Tud-1

Overview
NameTud-1
Smed IDSMED30007343
Length (bp)3953
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tud-1 (SMED30007343) t-SNE clustered cells

Violin plots show distribution of expression levels for Tud-1 (SMED30007343) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tud-1 (SMED30007343) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tud-1 (SMED30007343) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007343

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007343SMESG000043684.1 SmedASXL_003070SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30007343SMESG000043684.1 dd_Smed_v4_3741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007343SMESG000043684.1 dd_Smed_v4_3741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007343SMESG000043684.1 dd_Smed_v4_3741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007343SMESG000043684.1 dd_Smed_v4_3741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007343SMESG000043684.1 dd_Smed_v4_3741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007343SMESG000043684.1 dd_Smed_v4_3741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007343SMESG000043684.1 Contig24113newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
X1 cellSMED30007343SMESG000043684.1 SMESG000034836.1 SMED30007343smed_20140614PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30007343SMESG000043684.1 SMESG000034836.1 SMED30007343smed_20140614PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30007343SMESG000043684.1 isotig12304be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30007343SMESG000043684.1 dd_Smed_v6_3741_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30007343SMESG000034836.1 Contig32799newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30007343SMESG000043684.1 dd_Smed_v4_3741_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tud-1 vs. TrEMBL
Match: V5W3W8 (Tud-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 5.969e-50
Identity = 171/541 (31.61%), Postives = 270/541 (49.91%), Query Frame = 2
Query: 1559 IRVEIIELNDVSSILARPLILTEDSKPQLTDILDVVNDNVHSLADVRVPEINCFYMAKWTDDNKFYRAKLLEKSGNNQYKVCFVDEGTSGDIVRELKEIPR-EVADIPSQFLPCDMQCEPSXXXXXXXXXXXXXXQVNIYVTNGELIDGKYRINLFLNDIDVIKLYK--DEYNRDPRINKIPNECDLKKYKINSEFSDFQLINYPKEHRDIFEIVLIDPFRINPKMEPL-SGSPIKGDVLIYRQ----SESYLHRCVVESTRFVNTTLHYTIRLVDENRSIETTS-DSLFQTNFQCLETPPRIIRCVMD--LNCDRL-LPGEEVEKIKIVD-------------IDQKKNLYAISVVKAKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFM-----EENFRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRLPVEIQSEKNSEVVQL---LMEYCENGQVPVTVEVVSDSNGIFTVNLFAE 3082
            I +EI++L+ V  IL RP+  TE+SK ++ D+L  +N N  +L  V  P+I  F +AKWT+D+ +YRA+LL+   +  +KV FVDEGTSGDIV +LK IP   +   P QFL   + C  ++EL + I+       + IY   GE  D    +NLFLN+ ++++ Y   ++ N   + ++  ++  +   + NS FS   +     ++R+ F I+ +  F I+ K +   +  PI GD+ IY +     ES+L RCV+   +       + I L+D    I   + D L+      ++  P  I C +D  +N D + LP + ++ +                 I  +K  Y  + V  K       LIG+   VI+SHV S   F+++  D      L  IQ+ +N NY  S F S  ++ + + VIAPF+      E FRA + E   E   I+V FIDYGN EWV    L+     + + P  A  C+L + I+ E  S  ++L   L  Y EN Q    ++V+S       V+L +E
Sbjct:  174 IDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWL-GEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFS---IAPSMYKNRNDF-ILQMKTFSISLKQKKCPTVLPIPGDICIYEKRNANGESFL-RCVILRRQL----FSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKNNKYTVNFILPQKKAYEYAKVSYK------DLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISE 698          
BLAST of Tud-1 vs. TrEMBL
Match: C0L3L0 (Tudor domain containing 1 OS=Schmidtea polychroa OX=50054 GN=oltud-1 PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 6.264e-50
Identity = 176/554 (31.77%), Postives = 270/554 (48.74%), Query Frame = 2
Query: 1559 IRVEIIELNDVSSILARPLILTEDSKPQLTDILDVVNDNVHSLADVRVPEINCFYMAKWTDDNKFYRAKLLEKSGNNQYKVCFVDEGTSGDIVRELKEIPR-EVADIPSQFLPCDMQCEPSXXXXXXXXXXXXXXQVNIYVTNGELIDGKYRINLFLNDIDVIKLYKDEYNRDPRINKIPNECDLKKYKINSEFSDFQLINYPKEHRDIFEIVLI---DPFRINPKMEPLSGS--------PIKGDVLIYRQ----SESYLHRCVVESTRFVNTTLHYTIRLVDENRSIETTS-DSLFQTNFQCLETPPRIIRCVMD----LNCDRLLPGEEVEKIKIVDIDQKKNLYAISV-VKAKPIKPIQKL-----IGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFM-----EENFRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRLPVEIQSEKNSEVVQL---LMEYCENGQVPVTVEVVSDSNGIFTVNLFAENNKKSFVEVLK 3115
            + +EI++L+ V  IL RP+  TE+SK ++ D+L  +N N  +L  V  P++  FY+AKWT+D+ +YRA+LL+      +KV FVDEGTSGDIV +LK IP   +   P QFL   + C   +EL + II       + IY   GE  D    +NLFLN+ ++++ Y        +INKI    +++K K++  F D  + N        F   +    + F +  K   +S S        PI GD+ IY +     ES+L   ++    F      + I L+D    I   + D+L+      L+  P  I C +D    L+ DRLL       I  +   ++ N Y +S  +  K +    K+     IG+   VI+SHV S   F+++  D +    L  IQ+ +N NY  S+F S  +++  + VIAPF+      E FRA + E   E   I+V FIDYGN EWV    L+ +   +   P  A  C+L + I+ E  S   +L   L  Y EN Q    ++V+        V+L +E  K S   +L+
Sbjct:  174 VDIEIVDLSRVDLILIRPVKPTENSKIEIADLLSQINSNQSNLVPVDCPKVGDFYLAKWTEDDCYYRAELLDILKEGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDVKELMSFIIHESEGKVIKIYWL-GEYCDSIPVVNLFLNEDEIVEKY-------AQINKI----NIRK-KLSHTFDDLPVHNLETSSHFSFVPSMYKNENEFILQMKNSSISLSHKKCPTVLPIPGDICIYEKRNSTGESFLRSVILRRQLF-----SFDIELIDIGEKIMNVNIDNLYTAEESHLKNAPCAITCDLDNSVNLDGDRLLQVLIDGVIFNLKKYKRNNKYTVSFNLPEKKVYEYAKVSYKDFIGKSFKVIMSHVVSPINFFIQLDDGDNQLALGDIQEKLNINYSGSAFKSVGDVNITQAVIAPFIVSGTDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNVNEELITKPGFAIHCKLSLNIRKEAWSHANELFSDLAGYSENDQGAFVMQVIGVDGDTLVVDLISE-MKGSLTAILE 708          
BLAST of Tud-1 vs. TrEMBL
Match: A4V6J8 (Tudor protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.098e-12
Identity = 53/162 (32.72%), Postives = 82/162 (50.62%), Query Frame = 2
Query: 2579 QKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFM-----EENFRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRLPVEIQSEKNS---EVVQLLMEYCENGQVPVTVEVV 3040
            ++ +G+   V +SH  S   FY++F +  ++  L  IQ+ +N NY  S F +   L  N+ V+APF+      E FRA + E   E   ++V FIDYGN EWV    L  +  ++      A  C+L + I+ E  S   E+   L+ Y EN Q    +EV+
Sbjct:   45 EEYVGKSSKVTVSHFISPINFYIQFDEAESALALGDIQEKLNLNYNGSHFKNIDGLKINQAVVAPFIVSGSDSELFRAKVLEKRKESPQVHVLFIDYGNDEWVNFETLQNVDSDLVKKSGFAYHCQLNLNIKKEAWSNANEIFSDLIGYTENEQGGFVMEVI 206          
BLAST of Tud-1 vs. TrEMBL
Match: A0A1W5RU41 (Tudor domain containing protein 1 (Fragment) OS=Oopsacas minuta OX=111878 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.660e-8
Identity = 55/188 (29.26%), Postives = 92/188 (48.94%), Query Frame = 2
Query: 2414 QCLETPPRIIRCVMDLNCDRL---LPGEEVEKIKIVDIDQKKNLYAISVVKAKPIKPIQ-KLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEI-----VIAPFMEEN--FRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRL 2944
            + LE P + I C++    ++    +   E  KIK+ ++D +K    +     K I  ++   +G+++ V LSH+ S  EFY +      S N N +  II     LS F++T  L   EI      +  F E++  +R +I +I   K+ I V F+DYGN E +    + ++  NIS+ P  A KC +
Sbjct:  937 ELLELPSQAIPCMLPQEVEKFRENIEAHEYVKIKVTNVDGEKTTVDVFTTDGKIIYKMKPSPVGKKMEVYLSHMISPYEFYCQ------STNANTLDTIITL---LSEFTNTTRLESQEIKPGQVCLGVFSEDSSLYRGIIIQIIEAKAKILVQFMDYGNSEVIHPSKIYQMPSNISSFPTQAYKCAI 1115          
BLAST of Tud-1 vs. TrEMBL
Match: I4DQ73 (Tudor domain-containing protein (Fragment) OS=Papilio xuthus OX=66420 PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 9.711e-7
Identity = 46/142 (32.39%), Postives = 75/142 (52.82%), Query Frame = 2
Query: 2588 IGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFMEEN--FRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRL------PVEIQSEKNSEVVQL 2989
            +G R SV++S+V+S  +FYV+ SD    E LN + D +  +    S SS  EL       A F +++  +RA +K+    K  + V ++DYGN + + + DL  +  ++  LPA A KC L      PVE ++    E++ L
Sbjct:   18 LGSRRSVLVSYVDSCIKFYVQLSD--KIEELNSVMDAVKVH--CESKSSPGELPVGAACCARFPDDDNWYRARVKDTKGNK--VIVTYVDYGNEQEINVSDLRTITPDLIRLPAQALKCALKGYENKPVETKTSNQLEMLAL 153          
BLAST of Tud-1 vs. Ensembl Cavefish
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:103044565])

HSP 1 Score: 52.373 bits (124), Expect = 4.448e-6
Identity = 53/234 (22.65%), Postives = 108/234 (46.15%), Query Frame = 2
Query: 2552 VKAKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDI---INSNYPLSSFSSTRELSKNEIVIAPFMEEN--FRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRLP-VEIQSEKNSEVVQLLMEYCENGQVPVTVEVVSDSNGIFTVNLFAENNKKSFVEVLKMKKLTNEETVGNADIRKDMIARILDIEKRIENLERIAGNL 3235
            + A+P +P+ + +G   + I++H++S  E   +       EN + IQ +   +  +   +  S     +   +  + F E+N  +RA +   +SE   + V ++D+GN E V+L+ L  +   + AL   A  C L  ++  SE  SE V L+++     +  + VE++ + +G+  V++  E++      + +M   T    VGN +  K+    +      ++ LE     L
Sbjct:  399 IDAQPPEPLTQGVGDTFTAIVTHLQSPSEIICQ-----KLENASAIQQLQMSLREHCTKTPASENFRPAPGTVCCSLFSEDNQWYRAKVLAYSSEDR-VCVGYVDFGNSEEVELIHLRPVSMELLALATQAIPCALAGIKPTSEAWSEEVILMLKRLVCNRF-IQVEILGERDGMALVSMVDESSDPQ-TNIAEMLVATGYAAVGNMETVKEATKEVESKSPAVDKLEWTCAEL 624          
BLAST of Tud-1 vs. Ensembl Nematostella
Match: EDO44059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWZ4])

HSP 1 Score: 51.2174 bits (121), Expect = 3.727e-6
Identity = 42/140 (30.00%), Postives = 68/140 (48.57%), Query Frame = 2
Query: 1691 DVRVPEINCFYM--AKWTDDNKFYRAKLLEKSGNNQYKVCFVDEGTSGDI-VRELKEIPREVADIPSQFLPCDMQCEPSXXXXXXXXXXXXXXQVNIYVTNGELIDGK---YRINLFLNDIDVIKLYKDEYNRDPRINKI 2092
            DV   E+   Y+  A W +D +FYRAK+L K  NN+++V F+D G    + +  LK+I  ++  +P Q     M CE          +   + Q N   T  EL+  +    ++   L+D+  + LY    N+D  IN+I
Sbjct:  923 DVDASEVYQGYLCIALWDEDEQFYRAKVLSKHPNNEFEVMFLDFGNVSRVKLTSLKKITPQLLQLPFQAFEV-MLCEIQPANMPDCPTGMWSHQANQRFT--ELVQNRNLVAKVYSQLHDVLRVDLYDTNTNQDIHINQI 1059          
BLAST of Tud-1 vs. Ensembl Medaka
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:100144383])

HSP 1 Score: 52.7582 bits (125), Expect = 3.263e-6
Identity = 45/141 (31.91%), Postives = 70/141 (49.65%), Query Frame = 2
Query: 2558 AKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDI-INSNYPLSSFSSTREL--SKNEIVIAPFMEEN--FRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRL----PVE 2953
            A+P +P+   IG R SV++SH +S  +F V+       EN   IQD+ +      S   + ++   +   +  A F E+   +RA +   ++EKS + V +ID+GN E V L  L  +   + ALP  A  C L    PVE
Sbjct:  376 AQPPEPLTLTIGDRFSVVVSHFQSPTDFIVQ-----KVENAGVIQDLQLKLREHCSGVETQQDFRPAPGTVCCAQFSEDKQWYRAQVLAYSTEKS-VCVGYIDFGNSEEVDLNHLRPISPALLALPKQAISCILAGVQPVE 510          
BLAST of Tud-1 vs. Ensembl Medaka
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:100144383])

HSP 1 Score: 52.7582 bits (125), Expect = 3.323e-6
Identity = 45/141 (31.91%), Postives = 70/141 (49.65%), Query Frame = 2
Query: 2558 AKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDI-INSNYPLSSFSSTREL--SKNEIVIAPFMEEN--FRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRL----PVE 2953
            A+P +P+   IG R SV++SH +S  +F V+       EN   IQD+ +      S   + ++   +   +  A F E+   +RA +   ++EKS + V +ID+GN E V L  L  +   + ALP  A  C L    PVE
Sbjct:  376 AQPPEPLTLTIGDRFSVVVSHFQSPTDFIVQ-----KVENAGVIQDLQLKLREHCSGVETQQDFRPAPGTVCCAQFSEDKQWYRAQVLAYSTEKS-VCVGYIDFGNSEEVDLNHLRPISPALLALPKQAISCILAGVQPVE 510          
BLAST of Tud-1 vs. Ensembl Medaka
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:100144383])

HSP 1 Score: 52.7582 bits (125), Expect = 3.323e-6
Identity = 45/141 (31.91%), Postives = 70/141 (49.65%), Query Frame = 2
Query: 2558 AKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDI-INSNYPLSSFSSTREL--SKNEIVIAPFMEEN--FRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRL----PVE 2953
            A+P +P+   IG R SV++SH +S  +F V+       EN   IQD+ +      S   + ++   +   +  A F E+   +RA +   ++EKS + V +ID+GN E V L  L  +   + ALP  A  C L    PVE
Sbjct:  376 AQPPEPLTLTIGDRFSVVVSHFQSPTDFIVQ-----KVENAGVIQDLQLKLREHCSGVETQQDFRPAPGTVCCAQFSEDKQWYRAQVLAYSTEKS-VCVGYIDFGNSEEVDLNHLRPISPALLALPKQAISCILAGVQPVE 510          
BLAST of Tud-1 vs. Ensembl Medaka
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:100144383])

HSP 1 Score: 52.7582 bits (125), Expect = 3.357e-6
Identity = 45/141 (31.91%), Postives = 70/141 (49.65%), Query Frame = 2
Query: 2558 AKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDI-INSNYPLSSFSSTREL--SKNEIVIAPFMEEN--FRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRL----PVE 2953
            A+P +P+   IG R SV++SH +S  +F V+       EN   IQD+ +      S   + ++   +   +  A F E+   +RA +   ++EKS + V +ID+GN E V L  L  +   + ALP  A  C L    PVE
Sbjct:  385 AQPPEPLTLTIGDRFSVVVSHFQSPTDFIVQ-----KVENAGVIQDLQLKLREHCSGVETQQDFRPAPGTVCCAQFSEDKQWYRAQVLAYSTEKS-VCVGYIDFGNSEEVDLNHLRPISPALLALPKQAISCILAGVQPVE 519          
BLAST of Tud-1 vs. Ensembl Medaka
Match: amh (Oryzias latipes anti-Mullerian hormone (amh), mRNA. [Source:RefSeq mRNA;Acc:NM_001360941])

HSP 1 Score: 52.373 bits (124), Expect = 4.514e-6
Identity = 36/128 (28.12%), Postives = 67/128 (52.34%), Query Frame = 2
Query: 2567 IKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFMEEN--FRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRL 2944
            + P +   G R+ V +SH  S   FYV+  D+   E L  + + +N        S  +++   ++V+A F E++  +RA++KEI  E + + + F+D+GN     + ++ RL+ +   LPA +  C L
Sbjct: 1528 LPPSRITAGLRVDVYVSHYNSPLSFYVQRIDE--EEELFSLVEQLNDPEWTQKDSPIQDVHVGDLVLAEFSEDSSWYRAVVKEIQEEHTAL-IEFVDFGNTAEAPVSNMRRLQQSFLQLPAYSTHCML 1652          

HSP 2 Score: 51.9878 bits (123), Expect = 5.122e-6
Identity = 38/144 (26.39%), Postives = 73/144 (50.69%), Query Frame = 2
Query: 2519 DQKKNLYAISVVKAKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFMEEN--FRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRL 2944
            + ++ + A  V +   + P     G R+ V +SH  S   FYV+  D+   E L  + + +N        S  +++   ++V+A F E++  +RA++KEI  E + + + F+D+GN     + ++ RL+ +   LPA +  C L
Sbjct: 1819 ESQQEVDAGKVPQLPELPPSTITAGLRVDVYVSHYNSPLSFYVQRVDE--EEELFSLVEQLNDPEWTQKDSPIQDVHVGDLVLAEFSEDSSWYRAVVKEIQEEHTAL-IEFVDFGNTAEAPVSNMRRLQQSFLQLPAYSTHCML 1959          

HSP 3 Score: 51.2174 bits (121), Expect = 9.473e-6
Identity = 36/128 (28.12%), Postives = 66/128 (51.56%), Query Frame = 2
Query: 2567 IKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFMEEN--FRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRL 2944
            + P +   G R+ V +SH  S   FYV+  D+   E L  + + +N        S  +++   ++V+A F E++  +RA++KEI  E + + + F+D+GN     + ++ RL+     LPA +  C L
Sbjct: 1221 LPPSRITAGLRVDVYVSHYNSPLSFYVQRIDE--EEELFSLVEQLNDPEWTQKDSPIQDVHVGDLVLAEFSEDSSWYRAVVKEIQEEHTAL-IEFVDFGNTAEAPVSNMRRLQQPFLQLPAYSTHCML 1345          
BLAST of Tud-1 vs. Planmine SMEST
Match: SMESG000043684.1 (SMESG000043684.1)

HSP 1 Score: 1105.12 bits (2857), Expect = 0.000e+0
Identity = 569/600 (94.83%), Postives = 576/600 (96.00%), Query Frame = 2
Query: 1460 RRQKLVMG-DVLNGCSDISNLNK----LSFYQ**IQTKIRVEIIELNDVSSILARPLILTEDSKPQLTDILDVVNDNVHSLADVRVPEINCFYMAKWTDDNKFYRAKLLEKSGNNQYKVCFVDEGTSGDIVRELKEIPREVADIPSQFLPCDMQCEPSXXXXXXXXXXXXXXQVNIYVTNGELIDGKYRINLFLNDIDVIKLYKDEYNRDPRINKIPNECDLKKYKINSEFSDFQLINYPKEHRDIFEIVLIDPFRINPKMEPLSGSPIKGDVLIYRQSESYLHRCVVESTRFVNTTLHYTIRLVDENRSIETTSDSLFQTNFQCLETPPRIIRCVMDLNCDRLLPGEEVEKIKIVDIDQKKNLYAISVVKAKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFMEENFRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRLPVEIQSEKNSEVVQLLMEYCENGQVPVTVEVVSDSNGIFTVNLFAENNKKSFVEVLKMKKLTNEETVGNADIRKDMIARILDIEKRIENLERIAGNLHSK 3244
            R Q    G  ++N C  +  L +    LS+    + TKIRVEIIELNDVSSILARPLILTEDSKPQLTDILDVVNDNVHSLADVRVPEINCFYMAKWTDDNKFYRAKLLEKSGNNQYKVCFVDEGTSGDIVRELKEIPREVADIPSQFLPCDMQCEPSEELNNLIISNGNNSQVNIYVTNGELIDGKYRINLFLNDIDVIKLYKDEYNRDPRINKIPNECDLKKYKINSEFSDFQLINYPKEHRDIFEIVLIDPFRINPKMEPLSGSPIKGDVLIYRQSESYLHRCVVESTRFVNTTLHYTIRLVDENRSIET SDSLFQTNFQCLETPPRIIRCVMDLNCDRLLPGEEVEKIKIVDIDQKKNLYAISVVKAKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFMEENFRA IKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRLPVEIQSEKNSEVVQLLMEYCENGQVPVTVEVVSDSNGIFTV+LFAENNKKSFVEVLKMKKLTNEETVGNADIRKDMIARILDIEKRIENLERIAGNLHSK
Sbjct:   99 RMQSFGRGRGMINECGRVPRLTQSCIVLSYINIPLNTKIRVEIIELNDVSSILARPLILTEDSKPQLTDILDVVNDNVHSLADVRVPEINCFYMAKWTDDNKFYRAKLLEKSGNNQYKVCFVDEGTSGDIVRELKEIPREVADIPSQFLPCDMQCEPSEELNNLIISNGNNSQVNIYVTNGELIDGKYRINLFLNDIDVIKLYKDEYNRDPRINKIPNECDLKKYKINSEFSDFQLINYPKEHRDIFEIVLIDPFRINPKMEPLSGSPIKGDVLIYRQSESYLHRCVVESTRFVNTTLHYTIRLVDENRSIETASDSLFQTNFQCLETPPRIIRCVMDLNCDRLLPGEEVEKIKIVDIDQKKNLYAISVVKAKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFMEENFRATIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRLPVEIQSEKNSEVVQLLMEYCENGQVPVTVEVVSDSNGIFTVDLFAENNKKSFVEVLKMKKLTNEETVGNADIRKDMIARILDIEKRIENLERIAGNLHSK 698          

HSP 2 Score: 108.227 bits (269), Expect = 1.453e-23
Identity = 56/72 (77.78%), Postives = 60/72 (83.33%), Query Frame = 2
Query:    2 GLMNGNSNKSVTRMQSFGRGRGMINECGRVPRLTQSCIVLSYINIPLNV-----IIELN*KISVKIKPIKLS 202
            GLMNGNSNKSVTRMQSFGRGRGMINECGRVPRLTQSCIVLSYINIPLN      IIELN   S+  +P+ L+
Sbjct:   87 GLMNGNSNKSVTRMQSFGRGRGMINECGRVPRLTQSCIVLSYINIPLNTKIRVEIIELNDVSSILARPLILT 158          
BLAST of Tud-1 vs. Planmine SMEST
Match: SMESG000029236.1 (SMESG000029236.1)

HSP 1 Score: 201.83 bits (512), Expect = 1.083e-53
Identity = 170/541 (31.42%), Postives = 270/541 (49.91%), Query Frame = 2
Query: 1559 IRVEIIELNDVSSILARPLILTEDSKPQLTDILDVVNDNVHSLADVRVPEINCFYMAKWTDDNKFYRAKLLEKSGNNQYKVCFVDEGTSGDIVRELKEIPR-EVADIPSQFLPCDMQCEPSXXXXXXXXXXXXXXQVNIYVTNGELIDGKYRINLFLNDIDVIKLYK--DEYNRDPRINKIPNECDLKKYKINSEFSDFQLINYPKEHRDIFEIVLIDPFRINPKMEPL-SGSPIKGDVLIYRQ----SESYLHRCVVESTRFVNTTLHYTIRLVDENRSIETTS-DSLFQTNFQCLETPPRIIRCVMD--LNCDRL-LPGEEVEKIKIVD-------------IDQKKNLYAISVVKAKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFM-----EENFRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRLPVEIQSEKNSEVVQL---LMEYCENGQVPVTVEVVSDSNGIFTVNLFAE 3082
            I +EI++L+ V  IL RP+  TE+SK ++ D+L  +N N  +L  V  P+I  F +AKWT+D+ +YRA+LL+   +  +KV FVDEGTSGDIV +LK IP   +   P QFL   + C  ++EL + I+       + IY   GE  D    +NLFLN+ ++++ Y   ++ N   + ++  ++  +   + NS FS   +     ++R+ F I+ +  F ++ K +   +  PI GD+ IY +     ES+L RCV+   +       + I L+D    I   + D L+      ++  P  I C +D  +N D + LP + ++ +                 I  +K  Y  + V  K       LIG+   VI+SHV S   F+++  D      L  IQ+ +N NY  S F S  ++ + + VIAPF+      E FRA + E   E   I+V FIDYGN EWV    L+     + + P  A  C+L + I+ E  S  ++L   L  Y EN Q    ++V+S       V+L +E
Sbjct:  120 IDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWL-GEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFS---IAPSMYKNRNDF-ILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFL-RCVILRRQL----FSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKNNKYTVNFILPQKKAYEYAKVSYK------DLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISE 644          
BLAST of Tud-1 vs. Planmine SMEST
Match: SMESG000029232.1 (SMESG000029232.1)

HSP 1 Score: 201.83 bits (512), Expect = 1.083e-53
Identity = 170/541 (31.42%), Postives = 270/541 (49.91%), Query Frame = 2
Query: 1559 IRVEIIELNDVSSILARPLILTEDSKPQLTDILDVVNDNVHSLADVRVPEINCFYMAKWTDDNKFYRAKLLEKSGNNQYKVCFVDEGTSGDIVRELKEIPR-EVADIPSQFLPCDMQCEPSXXXXXXXXXXXXXXQVNIYVTNGELIDGKYRINLFLNDIDVIKLYK--DEYNRDPRINKIPNECDLKKYKINSEFSDFQLINYPKEHRDIFEIVLIDPFRINPKMEPL-SGSPIKGDVLIYRQ----SESYLHRCVVESTRFVNTTLHYTIRLVDENRSIETTS-DSLFQTNFQCLETPPRIIRCVMD--LNCDRL-LPGEEVEKIKIVD-------------IDQKKNLYAISVVKAKPIKPIQKLIGQRISVILSHVESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAPFM-----EENFRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPAVAKKCRLPVEIQSEKNSEVVQL---LMEYCENGQVPVTVEVVSDSNGIFTVNLFAE 3082
            I +EI++L+ V  IL RP+  TE+SK ++ D+L  +N N  +L  V  P+I  F +AKWT+D+ +YRA+LL+   +  +KV FVDEGTSGDIV +LK IP   +   P QFL   + C  ++EL + I+       + IY   GE  D    +NLFLN+ ++++ Y   ++ N   + ++  ++  +   + NS FS   +     ++R+ F I+ +  F ++ K +   +  PI GD+ IY +     ES+L RCV+   +       + I L+D    I   + D L+      ++  P  I C +D  +N D + LP + ++ +                 I  +K  Y  + V  K       LIG+   VI+SHV S   F+++  D      L  IQ+ +N NY  S F S  ++ + + VIAPF+      E FRA + E   E   I+V FIDYGN EWV    L+     + + P  A  C+L + I+ E  S  ++L   L  Y EN Q    ++V+S       V+L +E
Sbjct:  120 IDIEIVDLSRVDIILIRPVKSTENSKIEIADLLSQINSNKSNLMPVDCPKIGDFCLAKWTEDDCYYRAELLDILKDGSFKVTFVDEGTSGDIVTDLKHIPTGALQQYPKQFLKVSIGCSDAKELMSFILQESEGKVIKIYWL-GEYCDSVPVVNLFLNEDEIVEKYTQINKVNIRKKFSQTFDDLPVHNLETNSHFS---IAPSMYKNRNDF-ILQMKTFSVSLKQKKCPTVLPIPGDICIYEKRNANGESFL-RCVILRRQL----FSFDIELIDIGEKIMNVNIDHLYTVEDIHVKDAPCAITCDLDSSINIDGIKLPQDLIDGVLFNLKKYNKNNKYTVNFILPQKKAYEYAKVSYK------DLIGKSFKVIMSHVVSPINFFIQLDDGEHQLALGDIQEKLNINYNGSPFKSASDVKETQAVIAPFIVSGSDAELFRAYVLEKRKESPQIHVLFIDYGNDEWVNYETLLNTNEELVSKPGFAIHCKLSLNIKKEAWSHAIELFNDLAGYTENDQGTFVMQVISVDGDSLVVDLISE 644          
BLAST of Tud-1 vs. Planmine SMEST
Match: SMESG000081435.1 (SMESG000081435.1)

HSP 1 Score: 114.775 bits (286), Expect = 8.173e-30
Identity = 54/65 (83.08%), Postives = 57/65 (87.69%), Query Frame = 2
Query: 1724 MAKWTDDNKFYRAKLLEKSGNNQYKVCFVDEGTSGDIVRELKEIPREVADIPSQFLPCDMQCEPS 1918
            MAKW DDNKFYRAK LEKS NNQYKVCFVDE TSG+IVRELKEIP+ V D+PSQFLPC MQ EPS
Sbjct:    1 MAKWIDDNKFYRAKHLEKSVNNQYKVCFVDERTSGEIVRELKEIPKGVLDVPSQFLPCKMQLEPS 65          
BLAST of Tud-1 vs. Planmine SMEST
Match: SMESG000056144.1 (SMESG000056144.1)

HSP 1 Score: 54.6842 bits (130), Expect = 6.293e-8
Identity = 25/52 (48.08%), Postives = 35/52 (67.31%), Query Frame = 2
Query: 1763 KLLEKSGNNQYKVCFVDEGTSGDIVRELKEIPREVADIPSQFLPCDMQCEPS 1918
            +++EK    Q K+    E   G+   ELKEIP+EV+D+PSQ +PC+MQCE S
Sbjct:  112 EMIEKFRPAQGKIILAGEHAVGERDLELKEIPKEVSDVPSQLMPCEMQCEQS 163          
The following BLAST results are available for this feature:
BLAST of Tud-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tud-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tud-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tud-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tud-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tud-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tud-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tud-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V5W3W85.969e-5031.61Tud-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
C0L3L06.264e-5031.77Tudor domain containing 1 OS=Schmidtea polychroa O... [more]
A4V6J81.098e-1232.72Tudor protein (Fragment) OS=Dugesia japonica OX=61... [more]
A0A1W5RU415.660e-829.26Tudor domain containing protein 1 (Fragment) OS=Oo... [more]
I4DQ739.711e-732.39Tudor domain-containing protein (Fragment) OS=Papi... [more]
back to top
BLAST of Tud-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tdrd14.448e-622.65tudor domain containing 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Tud-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tud-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tud-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO440593.727e-630.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tud-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdrd13.263e-631.91tudor domain containing 1 [Source:NCBI gene;Acc:10... [more]
tdrd13.323e-631.91tudor domain containing 1 [Source:NCBI gene;Acc:10... [more]
tdrd13.323e-631.91tudor domain containing 1 [Source:NCBI gene;Acc:10... [more]
tdrd13.357e-631.91tudor domain containing 1 [Source:NCBI gene;Acc:10... [more]
amh4.514e-628.13Oryzias latipes anti-Mullerian hormone (amh), mRNA... [more]
back to top
BLAST of Tud-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043684.11.453e-2394.83SMESG000043684.1[more]
SMESG000029236.11.083e-5331.42SMESG000029236.1[more]
SMESG000029232.11.083e-5331.42SMESG000029232.1[more]
SMESG000081435.18.173e-3083.08SMESG000081435.1[more]
SMESG000056144.16.293e-848.08SMESG000056144.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007343 ID=SMED30007343|Name=Tud-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3953bp
AGGTTTAATGAACGGAAATTCGAATAAAAGTGTTACTAGAATGCAGAGCT
TTGGTCGAGGTCGAGGTATGATAAATGAGTGTGGTAGAGTTCCAAGATTG
ACACAGTCGTGTATTGTATTAAGCTACATCAACATACCTTTAAATGTAAT
AATTGAACTTAATTAAAAAATATCAGTAAAAATAAAGCCAATAAAATTAT
CTGTTATTGAATTGATAATTAATATTAATTAAAATTAATTTTTAAAATAT
TCTTAACAACTGCTTATATTTTTTAAATGTTTGGTTGAAAGTCATACAAG
GAAATTTTTGTTTAGTCTTCGAGAAAAGTGCCAAAAGTCCCCAACATATC
TAACATATATCTTCATTTTTTATTGTTACTGGTTTATTGAAAGTGGATCC
ATTAATTTCTATTATCAGTTTGTCATAAAGAAAAAGATTTATAAATCATT
TCAAATTTTATAATTTGTAGTTAATTGATAAGAAATGTTAAAATAGTAAA
CCGGAAGCTATTATGGAAAAGATTATGAGCATAATTCAGTAATGTCAACC
CAGGAAAAAATTAAATGTGTGGAATAATTGAGAAAAGCTGATGAAAAATC
ATAAAAACCAATTTGGATATTATTTAAACCAACGTGAGTGCTAGTCGAGT
TTTTGCCGGATGGATATTTGATGTTTTCCTCCAGGGTTTCGCTTATGGCA
CTTGGGAAATGCCGCACAAAAAAATATATCCACAGGTTTATAAAATTTAT
AAAAAATAATTTTGCAGTAAATCATAGAAACTAAGCTGAATGCAGAAAAG
CATATTATTAGTAAAAATTTTAATTTAAATATTGATTTTTTATTATTATA
ATCTCAAATTAATAATGTAGATTAATTGTAATTTCATAATAAAAATATCA
TTCAAATTATTGTTTATATTAAAAGGACCCGATTTTTATTTGAATGCCTG
GATTCAAAATGGATATAAATGTTACTTTGTCCTCTGTTTATTACAATTTA
TGAAATTGTAAGTTGAGTTTCTTTCTTTTAAACTAAGTTAATGGCATAAT
TAATTGCTCACCGAGTTAATTTTTTTTAATTTATAAATAAACCAAAGTAT
TGATCGATAGTTTAAAAAGAAATGAAGATAAAAAGTCGATTATGATCTCA
TTGGTGTGTTTGGTTTTATCTTTTTTTTTAAAAGATAATCGTCTAATTAT
GAATTATTTAATACAATTCCGGCTTAAAATAGAACTAACTTTTAAAAGGA
ATTTTAAGTAATATTTCTTGGTTAATAAATTGAAACATTTTTTATGAAAT
TGAGAGCATCTATTAAGGACGACCCCTAAGAAAGGTGATGGGCTCTCCAC
AGAGGGGACAATAGTGGAGCGGTTTATTAGCCTACAAGAATCTGCCGTAA
CATTCGGTTATCTAAATTTCTGTCCCGAAGAGTTCAAGAAAAGGTATTTA
AAGGGACAAAGGCGTCAAAAATTGGTTATGGGGGACGTCCTTAACGGATG
CTCCGATATTTCCAATTTAAATAAACTTTCATTTTATCAATAATAAATTC
AGACAAAAATCCGGGTTGAAATAATTGAATTGAACGACGTGAGTAGTATT
TTAGCGAGGCCTTTGATTTTGACTGAAGATTCTAAACCGCAATTAACTGA
CATTCTCGATGTCGTAAACGACAATGTTCATTCCTTAGCCGACGTACGAG
TACCGGAAATCAATTGTTTCTATATGGCAAAATGGACAGACGATAACAAA
TTTTATCGTGCGAAACTTCTAGAGAAGTCGGGTAATAATCAATATAAAGT
GTGTTTTGTCGACGAAGGAACTTCTGGAGATATTGTGAGAGAATTAAAAG
AAATTCCCAGAGAGGTTGCAGATATTCCATCCCAATTTTTGCCTTGTGAT
ATGCAATGTGAACCGTCTGAGGAATTGAATAACCTTATAATATCCAATGG
GAATAATTCTCAGGTCAATATTTATGTGACTAACGGTGAATTGATTGATG
GGAAATATCGAATTAATCTTTTTCTTAATGATATTGATGTCATCAAACTA
TATAAAGACGAATACAATCGAGATCCTCGCATTAATAAAATACCAAATGA
ATGTGACTTGAAAAAGTATAAAATCAATTCGGAATTTTCCGATTTCCAAC
TGATTAATTATCCCAAGGAACATCGGGATATTTTCGAAATAGTGCTTATT
GACCCGTTTAGAATAAATCCTAAGATGGAACCGTTAAGTGGATCACCGAT
CAAGGGAGATGTATTAATATATCGACAATCGGAAAGCTATTTGCATCGCT
GTGTGGTTGAATCCACCCGATTTGTCAACACAACCCTTCACTATACCATT
AGATTAGTCGATGAGAATAGATCTATAGAAACAACGAGTGATTCGCTGTT
TCAAACGAACTTCCAATGCTTAGAAACTCCCCCGAGAATCATAAGATGTG
TCATGGATTTGAATTGCGATCGATTACTGCCGGGTGAAGAAGTTGAAAAA
ATAAAAATAGTCGACATTGATCAAAAGAAAAATCTCTACGCAATTTCAGT
GGTAAAGGCTAAACCGATTAAACCGATTCAAAAATTGATTGGTCAAAGAA
TTAGTGTTATTCTCAGTCACGTAGAAAGCAGCGAAGAGTTTTACGTTCGA
TTCAGTGATGATAATACATCGGAAAACCTTAATTGTATTCAAGATATCAT
CAACTCCAATTATCCTTTATCAAGCTTCTCATCGACGAGAGAGCTGTCGA
AAAATGAAATAGTTATCGCGCCGTTTATGGAGGAAAACTTTCGAGCAATG
ATCAAAGAAATAAATTCGGAAAAATCGTTGATTTATGTGTTCTTTATCGA
TTATGGCAATTACGAATGGGTGAAACTGGTGGATTTGGTTAGATTGAAAG
GCAACATAAGCGCTTTGCCAGCGGTTGCAAAAAAATGCCGATTGCCAGTG
GAAATTCAATCGGAGAAAAATTCTGAGGTTGTCCAACTGTTGATGGAATA
CTGCGAAAACGGACAGGTCCCGGTCACTGTTGAAGTGGTTTCGGATTCTA
ATGGAATTTTCACTGTGAATTTGTTTGCTGAGAATAATAAGAAAAGTTTC
GTTGAGGTTTTAAAAATGAAAAAACTCACCAATGAAGAAACTGTGGGAAA
TGCCGATATTAGAAAAGATATGATTGCACGAATATTGGATATTGAAAAAC
GGATTGAAAATTTGGAAAGAATTGCTGGTAATTTGCATTCCAAATAAAGC
GGGCGAGATTTAAGCATTTATGTGTTTCAAATGATGATTTATTATTATTA
TTATTATTAATCATTTTACTAAAATGAAAGATTTATATCCTTATTACGAT
AGATTGTTAAAATTTTTCATTGACATTTTTGTTTACTAGTTTTATTTGTT
GTGATTGGTGTTTCGAATTGCTGTTCATTAATTGGACGATTTTATTTACA
ATTACTTTTTAGTTTTGCATTTCCAAACTTTTTTTGCCTTAATTAATAAT
TTGGTCTCGTCAATCGGTAAGTTTTAATTGATGAAAAATTGTAATTTAAA
TGTGCCATGGCTTGTTTTCTGTAAATAATGAACAATGGGATAATTAAATA
AAATAAATAAATGTTTTTCACTATTTCCAGTCGTAGGAATCGGTAATGCC
AGAAACAATGTCGTAAATTCCATTTTTCGTTACATACGTGATCGGTGGTC
AAATGCTCATGCATAATAATTATATATAATTGATCAATTAAATAATAACC
GGTCGCATACGTTTGGTTTCTTATGCAGCGCTTATATTTGAATCGTTTTA
AGGATTGACCTATTTTCGTGGTTGTCTTGGTTACTAGTGACTTATTTCCA
CAAATTTTGCTGATTGGAATTTCAATTATATAATTATATCGTGACTAATA
AGCCGAAGGTTTCAAAAGGTGATTAATAATAAAGAATTTTAATCATTTCA
AAT
back to top

protein sequence of SMED30007343-orf-1

>SMED30007343-orf-1 ID=SMED30007343-orf-1|Name=SMED30007343-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=508bp
MAKWTDDNKFYRAKLLEKSGNNQYKVCFVDEGTSGDIVRELKEIPREVAD
IPSQFLPCDMQCEPSEELNNLIISNGNNSQVNIYVTNGELIDGKYRINLF
LNDIDVIKLYKDEYNRDPRINKIPNECDLKKYKINSEFSDFQLINYPKEH
RDIFEIVLIDPFRINPKMEPLSGSPIKGDVLIYRQSESYLHRCVVESTRF
VNTTLHYTIRLVDENRSIETTSDSLFQTNFQCLETPPRIIRCVMDLNCDR
LLPGEEVEKIKIVDIDQKKNLYAISVVKAKPIKPIQKLIGQRISVILSHV
ESSEEFYVRFSDDNTSENLNCIQDIINSNYPLSSFSSTRELSKNEIVIAP
FMEENFRAMIKEINSEKSLIYVFFIDYGNYEWVKLVDLVRLKGNISALPA
VAKKCRLPVEIQSEKNSEVVQLLMEYCENGQVPVTVEVVSDSNGIFTVNL
FAENNKKSFVEVLKMKKLTNEETVGNADIRKDMIARILDIEKRIENLERI
AGNLHSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR002999Tudor