFKEQFLA
MLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQ
ILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQED
CRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEV
HIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNA
ILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERIS
back to top

protein sequence of SMED30007371-orf-2

>SMED30007371-orf-2 ID=SMED30007371-orf-2|Name=SMED30007371-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=686bp
MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFE
KPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQ
KYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILN
EEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDL
NIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVIS
EKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQ
ILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQ
KIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQL
KSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPS
RFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRF
FQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELL
IEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEET
DETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQFLKNKSDLE
SLYPNMLQWSICEKVRSLSKISWLMQLRRKMKTIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
Vocabulary: biological process
TermDefinition
GO:0006412translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 326..360
NoneNo IPR availableCOILSCoilCoilcoord: 183..203
NoneNo IPR availableCOILSCoilCoilcoord: 221..241
NoneNo IPR availableCOILSCoilCoilcoord: 256..321
NoneNo IPR availableCOILSCoilCoilcoord: 364..388
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 442..472
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 414..441
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 414..473
NoneNo IPR availablePANTHERPTHR37915FAMILY NOT NAMEDcoord: 173..617
coord: 78..139