Achaete-scute-like protein

Overview
NameAchaete-scute-like protein
Smed IDSMED30007346
Length (bp)542
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Achaete-scute-like protein (SMED30007346) t-SNE clustered cells

Violin plots show distribution of expression levels for Achaete-scute-like protein (SMED30007346) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Achaete-scute-like protein (SMED30007346) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Achaete-scute-like protein (SMED30007346) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007346

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30007346SMESG000026861.1 SmedASXL_007084SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30007346SMESG000026861.1 SMED30007346smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007346SMESG000026861.1 SMED30007346smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30007346SMESG000026861.1 SMED30007346smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nu neoblastSMED30007346SMESG000026861.1 SMED30007346smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007346SMESG000026861.1 dd_Smed_v4_1854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30007346SMESG000026861.1 dd_Smed_v4_1854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007346SMESG000026861.1 dd_Smed_v4_1854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30007346SMESG000026861.1 dd_Smed_v4_1854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007346SMESG000026861.1 Contig47141newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007346SMESG000026861.1 Contig47141uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
prepharyngeal regionSMED30007346SMESG000026861.1 dd_Smed_v6_1854_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30007346SMESG000026861.1 OX_Smed_1.0.02731ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
secretory systemSMED30007346SMESG000026861.1 dd_Smed_v6_1854_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Achaete-scute-like protein vs. Ensembl Human
Match: ASCL4 (achaete-scute family bHLH transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:24311])

HSP 1 Score: 60.8474 bits (146), Expect = 2.411e-11
Identity = 33/54 (61.11%), Postives = 38/54 (70.37%), Query Frame = 3
Query:  267 KRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLE 428
            KRN RER+RV  VN  +A LR  +P E   KR+SKV TLR AIDYIK L +LLE
Sbjct:   77 KRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLE 130          
BLAST of Achaete-scute-like protein vs. Ensembl Human
Match: HAND2 (heart and neural crest derivatives expressed 2 [Source:HGNC Symbol;Acc:HGNC:4808])

HSP 1 Score: 59.3066 bits (142), Expect = 8.547e-11
Identity = 27/55 (49.09%), Postives = 38/55 (69.09%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            N +ER+R + +N+AFAELR+CIP      ++SK++TLR+A  YI  L  LL  DD
Sbjct:   74 NRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDD 128          
BLAST of Achaete-scute-like protein vs. Ensembl Human
Match: HAND2 (heart and neural crest derivatives expressed 2 [Source:HGNC Symbol;Acc:HGNC:4808])

HSP 1 Score: 59.3066 bits (142), Expect = 1.264e-10
Identity = 27/55 (49.09%), Postives = 38/55 (69.09%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            N +ER+R + +N+AFAELR+CIP      ++SK++TLR+A  YI  L  LL  DD
Sbjct:  105 NRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDD 159          
BLAST of Achaete-scute-like protein vs. Ensembl Human
Match: ASCL3 (achaete-scute family bHLH transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:740])

HSP 1 Score: 58.151 bits (139), Expect = 2.160e-10
Identity = 31/56 (55.36%), Postives = 37/56 (66.07%), Query Frame = 3
Query:  267 KRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            KRN RER+RV+ VN  +A+LR  +P E   KR+SKV TLR AI YI  L  LL  D
Sbjct:   97 KRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIKYINYLQSLLYPD 152          
BLAST of Achaete-scute-like protein vs. Ensembl Human
Match: PTF1A (pancreas associated transcription factor 1a [Source:HGNC Symbol;Acc:HGNC:23734])

HSP 1 Score: 58.151 bits (139), Expect = 7.352e-10
Identity = 28/54 (51.85%), Postives = 38/54 (70.37%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N RER+R++ +N+AF  LR  IP     KR+SKV TLR+AI YI  LS+L++ D
Sbjct:  169 NVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQAD 222          
BLAST of Achaete-scute-like protein vs. Ensembl Celegans
Match: hlh-4 (Helix-loop-helix protein 4 [Source:UniProtKB/Swiss-Prot;Acc:P34555])

HSP 1 Score: 58.5362 bits (140), Expect = 9.652e-11
Identity = 30/64 (46.88%), Postives = 43/64 (67.19%), Query Frame = 3
Query:  249 LVMNIAKRNARERKRVEQVNNAFAELRKCIP-IENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            + M +AKRNARER RV  VN AF  L++ +P +    KRVSK+R L  AI YI +L +L+++ +
Sbjct:    1 MPMVVAKRNARERTRVHTVNQAFLVLKQHLPSLRQFTKRVSKLRILNAAITYIDTLLKLIQSSE 64          
BLAST of Achaete-scute-like protein vs. Ensembl Celegans
Match: hlh-6 (Helix-loop-helix protein 6 [Source:UniProtKB/Swiss-Prot;Acc:Q10007])

HSP 1 Score: 58.5362 bits (140), Expect = 1.574e-10
Identity = 30/55 (54.55%), Postives = 37/55 (67.27%), Query Frame = 3
Query:  261 IAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLL 425
            + KRN RER RV  VN+ +  LRK +P+    KR+SKV TLR+AI YIK L  LL
Sbjct:  175 VWKRNERERCRVRNVNDGYERLRKHLPVHFDEKRISKVDTLRLAIRYIKHLDNLL 229          
BLAST of Achaete-scute-like protein vs. Ensembl Celegans
Match: lin-32 (pep chromosome:WBcel235:X:2229208:2230122:-1 gene:WBGene00003018.1 transcript:T14F9.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-32)

HSP 1 Score: 54.299 bits (129), Expect = 1.311e-9
Identity = 40/122 (32.79%), Postives = 63/122 (51.64%), Query Frame = 3
Query:   96 ECHPIN------QQTLFEKYCEITFGIEKSGY-DCI--GYSKFDTKTAEKKKRTSNEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            +CHP        Q T+        F ++   Y D +  G  K D K   + K  S +  +L M  +  N RER+R+  +N A+ ELR+ +P  +  K++SK  TL++A  YI+ LSQ+L+ D
Sbjct:   12 QCHPSFMYQGSIQSTMTTPLQSPNFSLDSPNYPDSLSNGGGKDDKKKCRRYKTPSPQ--LLRMRRSAANERERRRMNTLNVAYDELREVLPEIDSGKKLSKFETLQMAQKYIECLSQILKQD 131          
BLAST of Achaete-scute-like protein vs. Ensembl Celegans
Match: cnd-1 (Neurogenic differentiation factor 1 [Source:UniProtKB/Swiss-Prot;Acc:P46581])

HSP 1 Score: 54.299 bits (129), Expect = 2.619e-9
Identity = 24/57 (42.11%), Postives = 40/57 (70.18%), Query Frame = 3
Query:  267 KRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            K N RER R+  +NNA   LR+ IPI  + +++SK+ TLR+A +YI +L ++L+ ++
Sbjct:   23 KANGRERARMHGLNNALDMLREYIPITTQHQKLSKIETLRLARNYIDALQRMLQTNE 79          
BLAST of Achaete-scute-like protein vs. Ensembl Celegans
Match: hlh-14 (Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:Q09961])

HSP 1 Score: 52.7582 bits (125), Expect = 4.796e-9
Identity = 29/59 (49.15%), Postives = 35/59 (59.32%), Query Frame = 3
Query:  258 NIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N   RN RERKRV QVN+ F  LR  +  +N  K+ SK  TLR A+ YI+ L  LL  D
Sbjct:    5 NQVARNERERKRVHQVNHGFDVLRNRLQPKNHTKKWSKADTLREAVKYIQQLQVLLNQD 63          
BLAST of Achaete-scute-like protein vs. Ensembl Fly
Match: sc (gene:FBgn0004170 transcript:FBtr0070073)

HSP 1 Score: 59.6918 bits (143), Expect = 1.074e-10
Identity = 30/69 (43.48%), Postives = 45/69 (65.22%), Query Frame = 3
Query:  258 NIAKRNARERKRVEQVNNAFAELRKCIPIE-----------NRRKRVSKVRTLRVAIDYIKSLSQLLEN 431
            ++ +RNARER RV+QVNN+FA LR+ IP                K++SKV TLR+A++YI+ L  L+++
Sbjct:  100 SVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDD 168          
BLAST of Achaete-scute-like protein vs. Ensembl Fly
Match: ac (gene:FBgn0000022 transcript:FBtr0070072)

HSP 1 Score: 58.151 bits (139), Expect = 1.626e-10
Identity = 31/73 (42.47%), Postives = 48/73 (65.75%), Query Frame = 3
Query:  261 IAKRNARERKRVEQVNNAFAELRKCIP------IENRR--------KRVSKVRTLRVAIDYIKSLSQLLENDD 437
            + +RNARER RV+QVNN F++LR+ IP      + N R        K++SKV TL++A++YI+ L ++L  +D
Sbjct:   26 VIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHEND 98          
BLAST of Achaete-scute-like protein vs. Ensembl Fly
Match: cato (gene:FBgn0024249 transcript:FBtr0087183)

HSP 1 Score: 56.6102 bits (135), Expect = 4.782e-10
Identity = 31/82 (37.80%), Postives = 48/82 (58.54%), Query Frame = 3
Query:  207 TAEKKKRTSNEKSILVMNIAKR-----NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            T    +++S E++ L   + KR     NARERKR+  +N AF  LR+ +P  +  +++SK  TL++A  YI +L  LL N D
Sbjct:   82 TGSDGRKSSPEQTNLSPTVQKRRRQAANARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILALCDLLNNGD 163          
BLAST of Achaete-scute-like protein vs. Ensembl Fly
Match: Fer1 (gene:FBgn0037475 transcript:FBtr0081567)

HSP 1 Score: 54.299 bits (129), Expect = 6.003e-9
Identity = 26/54 (48.15%), Postives = 37/54 (68.52%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N RER+R++ +N AF  LR  IP     KR+SKV TL++AI YI  LS++++ D
Sbjct:   87 NLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKD 140          
BLAST of Achaete-scute-like protein vs. Ensembl Fly
Match: Fer1 (gene:FBgn0037475 transcript:FBtr0334670)

HSP 1 Score: 54.299 bits (129), Expect = 6.071e-9
Identity = 26/54 (48.15%), Postives = 37/54 (68.52%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N RER+R++ +N AF  LR  IP     KR+SKV TL++AI YI  LS++++ D
Sbjct:   92 NLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKD 145          
BLAST of Achaete-scute-like protein vs. Ensembl Zebrafish
Match: tcf15 (transcription factor 15 [Source:ZFIN;Acc:ZDB-GENE-980605-20])

HSP 1 Score: 58.151 bits (139), Expect = 1.865e-10
Identity = 32/77 (41.56%), Postives = 48/77 (62.34%), Query Frame = 3
Query:  207 TAEKKKRTSNEKSILVMNIAKR----NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLL 425
            +AEK++R S + ++  + I K+    NARER R + VN AF  LR  IP E   +++SK+ TLR+A  YI  L+ +L
Sbjct:   44 SAEKRRRMSRKTTVGSVVIVKQRNAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVL 120          
BLAST of Achaete-scute-like protein vs. Ensembl Zebrafish
Match: hand2 (heart and neural crest derivatives expressed 2 [Source:NCBI gene;Acc:58150])

HSP 1 Score: 57.3806 bits (137), Expect = 3.918e-10
Identity = 25/55 (45.45%), Postives = 39/55 (70.91%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            N +ER+R + +N+AFAELR+CIP      ++SK++TLR+A  YI  L  +L+ D+
Sbjct:   93 NRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDILDKDE 147          
BLAST of Achaete-scute-like protein vs. Ensembl Zebrafish
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:368662])

HSP 1 Score: 56.9954 bits (136), Expect = 9.326e-10
Identity = 27/54 (50.00%), Postives = 39/54 (72.22%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N RER+R++ +N+AF  LR  IP     KR+SKV TLR+AI YI  L++L+++D
Sbjct:  121 NVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSD 174          
BLAST of Achaete-scute-like protein vs. Ensembl Zebrafish
Match: atoh1a (atonal bHLH transcription factor 1a [Source:ZFIN;Acc:ZDB-GENE-990415-17])

HSP 1 Score: 56.9954 bits (136), Expect = 1.116e-9
Identity = 32/76 (42.11%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  213 EKKKRTSNEKSILVMNIAKR---NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEN 431
            E ++R  + KS  V+   +R   NARER+R+  +N+AF ELR  IP  +  K++SK  TL++A  YI +LS LL+ 
Sbjct:  101 EGRQRAPSSKSTNVVQKQRRMAANARERRRMHGLNHAFDELRSVIPAFDNDKKLSKYETLQMAQIYINALSDLLQG 176          
BLAST of Achaete-scute-like protein vs. Ensembl Zebrafish
Match: AL807792.2 (pep chromosome:GRCz11:CHR_ALT_CTG8_2_5:29594098:29599935:1 gene:ENSDARG00000110597.1 transcript:ENSDART00000185012.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL807792.2)

HSP 1 Score: 56.9954 bits (136), Expect = 1.180e-9
Identity = 32/76 (42.11%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  213 EKKKRTSNEKSILVMNIAKR---NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEN 431
            E ++R  + KS  V+   +R   NARER+R+  +N+AF ELR  IP  +  K++SK  TL++A  YI +LS LL+ 
Sbjct:  101 EGRQRAPSSKSTNVVQKQRRMAANARERRRMHGLNHAFDELRSVIPAFDNDKKLSKYETLQMAQIYINALSDLLQG 176          
BLAST of Achaete-scute-like protein vs. Ensembl Xenopus
Match: hand2 (heart and neural crest derivatives expressed 2 [Source:NCBI gene;Acc:100101704])

HSP 1 Score: 59.3066 bits (142), Expect = 1.304e-10
Identity = 27/55 (49.09%), Postives = 38/55 (69.09%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            N +ER+R + +N+AFAELR+CIP      ++SK++TLR+A  YI  L  LL  DD
Sbjct:   98 NRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDD 152          
BLAST of Achaete-scute-like protein vs. Ensembl Xenopus
Match: PTF1A (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:100494161])

HSP 1 Score: 58.151 bits (139), Expect = 6.202e-10
Identity = 28/54 (51.85%), Postives = 39/54 (72.22%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N RER+R++ +N+AF  LR  IP     KR+SKV TLR+AI YI  LS+L+++D
Sbjct:  175 NVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQSD 228          
BLAST of Achaete-scute-like protein vs. Ensembl Xenopus
Match: gsk3b (glycogen synthase kinase 3 beta [Source:Xenbase;Acc:XB-GENE-487098])

HSP 1 Score: 55.8398 bits (133), Expect = 1.644e-9
Identity = 25/52 (48.08%), Postives = 36/52 (69.23%), Query Frame = 3
Query:  279 RERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            +ER+R E +N+AFAELR+CIP      ++SK++TLR+A  YI  L  +L  D
Sbjct:   88 KERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIGYLMDVLAKD 139          
BLAST of Achaete-scute-like protein vs. Ensembl Xenopus
Match: gsk3b (glycogen synthase kinase 3 beta [Source:Xenbase;Acc:XB-GENE-487098])

HSP 1 Score: 55.8398 bits (133), Expect = 1.706e-9
Identity = 25/52 (48.08%), Postives = 36/52 (69.23%), Query Frame = 3
Query:  279 RERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            +ER+R E +N+AFAELR+CIP      ++SK++TLR+A  YI  L  +L  D
Sbjct:   88 KERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIGYLMDVLAKD 139          
BLAST of Achaete-scute-like protein vs. Ensembl Xenopus
Match: gsk3b (glycogen synthase kinase 3 beta [Source:Xenbase;Acc:XB-GENE-487098])

HSP 1 Score: 55.8398 bits (133), Expect = 1.769e-9
Identity = 25/52 (48.08%), Postives = 36/52 (69.23%), Query Frame = 3
Query:  279 RERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            +ER+R E +N+AFAELR+CIP      ++SK++TLR+A  YI  L  +L  D
Sbjct:   88 KERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIGYLMDVLAKD 139          
BLAST of Achaete-scute-like protein vs. Ensembl Mouse
Match: Hand2 (heart and neural crest derivatives expressed 2 [Source:MGI Symbol;Acc:MGI:103580])

HSP 1 Score: 59.3066 bits (142), Expect = 8.681e-11
Identity = 27/55 (49.09%), Postives = 38/55 (69.09%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            N +ER+R + +N+AFAELR+CIP      ++SK++TLR+A  YI  L  LL  DD
Sbjct:  105 NRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDD 159          
BLAST of Achaete-scute-like protein vs. Ensembl Mouse
Match: Ascl3 (achaete-scute family bHLH transcription factor 3 [Source:MGI Symbol;Acc:MGI:1928820])

HSP 1 Score: 57.3806 bits (137), Expect = 3.050e-10
Identity = 31/59 (52.54%), Postives = 39/59 (66.10%), Query Frame = 3
Query:  261 IAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            I KRN RER+RV+ VN  +A LR+ +P +   KR+SKV TLR AI YI  L  LL  D+
Sbjct:   94 IRKRNERERQRVKCVNEGYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLLYPDE 152          
BLAST of Achaete-scute-like protein vs. Ensembl Mouse
Match: Ascl5 (achaete-scute family bHLH transcription factor 5 [Source:MGI Symbol;Acc:MGI:2685043])

HSP 1 Score: 57.3806 bits (137), Expect = 3.866e-10
Identity = 31/55 (56.36%), Postives = 37/55 (67.27%), Query Frame = 3
Query:  261 IAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLL 425
            I KRN RER+RV+ VN  +A LR  +P     KR+SKV TLR AI YIK L +LL
Sbjct:   82 IQKRNERERQRVKCVNEGYARLRGHLPGALTEKRLSKVETLRAAIRYIKYLQELL 136          
BLAST of Achaete-scute-like protein vs. Ensembl Mouse
Match: Ptf1a (pancreas specific transcription factor, 1a [Source:MGI Symbol;Acc:MGI:1328312])

HSP 1 Score: 58.151 bits (139), Expect = 5.935e-10
Identity = 28/54 (51.85%), Postives = 38/54 (70.37%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N RER+R++ +N+AF  LR  IP     KR+SKV TLR+AI YI  LS+L++ D
Sbjct:  166 NVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQAD 219          
BLAST of Achaete-scute-like protein vs. Ensembl Mouse
Match: Hand1 (heart and neural crest derivatives expressed 1 [Source:MGI Symbol;Acc:MGI:103577])

HSP 1 Score: 55.4546 bits (132), Expect = 2.198e-9
Identity = 29/79 (36.71%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  198 DTKTAEKKKRTSNEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            D + ++   R     S L         +ER+R E +N+AFAELR+CIP      ++SK++TLR+A  YI  L  +L  D
Sbjct:   75 DARPSQSPGRLEALGSRLPKRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKD 153          
BLAST of Achaete-scute-like protein vs. UniProt/SwissProt
Match: sp|Q6XD76|ASCL4_HUMAN (Achaete-scute homolog 4 OS=Homo sapiens OX=9606 GN=ASCL4 PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.174e-10
Identity = 33/54 (61.11%), Postives = 38/54 (70.37%), Query Frame = 3
Query:  267 KRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLE 428
            KRN RER+RV  VN  +A LR  +P E   KR+SKV TLR AIDYIK L +LLE
Sbjct:   76 KRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLE 129          
BLAST of Achaete-scute-like protein vs. UniProt/SwissProt
Match: sp|Q90690|HAND2_CHICK (Heart- and neural crest derivatives-expressed protein 2 OS=Gallus gallus OX=9031 GN=HAND2 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.389e-10
Identity = 27/55 (49.09%), Postives = 38/55 (69.09%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            N +ER+R + +N+AFAELR+CIP      ++SK++TLR+A  YI  L  LL  DD
Sbjct:  104 NRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLPKDD 158          
BLAST of Achaete-scute-like protein vs. UniProt/SwissProt
Match: sp|P61295|HAND2_RAT (Heart- and neural crest derivatives-expressed protein 2 OS=Rattus norvegicus OX=10116 GN=Hand2 PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 6.072e-10
Identity = 27/55 (49.09%), Postives = 38/55 (69.09%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            N +ER+R + +N+AFAELR+CIP      ++SK++TLR+A  YI  L  LL  DD
Sbjct:  105 NRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDD 159          
BLAST of Achaete-scute-like protein vs. UniProt/SwissProt
Match: sp|Q61039|HAND2_MOUSE (Heart- and neural crest derivatives-expressed protein 2 OS=Mus musculus OX=10090 GN=Hand2 PE=1 SV=3)

HSP 1 Score: 59.3066 bits (142), Expect = 6.072e-10
Identity = 27/55 (49.09%), Postives = 38/55 (69.09%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            N +ER+R + +N+AFAELR+CIP      ++SK++TLR+A  YI  L  LL  DD
Sbjct:  105 NRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDD 159          
BLAST of Achaete-scute-like protein vs. UniProt/SwissProt
Match: sp|P61296|HAND2_HUMAN (Heart- and neural crest derivatives-expressed protein 2 OS=Homo sapiens OX=9606 GN=HAND2 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 6.072e-10
Identity = 27/55 (49.09%), Postives = 38/55 (69.09%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            N +ER+R + +N+AFAELR+CIP      ++SK++TLR+A  YI  L  LL  DD
Sbjct:  105 NRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDD 159          
BLAST of Achaete-scute-like protein vs. TrEMBL
Match: A0A0A7M224 (Achaete-scute class A transcription factor (Fragment) OS=Schmidtea polychroa OX=50054 GN=ASCa PE=2 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 5.240e-80
Identity = 118/121 (97.52%), Postives = 118/121 (97.52%), Query Frame = 3
Query:   75 SQYPFNHECHPINQQTLFEKYCEITFGIEKSGYDCIGYSKFDTKTAEKKKRTSNEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            SQYPFNHECHPINQQTLFEKYCEITFGIEKS YDCIGYSKFD KTAEKKKRT NEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD
Sbjct:    1 SQYPFNHECHPINQQTLFEKYCEITFGIEKSDYDCIGYSKFDMKTAEKKKRTPNEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 121          
BLAST of Achaete-scute-like protein vs. TrEMBL
Match: R7UMI7 (BHLH domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_80653 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.158e-14
Identity = 37/58 (63.79%), Postives = 43/58 (74.14%), Query Frame = 3
Query:  261 IAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            + KRNARERKRV+ VN AF  LRK IP ENR KR+SKV+TLR AI+YI  L  +L  D
Sbjct:    4 VEKRNARERKRVQTVNGAFVRLRKFIPYENRHKRLSKVKTLRKAIEYIDHLQAMLGQD 61          
BLAST of Achaete-scute-like protein vs. TrEMBL
Match: A0A443S4P5 (Achaete-scute 1a-like protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_01451 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.666e-14
Identity = 36/56 (64.29%), Postives = 48/56 (85.71%), Query Frame = 3
Query:  261 IAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLE 428
            +A+RNARERKRV+ VN AF  LRK +P+ENR KR+SKV+TL+ AI+YI +L++LLE
Sbjct:   20 VARRNARERKRVQAVNLAFQRLRKAVPVENRTKRLSKVKTLQRAIEYINNLAKLLE 75          
BLAST of Achaete-scute-like protein vs. TrEMBL
Match: A0A267FCT8 (BHLH domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034253g1 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.979e-14
Identity = 38/61 (62.30%), Postives = 48/61 (78.69%), Query Frame = 3
Query:  255 MNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            + +AKRNARER+RVE VN+AFA LRK IP E R KR+SKV+TLR+ I+YI+ L Q+L   D
Sbjct:  226 LMVAKRNARERRRVEAVNSAFARLRKYIPYEKRNKRLSKVKTLRITIEYIQLLQQVLHEFD 286          
BLAST of Achaete-scute-like protein vs. TrEMBL
Match: A0A267GSH9 (BHLH domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031582g1 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 7.146e-14
Identity = 38/61 (62.30%), Postives = 48/61 (78.69%), Query Frame = 3
Query:  255 MNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            + +AKRNARER+RVE VN+AFA LRK IP E R KR+SKV+TLR+ I+YI+ L Q+L   D
Sbjct:  220 LMVAKRNARERRRVEAVNSAFARLRKYIPYEKRNKRLSKVKTLRITIEYIQLLQQVLHEFD 280          
BLAST of Achaete-scute-like protein vs. Ensembl Cavefish
Match: ASCL4 (achaete-scute homolog 4-like [Source:NCBI gene;Acc:103042080])

HSP 1 Score: 61.2326 bits (147), Expect = 1.165e-11
Identity = 45/118 (38.14%), Postives = 59/118 (50.00%), Query Frame = 3
Query:   90 NHECHP----INQQTLFEK-YCEITFGIEKSGYDCIGYSKFDTKTAEKKKRTSNEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLE 428
            +H+C P    ++    FE+ Y E  +    +G+    Y  F    A        + S     I KRN RER+RV  VN  +A LR+ +P E   KR+SKV TLR AI YIK L  LLE
Sbjct:   40 DHQCPPFRDALSLPLHFEQTYLEPVYSHRYNGH--FSYLPFPGHLA------MYDYSFEPAFIRKRNERERQRVRCVNEGYARLREHLPQEFEDKRLSKVETLRAAISYIKHLQNLLE 149          
BLAST of Achaete-scute-like protein vs. Ensembl Cavefish
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:103040145])

HSP 1 Score: 59.3066 bits (142), Expect = 4.200e-11
Identity = 31/77 (40.26%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  207 TAEKKKRTSNEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            +AEK++R +    ++V      NARER R + VN AF  LR  IP E   +++SK+ TLR+A  YI  L+ +L   D
Sbjct:   45 SAEKRRRNTTGGVLIVKQRNAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLTGD 121          
BLAST of Achaete-scute-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000041861.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:17363496:17366963:1 gene:ENSAMXG00000040130.1 transcript:ENSAMXT00000041861.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.207e-10
Identity = 31/56 (55.36%), Postives = 39/56 (69.64%), Query Frame = 3
Query:  261 IAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLE 428
            I KRN RER+RV+ VN  +A+LR  +P     KR+SKV TLR AI YIK L +L+E
Sbjct:   80 IQKRNERERQRVKCVNQGYAKLRDHLPGGTADKRMSKVETLRAAIRYIKHLQRLVE 135          
BLAST of Achaete-scute-like protein vs. Ensembl Cavefish
Match: hand2 (heart and neural crest derivatives expressed 2 [Source:NCBI gene;Acc:103040254])

HSP 1 Score: 58.5362 bits (140), Expect = 1.431e-10
Identity = 25/55 (45.45%), Postives = 40/55 (72.73%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            N +ER+R + +N+AFAELR+CIP      ++SK++TLR+A  YI  L+ +L+ D+
Sbjct:   88 NRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLTDILDRDE 142          
BLAST of Achaete-scute-like protein vs. Ensembl Cavefish
Match: si:ch211-246m6.4 (transcription factor 15-like [Source:NCBI gene;Acc:103034626])

HSP 1 Score: 56.225 bits (134), Expect = 7.616e-10
Identity = 33/76 (43.42%), Postives = 42/76 (55.26%), Query Frame = 3
Query:  207 TAEKKKRTSNEKSILVMNIAKR---NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLL 425
            T E  KRT      LV    +R   NARER R   VN AF+ LR  IP E   +++SK+ TLR+A  YI  L+ +L
Sbjct:   58 TGEPGKRTHRPTRRLVGVSKQRQAANARERDRTHSVNTAFSALRTLIPTEPADRKLSKIETLRLASSYIAHLANVL 133          
BLAST of Achaete-scute-like protein vs. Ensembl Sea Lamprey
Match: ASCL4 (achaete-scute family bHLH transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:24311])

HSP 1 Score: 56.9954 bits (136), Expect = 3.553e-11
Identity = 31/55 (56.36%), Postives = 37/55 (67.27%), Query Frame = 3
Query:  261 IAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLL 425
            I KRN RER+RV+ VN  +A LR  +P E   KR+SKV TLR AI YIK L  +L
Sbjct:   57 IRKRNERERQRVKCVNEGYARLRDHLPDEFSDKRLSKVETLRAAIRYIKHLQAML 111          
BLAST of Achaete-scute-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004072.1 (pep scaffold:Pmarinus_7.0:GL492732:1750:4325:-1 gene:ENSPMAG00000003727.1 transcript:ENSPMAT00000004072.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.999e-9
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N RER+R++ +N AF  LR  IP     KR+SKV TLR+AI YI  L +L+ ++
Sbjct:  137 NQRERRRMQSINAAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYISFLGELVHSE 190          
BLAST of Achaete-scute-like protein vs. Ensembl Sea Lamprey
Match: TWIST1 (twist family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:12428])

HSP 1 Score: 50.447 bits (119), Expect = 4.908e-9
Identity = 26/55 (47.27%), Postives = 38/55 (69.09%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            N RER+R + +N AFA LRK IP     K +SK++TL++A  YI  L Q+L++D+
Sbjct:   14 NVRERQRTQSLNEAFASLRKIIPTLPSDK-LSKIQTLKLASRYIDFLYQVLQSDE 67          
BLAST of Achaete-scute-like protein vs. Ensembl Sea Lamprey
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 50.8322 bits (120), Expect = 6.015e-9
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N RER+R+  +N+AF ELR  +P     KR+SK+ TLR+AI YI  L  +L +D
Sbjct:   39 NVRERRRMLSINSAFEELRCHVPTFPYEKRLSKIDTLRLAIAYIALLRDILLSD 92          
BLAST of Achaete-scute-like protein vs. Ensembl Sea Lamprey
Match: neurod1 (neuronal differentiation 1 [Source:NCBI gene;Acc:30169])

HSP 1 Score: 51.9878 bits (123), Expect = 1.056e-8
Identity = 25/57 (43.86%), Postives = 39/57 (68.42%), Query Frame = 3
Query:  255 MNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLL 425
            M   K NARER R+  +N A   LRK +P  ++ +++SK+ TLR+A +YI +LS++L
Sbjct:   23 MRRVKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEIL 79          
BLAST of Achaete-scute-like protein vs. Ensembl Nematostella
Match: EDO31750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX24])

HSP 1 Score: 59.6918 bits (143), Expect = 1.531e-12
Identity = 28/49 (57.14%), Postives = 40/49 (81.63%), Query Frame = 3
Query:  261 IAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIK 407
            +A+RNARERKRV+ VN+ F  LRK +P + + K++SKV+TLR AI+YI+
Sbjct:   27 VARRNARERKRVKLVNDGFMRLRKHVPTDPKNKKLSKVKTLRSAIEYIR 75          
BLAST of Achaete-scute-like protein vs. Ensembl Nematostella
Match: NVAS-C2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1A5])

HSP 1 Score: 58.151 bits (139), Expect = 5.202e-12
Identity = 32/58 (55.17%), Postives = 38/58 (65.52%), Query Frame = 3
Query:  261 IAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            I KRN RER RV  VN  +A LR+ +P E   KR+SKV TLR AI YIK L  LL+ +
Sbjct:   11 IRKRNERERIRVRHVNEGYARLREHLPEEPSDKRMSKVETLRAAIRYIKHLESLLQAE 68          
BLAST of Achaete-scute-like protein vs. Ensembl Nematostella
Match: EDO43849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI0])

HSP 1 Score: 54.299 bits (129), Expect = 1.022e-10
Identity = 27/51 (52.94%), Postives = 36/51 (70.59%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLL 425
            N RERKR++ +N AF  LRK IP     KR+SKV TLR+AI YI  L++++
Sbjct:    8 NLRERKRMQSINEAFEGLRKHIPTLPYEKRLSKVDTLRLAIGYIGFLTEMI 58          
BLAST of Achaete-scute-like protein vs. Ensembl Nematostella
Match: NVATO2 (Atonal-related protein 2; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ22])

HSP 1 Score: 56.6102 bits (135), Expect = 3.317e-10
Identity = 25/54 (46.30%), Postives = 38/54 (70.37%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N RER+R++ +N A   L+KCIP+   ++RV+K+  LR+A +YIKSLS  L  +
Sbjct:  147 NDRERRRMKSLNRALDSLKKCIPVPQSKRRVTKLEILRIACNYIKSLSDTLRGE 200          
BLAST of Achaete-scute-like protein vs. Ensembl Nematostella
Match: EDO42907 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S063])

HSP 1 Score: 52.373 bits (124), Expect = 5.750e-10
Identity = 27/51 (52.94%), Postives = 35/51 (68.63%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLL 425
            N RER RV+QVN AF  LR  IP+    K+ SK+ T+R+A  YI+ L+QLL
Sbjct:    9 NERERNRVQQVNAAFETLRNKIPLRALEKKPSKIDTIRLATRYIQDLTQLL 59          
BLAST of Achaete-scute-like protein vs. Ensembl Medaka
Match: ASCL4 (achaete-scute family bHLH transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:24311])

HSP 1 Score: 61.6178 bits (148), Expect = 3.783e-12
Identity = 34/56 (60.71%), Postives = 38/56 (67.86%), Query Frame = 3
Query:  261 IAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLE 428
            I KRN RER RV  VN  +A LR+ +P E   KR+SKV TLR AIDYIK L  LLE
Sbjct:   83 IQKRNERERHRVRCVNEGYARLREHLPQEFEDKRLSKVETLRAAIDYIKRLQSLLE 138          
BLAST of Achaete-scute-like protein vs. Ensembl Medaka
Match: ENSORLT00000013528.2 (pep primary_assembly:ASM223467v1:5:20413359:20417599:-1 gene:ENSORLG00000010785.2 transcript:ENSORLT00000013528.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.229e-11
Identity = 32/59 (54.24%), Postives = 42/59 (71.19%), Query Frame = 3
Query:  261 IAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            I KRN RER+RV+ VN  +A+LR  +P ++  KR+SKV TLR AI YIK L  L+E +D
Sbjct:   24 IQKRNERERQRVKCVNQGYAKLRDHLPGQSANKRLSKVETLRAAIRYIKYLQGLVELED 82          
BLAST of Achaete-scute-like protein vs. Ensembl Medaka
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:101172734])

HSP 1 Score: 58.151 bits (139), Expect = 1.384e-10
Identity = 30/81 (37.04%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  207 TAEKKKRTS----NEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            ++EK++R S     + ++++   +  NARER R + VN AF  LR  IP E   +++SK+ TLR+A  YI  L+ +L   D
Sbjct:   42 SSEKRRRASRKLEGDTAVVIKQRSAANARERGRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLTGD 122          
BLAST of Achaete-scute-like protein vs. Ensembl Medaka
Match: tal1 (T-cell acute lymphocytic leukemia protein 1 [Source:NCBI gene;Acc:101174459])

HSP 1 Score: 58.5362 bits (140), Expect = 3.212e-10
Identity = 30/55 (54.55%), Postives = 37/55 (67.27%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            N+RER R + VN AFAELRK IP     K++SK   LR+A+ YI  LS LLE+ D
Sbjct:  231 NSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYISFLSNLLEDQD 285          
BLAST of Achaete-scute-like protein vs. Ensembl Medaka
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:101160350])

HSP 1 Score: 58.151 bits (139), Expect = 3.579e-10
Identity = 27/54 (50.00%), Postives = 39/54 (72.22%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N RER+R++ +N+AF  LR  IP     KR+SKV TLR+AI YI  L++L+++D
Sbjct:  124 NVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSD 177          
BLAST of Achaete-scute-like protein vs. Planmine SMEST
Match: SMESG000026861.1 (SMESG000026861.1)

HSP 1 Score: 264.618 bits (675), Expect = 4.514e-92
Identity = 127/129 (98.45%), Postives = 129/129 (100.00%), Query Frame = 3
Query:   51 MSRTNEVKSQYPFNHECHPINQQTLFEKYCEITFGIEKSGYDCIGYSKFDTKTAEKKKRTSNEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 437
            MSRTNE+KSQYPFNHECHPINQQT+FEKYCEITFGIEKSGYDCIGYSKFDTKTAEKKKRTSNEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD
Sbjct:    1 MSRTNEIKSQYPFNHECHPINQQTIFEKYCEITFGIEKSGYDCIGYSKFDTKTAEKKKRTSNEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLENDD 129          
BLAST of Achaete-scute-like protein vs. Planmine SMEST
Match: SMESG000044960.1 (SMESG000044960.1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.826e-9
Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N RERKR++ +N+AF +LR  IP     KR+SKV TLR+AI YI  L  +++ D
Sbjct:   52 NMRERKRMQSINDAFEKLRVHIPTMPYEKRLSKVDTLRMAIGYINFLGGIMQVD 105          
BLAST of Achaete-scute-like protein vs. Planmine SMEST
Match: SMESG000044395.1 (SMESG000044395.1)

HSP 1 Score: 52.7582 bits (125), Expect = 3.072e-9
Identity = 29/59 (49.15%), Postives = 37/59 (62.71%), Query Frame = 3
Query:  255 MNIAKRNA--RERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLL 425
            M I+KR+A  RER R   VN AF  LR+ IP E   +++SK+ TLR+A  YI  L  LL
Sbjct:    1 MGISKRSAKERERSRTASVNEAFLALREIIPTEPINRKLSKIETLRLAASYINHLHTLL 59          
BLAST of Achaete-scute-like protein vs. Planmine SMEST
Match: SMESG000000956.1 (SMESG000000956.1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.522e-8
Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 3
Query:  273 NARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            N RER+R++ +N AF  LR  IP     KR+SKV TLR+AI YI  L +L+++D
Sbjct:  108 NIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSD 161          
BLAST of Achaete-scute-like protein vs. Planmine SMEST
Match: SMESG000079648.1 (SMESG000079648.1)

HSP 1 Score: 51.9878 bits (123), Expect = 2.921e-8
Identity = 33/82 (40.24%), Postives = 45/82 (54.88%), Query Frame = 3
Query:  189 SKFDTKTAEKKKRTSNEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIENRRKRVSKVRTLRVAIDYIKSLSQLLEND 434
            S F +K   + K    +K  LV      N RER+R++ +N AF  LR  IP     KR+SKV TLR+AI YI  L  L++ +
Sbjct:   82 SGFSSKYRNRNKTRRGQK--LVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE 161          
The following BLAST results are available for this feature:
BLAST of Achaete-scute-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASCL42.411e-1161.11achaete-scute family bHLH transcription factor 4 [... [more]
HAND28.547e-1149.09heart and neural crest derivatives expressed 2 [So... [more]
HAND21.264e-1049.09heart and neural crest derivatives expressed 2 [So... [more]
ASCL32.160e-1055.36achaete-scute family bHLH transcription factor 3 [... [more]
PTF1A7.352e-1051.85pancreas associated transcription factor 1a [Sourc... [more]
back to top
BLAST of Achaete-scute-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hlh-49.652e-1146.88Helix-loop-helix protein 4 [Source:UniProtKB/Swis... [more]
hlh-61.574e-1054.55Helix-loop-helix protein 6 [Source:UniProtKB/Swis... [more]
lin-321.311e-932.79pep chromosome:WBcel235:X:2229208:2230122:-1 gene:... [more]
cnd-12.619e-942.11Neurogenic differentiation factor 1 [Source:UniPr... [more]
hlh-144.796e-949.15Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:Q09... [more]
back to top
BLAST of Achaete-scute-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sc1.074e-1043.48gene:FBgn0004170 transcript:FBtr0070073[more]
ac1.626e-1042.47gene:FBgn0000022 transcript:FBtr0070072[more]
cato4.782e-1037.80gene:FBgn0024249 transcript:FBtr0087183[more]
Fer16.003e-948.15gene:FBgn0037475 transcript:FBtr0081567[more]
Fer16.071e-948.15gene:FBgn0037475 transcript:FBtr0334670[more]
back to top
BLAST of Achaete-scute-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tcf151.865e-1041.56transcription factor 15 [Source:ZFIN;Acc:ZDB-GENE-... [more]
hand23.918e-1045.45heart and neural crest derivatives expressed 2 [So... [more]
ptf1a9.326e-1050.00pancreas associated transcription factor 1a [Sourc... [more]
atoh1a1.116e-942.11atonal bHLH transcription factor 1a [Source:ZFIN;A... [more]
AL807792.21.180e-942.11pep chromosome:GRCz11:CHR_ALT_CTG8_2_5:29594098:29... [more]
back to top
BLAST of Achaete-scute-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hand21.304e-1049.09heart and neural crest derivatives expressed 2 [So... [more]
PTF1A6.202e-1051.85pancreas associated transcription factor 1a [Sourc... [more]
gsk3b1.644e-948.08glycogen synthase kinase 3 beta [Source:Xenbase;Ac... [more]
gsk3b1.706e-948.08glycogen synthase kinase 3 beta [Source:Xenbase;Ac... [more]
gsk3b1.769e-948.08glycogen synthase kinase 3 beta [Source:Xenbase;Ac... [more]
back to top
BLAST of Achaete-scute-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hand28.681e-1149.09heart and neural crest derivatives expressed 2 [So... [more]
Ascl33.050e-1052.54achaete-scute family bHLH transcription factor 3 [... [more]
Ascl53.866e-1056.36achaete-scute family bHLH transcription factor 5 [... [more]
Ptf1a5.935e-1051.85pancreas specific transcription factor, 1a [Source... [more]
Hand12.198e-936.71heart and neural crest derivatives expressed 1 [So... [more]
back to top
BLAST of Achaete-scute-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6XD76|ASCL4_HUMAN1.174e-1061.11Achaete-scute homolog 4 OS=Homo sapiens OX=9606 GN... [more]
sp|Q90690|HAND2_CHICK4.389e-1049.09Heart- and neural crest derivatives-expressed prot... [more]
sp|P61295|HAND2_RAT6.072e-1049.09Heart- and neural crest derivatives-expressed prot... [more]
sp|Q61039|HAND2_MOUSE6.072e-1049.09Heart- and neural crest derivatives-expressed prot... [more]
sp|P61296|HAND2_HUMAN6.072e-1049.09Heart- and neural crest derivatives-expressed prot... [more]
back to top
BLAST of Achaete-scute-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A7M2245.240e-8097.52Achaete-scute class A transcription factor (Fragme... [more]
R7UMI72.158e-1463.79BHLH domain-containing protein (Fragment) OS=Capit... [more]
A0A443S4P54.666e-1464.29Achaete-scute 1a-like protein (Fragment) OS=Leptot... [more]
A0A267FCT86.979e-1462.30BHLH domain-containing protein OS=Macrostomum lign... [more]
A0A267GSH97.146e-1462.30BHLH domain-containing protein OS=Macrostomum lign... [more]
back to top
BLAST of Achaete-scute-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASCL41.165e-1138.14achaete-scute homolog 4-like [Source:NCBI gene;Acc... [more]
tcf154.200e-1140.26transcription factor 15 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000041861.11.207e-1055.36pep primary_assembly:Astyanax_mexicanus-2.0:22:173... [more]
hand21.431e-1045.45heart and neural crest derivatives expressed 2 [So... [more]
si:ch211-246m6.47.616e-1043.42transcription factor 15-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Achaete-scute-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASCL43.553e-1156.36achaete-scute family bHLH transcription factor 4 [... [more]
ENSPMAT00000004072.11.999e-948.15pep scaffold:Pmarinus_7.0:GL492732:1750:4325:-1 ge... [more]
TWIST14.908e-947.27twist family bHLH transcription factor 1 [Source:H... [more]
si:dkey-34f9.36.015e-948.15si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
neurod11.056e-843.86neuronal differentiation 1 [Source:NCBI gene;Acc:3... [more]
back to top
BLAST of Achaete-scute-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Achaete-scute-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO317501.531e-1257.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVAS-C25.202e-1255.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438491.022e-1052.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVATO23.317e-1046.30Atonal-related protein 2; Predicted protein [Sour... [more]
EDO429075.750e-1052.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Achaete-scute-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASCL43.783e-1260.71achaete-scute family bHLH transcription factor 4 [... [more]
ENSORLT00000013528.21.229e-1154.24pep primary_assembly:ASM223467v1:5:20413359:204175... [more]
tcf151.384e-1037.04transcription factor 15 [Source:NCBI gene;Acc:1011... [more]
tal13.212e-1054.55T-cell acute lymphocytic leukemia protein 1 [Sourc... [more]
ptf1a3.579e-1050.00pancreas associated transcription factor 1a [Sourc... [more]
back to top
BLAST of Achaete-scute-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026861.14.514e-9298.45SMESG000026861.1[more]
SMESG000044960.11.826e-950.00SMESG000044960.1[more]
SMESG000044395.13.072e-949.15SMESG000044395.1[more]
SMESG000000956.11.522e-850.00SMESG000000956.1[more]
SMESG000079648.12.921e-840.24SMESG000079648.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007346 ID=SMED30007346|Name=Achaete-scute-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=542bp
GTTCGCTTTTTCCATTTCAACTCTGTTGACATTGTCTATTTAGTGGAGCC
ATGAGTCGGACAAATGAAGTCAAATCTCAATACCCCTTCAATCATGAATG
TCACCCGATTAATCAGCAAACCCTATTTGAAAAATACTGTGAAATCACAT
TTGGAATTGAGAAATCGGGTTACGACTGCATTGGTTATTCGAAATTCGAC
ACGAAGACCGCAGAAAAGAAAAAGCGAACCTCGAATGAAAAGTCAATATT
GGTCATGAATATCGCGAAGCGAAACGCCCGAGAGCGGAAACGGGTGGAAC
AGGTCAACAATGCGTTCGCAGAACTGCGGAAGTGTATTCCGATTGAAAAC
CGAAGAAAGAGAGTTTCAAAAGTTCGAACTTTGAGAGTCGCGATTGATTA
CATCAAATCATTGTCTCAGCTTTTAGAAAATGACGATTGATTGGTTCGCA
GATAATTTTTTGCACCAATCAAATTGATGTTATATAGTTTGTTATTGAAT
ACTGTTGAGAAATAAATCATTATTTTTTCTTTTGAAAAAAAA
back to top

protein sequence of SMED30007346-orf-1

>SMED30007346-orf-1 ID=SMED30007346-orf-1|Name=SMED30007346-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=130bp
MSRTNEVKSQYPFNHECHPINQQTLFEKYCEITFGIEKSGYDCIGYSKFD
TKTAEKKKRTSNEKSILVMNIAKRNARERKRVEQVNNAFAELRKCIPIEN
RRKRVSKVRTLRVAIDYIKSLSQLLENDD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000039gamma neoblast
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0000484secretory system
PLANA:0003117parapharyngeal cell
PLANA:0007552nu neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036638HLH_DNA-bd_sf
IPR015660MASH1/Ascl1a-like
IPR011598bHLH_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSMARTSM00353finuluscoord: 75..127
e-value: 7.6E-16
score: 68.6
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 73..121
e-value: 3.6E-16
score: 58.8
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 69..121
score: 14.894
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainCDDcd00083HLHcoord: 73..126
e-value: 1.66728E-14
score: 61.4611
IPR036638Helix-loop-helix DNA-binding domain superfamilyGENE3DG3DSA:4.10.280.10coord: 72..127
e-value: 3.3E-21
score: 76.8
IPR036638Helix-loop-helix DNA-binding domain superfamilySUPERFAMILYSSF47459HLH, helix-loop-helix DNA-binding domaincoord: 73..126
IPR015660Achaete-scute transcription factor-relatedPANTHERPTHR13935ACHAETE-SCUTE TRANSCRIPTION FACTOR-RELATEDcoord: 57..128
NoneNo IPR availablePANTHERPTHR13935:SF83ACHAETE-SCUTE COMPLEX PROTEIN T3-RELATEDcoord: 57..128