TBC1 domain family member 2B

Overview
NameTBC1 domain family member 2B
Smed IDSMED30007341
Length (bp)3059
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TBC1 domain family member 2B (SMED30007341) t-SNE clustered cells

Violin plots show distribution of expression levels for TBC1 domain family member 2B (SMED30007341) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TBC1 domain family member 2B (SMED30007341) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TBC1 domain family member 2B (SMED30007341) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007341

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30007341SMESG000078416.1 dd_Smed_v4_6508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007341SMESG000078416.1 dd_Smed_v4_6508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30007341SMESG000078416.1 dd_Smed_v4_6508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30007341SMESG000078416.1 dd_Smed_v6_6508_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007341SMESG000078416.1 dd_Smed_v4_6508_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30007341SMESG000078416.1 dd_Smed_v4_6508_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TBC1 domain family member 2B vs. Ensembl Human
Match: TBC1D30 (TBC1 domain family member 30 [Source:HGNC Symbol;Acc:HGNC:29164])

HSP 1 Score: 431.024 bits (1107), Expect = 9.654e-137
Identity = 228/478 (47.70%), Postives = 307/478 (64.23%), Query Frame = 2
Query:  455 RLVRQLKRRDHALAKM------QKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGG----MMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQY 1849
            R  R LKR+   +  +      +++C   TA     +L+   DTKLKF +EP  G   F+QW +A+K VARL  G+P E R+KVWL+LA++++     DW++ ++F FNERSNPDDDS+G+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK VGYCQGFN+LAA+ILEVME NE D+LKIM+YL+D +LPESYF  NL+ALS+DMAVFR+ L + +P+L+ HL+ LQ       A+  +   YEPPLTNVFTMQWFLTLFATCLP   VL IWDS+  EGSEII R  LAIW  L +Q+     AD FY TM  LT ++ +  + Q   L+  +Y+MAP PFP L+ LR+++TYNI PF   P+ +      G  +   D+DE+ D   +     ++GC G     + P       + KE     SL S +I+++ PGA+++  S +H A      ERM TD+  L+ QY
Sbjct:   12 RGGRCLKRQGGGVGTILSNVLKKRSCISRTAPRLLCTLEPGVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPKEWRRKVWLTLADHYLHSIAIDWDKTMRFTFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGFNILAALILEVMEGNEGDALKIMIYLIDKVLPESYFVNNLRALSVDMAVFRDLLRMKLPELSQHLDTLQRT-----ANKESGGGYEPPLTNVFTMQWFLTLFATCLPNQTVLKIWDSVFFEGSEIILRVSLAIWAKLGEQIECCETADEFYSTMGRLTQEMLENDLLQSHELMQTVYSMAPFPFPQLAELREKYTYNITPF---PATVKPTSVSGRHSKARDSDEENDPDDEDAVVNAVGCLGPFSGFLAPELQKYQKQIKEPNEEQSLRSNNIAELSPGAINSCRSEYHAAFNSMMMERMTTDINALKRQY 481          
BLAST of TBC1 domain family member 2B vs. Ensembl Human
Match: TBC1D30 (TBC1 domain family member 30 [Source:HGNC Symbol;Acc:HGNC:29164])

HSP 1 Score: 360.533 bits (924), Expect = 2.146e-111
Identity = 189/375 (50.40%), Postives = 247/375 (65.87%), Query Frame = 2
Query:  746 IKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGG----MMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQY 1849
            ++F FNERSNPDDDS+G+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK VGYCQGFN+LAA+ILEVME NE D+LKIM+YL+D +LPESYF  NL+ALS+DMAVFR+ L + +P+L+ HL+ LQ       A+  +   YEPPLTNVFTMQWFLTLFATCLP   VL IWDS+  EGSEII R  LAIW  L +Q+     AD FY TM  LT ++ +  + Q   L+  +Y+MAP PFP L+ LR+++TYNI PF   P+ +      G  +   D+DE+ D   +     ++GC G     + P       + KE     SL S +I+++ PGA+++  S +H A      ERM TD+  L+ QY
Sbjct:    1 MRFTFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGFNILAALILEVMEGNEGDALKIMIYLIDKVLPESYFVNNLRALSVDMAVFRDLLRMKLPELSQHLDTLQRT-----ANKESGGGYEPPLTNVFTMQWFLTLFATCLPNQTVLKIWDSVFFEGSEIILRVSLAIWAKLGEQIECCETADEFYSTMGRLTQEMLENDLLQSHELMQTVYSMAPFPFPQLAELREKYTYNITPF---PATVKPTSVSGRHSKARDSDEENDPDDEDAVVNAVGCLGPFSGFLAPELQKYQKQIKEPNEEQSLRSNNIAELSPGAINSCRSEYHAAFNSMMMERMTTDINALKRQY 367          
BLAST of TBC1 domain family member 2B vs. Ensembl Human
Match: TBC1D30 (TBC1 domain family member 30 [Source:HGNC Symbol;Acc:HGNC:29164])

HSP 1 Score: 163.31 bits (412), Expect = 5.279e-44
Identity = 88/187 (47.06%), Postives = 119/187 (63.64%), Query Frame = 2
Query:  248 SWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIV 808
            S DS T  S SD V G   R   G S    E + +         L QK   EL+ +   +K  + I S++L+R LK++D  L K+Q+NCDI+TA LQA S KRR DTKLKF +EP  G   F+QW +A+K VARL  G+P E R+KVWL+LA++++     DW++ ++F FNERSNPDDDS+G+QIV
Sbjct:  114 SLDSSTEASGSDVVLGG--RSGAGDSRVLQELQERPSQRHQMLYLRQKDANELKTILRELKYRIGIQSAKLLRHLKQKDRLLHKVQRNCDIVTACLQAVSQKRRVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPKEWRRKVWLTLADHYLHSIAIDWDKTMRFTFNERSNPDDDSMGIQIV 298          
BLAST of TBC1 domain family member 2B vs. Ensembl Human
Match: TBC1D30 (TBC1 domain family member 30 [Source:HGNC Symbol;Acc:HGNC:29164])

HSP 1 Score: 147.902 bits (372), Expect = 2.362e-41
Identity = 66/91 (72.53%), Postives = 79/91 (86.81%), Query Frame = 2
Query:  746 IKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVD 1009
            ++F FNERSNPDDDS+G+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK VGYCQGFN+LAA+ILEVME NE D+LKIM+YL+D
Sbjct:    1 MRFTFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGFNILAALILEVMEGNEGDALKIMIYLID 91          
BLAST of TBC1 domain family member 2B vs. Ensembl Human
Match: TBC1D2 (TBC1 domain family member 2 [Source:HGNC Symbol;Acc:HGNC:18026])

HSP 1 Score: 119.783 bits (299), Expect = 8.204e-28
Identity = 89/288 (30.90%), Postives = 140/288 (48.61%), Query Frame = 2
Query:  650 LPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCD----TFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYN-MAPMPFPGLSNLR 1498
            L  G+P E R +VW  L   H+ VQ        +   + R    +     QI  DL+RT  +    T  T S    L+RVLLA++  N  +GYCQG N LAAI L V+E  EE +   +V +V+ I+P  Y+   L A  +D  V ++ L+  +P+L AH               +  +H +  L    T  WFL +FA  L  +++L +WD+ + EG++++FR  LAI++    ++L++ +    Y  +R  T  +S+        L+N  +N M P     L  LR
Sbjct:  162 LRAGVPREHRPRVWRWLV--HLRVQHLHTPGCYQELLS-RGQAREHPAARQIELDLNRTFPNNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLE-EEESAFWCLVAIVETIMPADYYCNTLTASQVDQRVLQDLLSEKLPRLMAH---------------LGQHHVDLSLV---TFNWFLVVFADSLISNILLRVWDAFLYEGTKVVFRYALAIFKYNEKEILRLQNGLEIYQYLRFFTKTISNS-----RKLMNIAFNDMNPFRMKQLRQLR 422          
BLAST of TBC1 domain family member 2B vs. Ensembl Celegans
Match: tbc-2 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:Q23419])

HSP 1 Score: 102.834 bits (255), Expect = 5.805e-22
Identity = 71/241 (29.46%), Postives = 121/241 (50.21%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYD-----WNRVIKFAFNERSNPDDDSLGLQIVKDLHRT-GCDTFATESERA---ILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLK 1354
            G+P   R +VW  +  + +  ++ +     +  +++ A  ++ +   D+   QI  DL RT   +    E + A    L+ VL A+   N  VGYCQG N LAAI L  +  +E+DS   +V  V+H+ PE Y+  +L     D  V R+ +   +PKLAAHL  L++                    ++F + WFLT F   LP  + L I+D+ + EG++++FR  LA++++    +L+
Sbjct:  630 GVPPAYRGRVWKIIVTHWVKDKQAELGNGYYQSMLRKAGTKKQDGSYDAAIKQIDLDLARTLPTNKLFDEPDSANIEKLRNVLYAFRYHNSHVGYCQGLNRLAAIAL--LNLDEQDSFWFLVACVEHLQPEGYYTSSLIGAVADQKVLRDLVAEKLPKLAAHLRALEVDL------------------SLFALSWFLTCFVDVLPHSIYLTIFDAFLYEGNKVLFRFALALFKICEPHVLQ 850          
BLAST of TBC1 domain family member 2B vs. Ensembl Celegans
Match: tbc-2 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:Q23419])

HSP 1 Score: 102.834 bits (255), Expect = 5.805e-22
Identity = 71/241 (29.46%), Postives = 121/241 (50.21%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYD-----WNRVIKFAFNERSNPDDDSLGLQIVKDLHRT-GCDTFATESERA---ILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLK 1354
            G+P   R +VW  +  + +  ++ +     +  +++ A  ++ +   D+   QI  DL RT   +    E + A    L+ VL A+   N  VGYCQG N LAAI L  +  +E+DS   +V  V+H+ PE Y+  +L     D  V R+ +   +PKLAAHL  L++                    ++F + WFLT F   LP  + L I+D+ + EG++++FR  LA++++    +L+
Sbjct:  630 GVPPAYRGRVWKIIVTHWVKDKQAELGNGYYQSMLRKAGTKKQDGSYDAAIKQIDLDLARTLPTNKLFDEPDSANIEKLRNVLYAFRYHNSHVGYCQGLNRLAAIAL--LNLDEQDSFWFLVACVEHLQPEGYYTSSLIGAVADQKVLRDLVAEKLPKLAAHLRALEVDL------------------SLFALSWFLTCFVDVLPHSIYLTIFDAFLYEGNKVLFRFALALFKICEPHVLQ 850          
BLAST of TBC1 domain family member 2B vs. Ensembl Celegans
Match: tbc-19 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:G5EEB5])

HSP 1 Score: 92.8189 bits (229), Expect = 9.083e-19
Identity = 65/245 (26.53%), Postives = 109/245 (44.49%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHI-----TVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDT--FATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDA 1366
            G+P+ +R  VW  L N  +        KY +  +      E      D    QI  DL RT  +   F + + + +  L +VL A+   N ++GYCQG N LAA  L  +    ED+   ++ + +    ++YF  NL     D  V +  L +  PK+  HL +L +                      FT+ WF++LF   +P + +L IWD  +LEG +++FR  + +     ++++   DA
Sbjct:  451 GIPNSLRATVWKILINQQVEDLKNVYGKYYYRNLCNIQGGEDEKTYSDVHQKQINLDLLRTMPNNVHFMSANSKGVTQLLQVLHAFCLHNSQIGYCQGMNFLAATALLFV--GPEDAFWFLIAVTERYFDKTYFDSNLTGAQADQEVLKGLLEVQHPKIMKHLKSLDIDVAS------------------FTLNWFISLFFDAVPFNTLLRIWDCFLLEGPKVLFRFAIVLIGKHEEEIISRGDA 675          
BLAST of TBC1 domain family member 2B vs. Ensembl Celegans
Match: tbc-18 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:Q94222])

HSP 1 Score: 88.5817 bits (218), Expect = 1.252e-17
Identity = 68/242 (28.10%), Postives = 114/242 (47.11%), Query Frame = 2
Query:  659 GLPSEIRKKVW--LSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDT--FATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDA 1366
            G+P  +R  +W  LS A       KY +  V+     ++   D  S+G+QI +DL RT  +   F  ++   I  L+R+L   A     +GYCQG  V+ A +L  +  +EE +  +M  L++ ILP +++ Q L  L  D  V R  +  HVP L   L                   YE  ++ + T+ W LTLF +     ++L +WD I   G   IFR  ++I ++   +++++ + 
Sbjct:  150 GIPHSMRPFLWPRLSGATKKQKDAKYTYESVL-----QQCAQDKPSIGVQIERDLLRTLPNNICFWKKNSEGIEALRRILKCVAFIYPDLGYCQGMGVIVATLL--LYCSEETTFWMMTALIEDILPPNFYTQTLLGLQADERVSRHLMKCHVPDLNKAL-----------------EDYEVEVS-LLTVSWLLTLFGSVFRTRVMLRVWDFIFYSGGVNIFRVIISILKMKEQEIVEIAET 366          
BLAST of TBC1 domain family member 2B vs. Ensembl Celegans
Match: tbc-6 (Growth hormone-regulated TBC protein 6 [Source:UniProtKB/Swiss-Prot;Acc:Q09445])

HSP 1 Score: 83.9593 bits (206), Expect = 4.525e-17
Identity = 65/224 (29.02%), Postives = 98/224 (43.75%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDT--FATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAI 1324
            G+P   RK++WL    +        W R          +   D +  QI  DL RT  D     TE  R  L R L A A     VGYCQG N +A +IL V+  +E  ++ ++V+LV     + Y+ +N+  L  DM V    L  H P++   L  L +                    ++   +WF+  F   LP + VL +WD ++ EG E +FR  +A+
Sbjct:   78 GIPHTFRKELWLRSCPSR---ADGVWQR----------HEVPDEVIKQIKLDLPRTFPDNKFLKTEGTRKTLGRALFAVAEHIPSVGYCQGLNFVAGVILLVVN-DESRAIDLLVHLVSQ--RQEYYGKNMIGLRRDMHVLHSLLREHCPRVVVTLEKLDVG------------------LDMLVGKWFVCWFVESLPMETVLRLWDCLIYEGDEWLFRIAVAL 267          
BLAST of TBC1 domain family member 2B vs. Ensembl Fly
Match: CG42795 (gene:FBgn0261928 transcript:FBtr0345170)

HSP 1 Score: 304.679 bits (779), Expect = 1.555e-85
Identity = 144/309 (46.60%), Postives = 198/309 (64.08%), Query Frame = 2
Query:  611 FRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTG---CDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPF 1528
            + QW  AMK VARLP G P E R+K+WLSLA+ ++  +  DW +  +  F E    DD+ LG+QIVKDLHRTG   C   A    +A LKR+LL YAR+N  VGYCQGFN+L A+IL+VM++ EE+S+K+M+YLV+ +LP  YF  ++  L  DM VFRE +   +P+LA HL  LQ             N +EPPLTNVFTMQWFLT+F TCLP   VL +WD +++EGS+++ RT L +W LL ++++ V  AD FY  M   +++L +G +   + LI R+  + P+    L  LRD+  YNI P 
Sbjct:  205 YNQWLHAMKLVARLPGGTPPEFRRKLWLSLADKYLKSKNVDWAQQREKCFCEEWREDDEELGIQIVKDLHRTGSNLCTGPAGSINQAKLKRILLGYARYNPEVGYCQGFNMLGALILQVMDKEEEESMKVMIYLVEGVLPTGYFYGSMGGLQADMGVFRELMQTRLPRLAKHLQRLQGPV---------ENAFEPPLTNVFTMQWFLTMFCTCLPMSCVLRVWDLVLIEGSDVLLRTALVLWSLLEERVISVRSADEFYGKMGSYSSELLNGHLVDSNGLIERVVKLGPI--EDLRQLRDKHLYNIAPL 502          
BLAST of TBC1 domain family member 2B vs. Ensembl Fly
Match: CG42795 (gene:FBgn0261928 transcript:FBtr0332437)

HSP 1 Score: 304.294 bits (778), Expect = 1.828e-85
Identity = 144/309 (46.60%), Postives = 198/309 (64.08%), Query Frame = 2
Query:  611 FRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTG---CDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPF 1528
            + QW  AMK VARLP G P E R+K+WLSLA+ ++  +  DW +  +  F E    DD+ LG+QIVKDLHRTG   C   A    +A LKR+LL YAR+N  VGYCQGFN+L A+IL+VM++ EE+S+K+M+YLV+ +LP  YF  ++  L  DM VFRE +   +P+LA HL  LQ             N +EPPLTNVFTMQWFLT+F TCLP   VL +WD +++EGS+++ RT L +W LL ++++ V  AD FY  M   +++L +G +   + LI R+  + P+    L  LRD+  YNI P 
Sbjct:  205 YNQWLHAMKLVARLPGGTPPEFRRKLWLSLADKYLKSKNVDWAQQREKCFCEEWREDDEELGIQIVKDLHRTGSNLCTGPAGSINQAKLKRILLGYARYNPEVGYCQGFNMLGALILQVMDKEEEESMKVMIYLVEGVLPTGYFYGSMGGLQADMGVFRELMQTRLPRLAKHLQRLQGPV---------ENAFEPPLTNVFTMQWFLTMFCTCLPMSCVLRVWDLVLIEGSDVLLRTALVLWSLLEERVISVRSADEFYGKMGSYSSELLNGHLVDSNGLIERVVKLGPI--EDLRQLRDKHLYNIAPL 502          
BLAST of TBC1 domain family member 2B vs. Ensembl Fly
Match: CG42795 (gene:FBgn0261928 transcript:FBtr0303601)

HSP 1 Score: 303.908 bits (777), Expect = 2.435e-85
Identity = 144/309 (46.60%), Postives = 198/309 (64.08%), Query Frame = 2
Query:  611 FRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTG---CDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPF 1528
            + QW  AMK VARLP G P E R+K+WLSLA+ ++  +  DW +  +  F E    DD+ LG+QIVKDLHRTG   C   A    +A LKR+LL YAR+N  VGYCQGFN+L A+IL+VM++ EE+S+K+M+YLV+ +LP  YF  ++  L  DM VFRE +   +P+LA HL  LQ             N +EPPLTNVFTMQWFLT+F TCLP   VL +WD +++EGS+++ RT L +W LL ++++ V  AD FY  M   +++L +G +   + LI R+  + P+    L  LRD+  YNI P 
Sbjct:  205 YNQWLHAMKLVARLPGGTPPEFRRKLWLSLADKYLKSKNVDWAQQREKCFCEEWREDDEELGIQIVKDLHRTGSNLCTGPAGSINQAKLKRILLGYARYNPEVGYCQGFNMLGALILQVMDKEEEESMKVMIYLVEGVLPTGYFYGSMGGLQADMGVFRELMQTRLPRLAKHLQRLQGPV---------ENAFEPPLTNVFTMQWFLTMFCTCLPMSCVLRVWDLVLIEGSDVLLRTALVLWSLLEERVISVRSADEFYGKMGSYSSELLNGHLVDSNGLIERVVKLGPI--EDLRQLRDKHLYNIAPL 502          
BLAST of TBC1 domain family member 2B vs. Ensembl Fly
Match: CG42795 (gene:FBgn0261928 transcript:FBtr0345169)

HSP 1 Score: 303.908 bits (777), Expect = 2.503e-85
Identity = 144/309 (46.60%), Postives = 198/309 (64.08%), Query Frame = 2
Query:  611 FRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTG---CDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPF 1528
            + QW  AMK VARLP G P E R+K+WLSLA+ ++  +  DW +  +  F E    DD+ LG+QIVKDLHRTG   C   A    +A LKR+LL YAR+N  VGYCQGFN+L A+IL+VM++ EE+S+K+M+YLV+ +LP  YF  ++  L  DM VFRE +   +P+LA HL  LQ             N +EPPLTNVFTMQWFLT+F TCLP   VL +WD +++EGS+++ RT L +W LL ++++ V  AD FY  M   +++L +G +   + LI R+  + P+    L  LRD+  YNI P 
Sbjct:  205 YNQWLHAMKLVARLPGGTPPEFRRKLWLSLADKYLKSKNVDWAQQREKCFCEEWREDDEELGIQIVKDLHRTGSNLCTGPAGSINQAKLKRILLGYARYNPEVGYCQGFNMLGALILQVMDKEEEESMKVMIYLVEGVLPTGYFYGSMGGLQADMGVFRELMQTRLPRLAKHLQRLQGPV---------ENAFEPPLTNVFTMQWFLTMFCTCLPMSCVLRVWDLVLIEGSDVLLRTALVLWSLLEERVISVRSADEFYGKMGSYSSELLNGHLVDSNGLIERVVKLGPI--EDLRQLRDKHLYNIAPL 502          
BLAST of TBC1 domain family member 2B vs. Ensembl Fly
Match: CG42795 (gene:FBgn0261928 transcript:FBtr0303602)

HSP 1 Score: 303.908 bits (777), Expect = 2.726e-85
Identity = 144/309 (46.60%), Postives = 198/309 (64.08%), Query Frame = 2
Query:  611 FRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTG---CDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPF 1528
            + QW  AMK VARLP G P E R+K+WLSLA+ ++  +  DW +  +  F E    DD+ LG+QIVKDLHRTG   C   A    +A LKR+LL YAR+N  VGYCQGFN+L A+IL+VM++ EE+S+K+M+YLV+ +LP  YF  ++  L  DM VFRE +   +P+LA HL  LQ             N +EPPLTNVFTMQWFLT+F TCLP   VL +WD +++EGS+++ RT L +W LL ++++ V  AD FY  M   +++L +G +   + LI R+  + P+    L  LRD+  YNI P 
Sbjct:   84 YNQWLHAMKLVARLPGGTPPEFRRKLWLSLADKYLKSKNVDWAQQREKCFCEEWREDDEELGIQIVKDLHRTGSNLCTGPAGSINQAKLKRILLGYARYNPEVGYCQGFNMLGALILQVMDKEEEESMKVMIYLVEGVLPTGYFYGSMGGLQADMGVFRELMQTRLPRLAKHLQRLQGPV---------ENAFEPPLTNVFTMQWFLTMFCTCLPMSCVLRVWDLVLIEGSDVLLRTALVLWSLLEERVISVRSADEFYGKMGSYSSELLNGHLVDSNGLIERVVKLGPI--EDLRQLRDKHLYNIAPL 381          
BLAST of TBC1 domain family member 2B vs. Ensembl Zebrafish
Match: tbc1d30 (TBC1 domain family, member 30 [Source:ZFIN;Acc:ZDB-GENE-030131-2064])

HSP 1 Score: 492.656 bits (1267), Expect = 4.782e-157
Identity = 284/644 (44.10%), Postives = 399/644 (61.96%), Query Frame = 2
Query:  149 FEKHECKNS-GESVIDNLLFEIYDKWAYKCRHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGMMPSNHLSNYKA--KENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYXXXXXXXXXTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTASHIIVSS----TYPSLQNSMVNH 2050
            F++ E K+S   S++D LL E+YD +++        DS T  S+SDA  G    RS   S    E + KH        L QK  EEL+ +   +K  +A+ S++LVRQ KR+D    K QKNCDI+TA LQA S KRR DT+LKF +EP  G   F+QW +A+K VARLP+G+P E RK+VWL+LA+ ++     DW + ++FAFN+RSNPDDDSLG+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK VGYCQGFNVLAA+ILEV E NE D+LK+M+YL+D +LP+SYFA NL+ALS+DMAVFR+ L + +P+L+ HL++LQ  + ++         YEPPLTNVFTMQWFLT+FATCLP   VL IWDS+  EGSE++ R  LAIW  L +++ +   AD FY  M CLT ++ +  +   + L+  +Y+MAP PFP L+ LR+++TYNI PF   P+ + +  S      E D D D D +   V         G + +  +  Y+   K+ +   S +  +++++ PGAV    + H  A      ERM TD+  L+ QY +IK KQ++ + L+    H      + VLA        S +G P+P  +H+++         SL+N M+++
Sbjct:   75 FDREELKDSRASSLVDCLLVELYDTYSHGV---PGLDSSTEASSSDAFLG----RSNSGSSFLQELQEKHTRRHQVKYLAQKGPEELKWIVQEVKYRIAVQSAKLVRQAKRKDRLRQKFQKNCDIVTACLQAVSQKRRVDTRLKFTIEPSLGKNGFQQWYDALKAVARLPVGIPKEWRKRVWLTLADQYLHSISIDWEKTMRFAFNDRSNPDDDSLGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGFNVLAALILEVTEGNEGDALKVMIYLIDKVLPDSYFANNLRALSVDMAVFRDLLRLKLPELSQHLHHLQKVANREAGGS-----YEPPLTNVFTMQWFLTMFATCLPHHTVLKIWDSVFFEGSEMLLRVALAIWAKLGERIEECQTADEFYSIMGCLTQEMLEHKLIDSNELMQTVYSMAPFPFPQLAELREKYTYNITPF---PAPVRANSSLALHGWESDDDADMDDEDSIVTALGCLGPLGGLLAPEIQRYQRHLKDQRAEQSCNGSNMAELSPGAVGAGRAEHQAAINSMMLERMSTDISALKKQYSRIKQKQQQQAGLL--YIHTDKCPATSVLA--------SQIG-PSPVVNHLLLGRRPRPCERSLKNGMIHN 692          
BLAST of TBC1 domain family member 2B vs. Ensembl Zebrafish
Match: tbc1d2 (TBC1 domain family, member 2 [Source:ZFIN;Acc:ZDB-GENE-140106-100])

HSP 1 Score: 128.642 bits (322), Expect = 9.176e-30
Identity = 81/265 (30.57%), Postives = 138/265 (52.08%), Query Frame = 2
Query:  632 MKGVARLPLGLPSEIRKKVWLSLANNHI-TVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDG 1417
            MKG+ R   GLP E R +VW  +      ++++   +R  +     RS+P      +Q+  D   T    F+  +   I  L+RVL A++  N  +GY QG N LAAI L V++  E D+   +V +V+HI+P +YF ++L     D  V ++ +   +P+L AHL  L++                    ++ T++WFL LF   LP  ++  +WD+++ EGS++IFR  LA+++   + +LK+ D+   Y  +R   N ++DG
Sbjct:  616 MKGLLRT--GLPHEYRVRVWRFMIQTRTKSLRERHPDRYHELCEKSRSSPHLVPRQIQLDLDRTLTSNKHFSPPTSPLIQKLERVLQAFSWHNPTIGYVQGLNRLAAIALLVLQ-EEADAFWCLVVIVEHIMPPNYFTKDLVGCQADQRVLKDLMLEKLPRLTAHLEALKVD------------------ISLITVEWFLVLFVESLPTRILFKVWDALLYEGSKVIFRYALALFKYREEAILKIQDSVEMYQYLRIFPNTIADG 859          
BLAST of TBC1 domain family member 2B vs. Ensembl Zebrafish
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:406635])

HSP 1 Score: 110.923 bits (276), Expect = 2.368e-24
Identity = 74/257 (28.79%), Postives = 128/257 (49.81%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRT----GCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDG 1417
            G+P  +R ++W+ L+     +QK   + +      + S+ DD +   QI KDL RT     C    T      L+RVL   A     +GYCQG  ++ + +L  +E  EED+L +M  L++ +LP SYF+  L  +  D  V R+ +  ++P+L                  +  +  E    ++ T+ WFLT FA+ +   ++L IWD +  EGS ++F+  L + ++  D+L+   ++ S + T+  L +QL DG
Sbjct:  115 GIPHSMRPQLWMRLSG---ALQKKRTSDISYREIVKNSSNDDTTAAKQIEKDLLRTMPTNACFNTLTSVGVPKLRRVLRGLAWLYPDIGYCQGTGMVVSCLLLFLE--EEDALWMMCALIEDLLPPSYFSSTLLGVQTDQRVLRQLIVQYLPRLD---------------KLLQEHDIE---LSLITLHWFLTAFASVVDIRILLRIWDLLFYEGSMVLFQVTLGMLKIKEDELVSSENSASIFNTLSDLPSQLEDG 348          
BLAST of TBC1 domain family member 2B vs. Ensembl Zebrafish
Match: grtp1b (growth hormone regulated TBC protein 1b [Source:ZFIN;Acc:ZDB-GENE-050417-346])

HSP 1 Score: 101.293 bits (251), Expect = 1.899e-22
Identity = 73/254 (28.74%), Postives = 121/254 (47.64%), Query Frame = 2
Query:  614 RQWCEAMKGVARLPL----------GLPSEIRKKVWLSL--ANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDT--FATESERAILK---RVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAI 1324
            ++W + ++G  ++            G+P E R ++W++   A + +      +  ++K    E+ +P  + +   I  D+HRT  D   F   S+  + K    VLLAY   NK VGYCQG N +A  +L ++ ++EE S  +M  L+  ILP+ Y+ Q +  L +D  V  E +   VP                 A     N ++   T V + +WF+ L+   LP + VL IWD +  EGS+I+FR  L +
Sbjct:   54 KKWSKLLQGTGKMEKNLKVKRYVRKGIPCEHRTEIWMAFSGAQDQLERNPGYYQALLK---TEQHDPKIEEV---IHADMHRTFPDNIQFRHSSQSCLQKALFNVLLAYGHHNKDVGYCQGMNFIAGYLL-IITKDEEKSFWLMDALIGRILPD-YYTQTMLGLKVDQEVLGELVKSKVP-----------------AVWQTMNQHDVMWTLVVS-RWFICLYVDVLPVETVLRIWDCLFYEGSKILFRVALTL 281          
BLAST of TBC1 domain family member 2B vs. Ensembl Zebrafish
Match: tbc1d2b (TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB-GENE-100922-148])

HSP 1 Score: 103.99 bits (258), Expect = 4.126e-22
Identity = 80/290 (27.59%), Postives = 136/290 (46.90%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHIT----VQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDL----HRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDG--LIAQPDHLINRIYNMAPMPFPGLSNLR 1498
            G+P   R KVW    + H+      Q  D+   +    N++ NP    + L +++ L    H +  D+   +     L+ VLLA++  N  +GYCQG N LAAI L  +  ++ED+   +V +V+  +P  Y+ + L    +D  VF++ +   +P+L AH                   HY+   + + T  WFL +F   +  D++  IWDS + EG +IIFR  LA+++   ++ LK+ D  + +  +R  T  + D   L+A          +M P P   + N R
Sbjct:  537 GVPHIHRSKVWSWCVSFHVKKMRDCQPKDYYHNLLCMANDKPNPACKQIELDLLRTLPNNKHYSSPDSDGIQK----LRNVLLAFSWRNPDIGYCQGLNRLAAIALLYL--DQEDAFWCLVAIVEVFMPHDYYTKTLLGSQVDQRVFKDLMYEKLPRLHAHF-----------------EHYKVDFS-LITFNWFLVVFVDSVVSDILFKIWDSFLYEGPKIIFRFALALFKYKEEEFLKLQDPMTIFKYLRYFTRTILDARKLMAMA------FVDMNPFPLRQIQNRR 796          
BLAST of TBC1 domain family member 2B vs. Ensembl Xenopus
Match: bard1 (BRCA1 associated RING domain 1 [Source:Xenbase;Acc:XB-GENE-492035])

HSP 1 Score: 504.597 bits (1298), Expect = 9.148e-163
Identity = 277/655 (42.29%), Postives = 396/655 (60.46%), Query Frame = 2
Query:  155 KHECKNSGESVIDNLLFEIYDKW-----AYKCRHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGG----MMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYXXXXXXXXXTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSV----GRPNPTASHIIVSSTYPSLQNS--MVNHLFLTR 2065
            + + ++   S+++ LL E+YD +      Y  R   S DS T  S SDA    +   S G     SE +   +  +    L QK   EL+ +K  + + +AI S++L+RQ+K++D    K+QKNCDI+TA LQA S KRR DTKLKF +EP  G   F+QW +A+K VARLP G+P E RK+VWL+LA++++     DW++ ++F FN+RSNPDDDS+G+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK +GYCQGFN+LAA+ILEVME NE D+LK+M+YL+D +LP+SYFA NL+ALS+DMAVFR+ + + +P+L+ H     L   Q+ A+  +   YEPPLTNVFTMQWFLTLFATCLP   VL IWDS+  EGSEI+ R  LAIW  L +Q+    ++D FY TM  LT ++ +  +   + L+  +Y+MA  PFP L+ LR+++TYNI PF   P+ + S    G  +   D+DE+ +     VN  ++GC G     + P       + K+ +   SL + +I+++ PGA+ +  S +H        ERM TD+  L+ QY              + I   ++   +QV   + HG+ K+S      R         VS   PS  N+  ++NHL L +
Sbjct:   84 QQQGRSRTSSLVNGLLTELYDTYRGGAGCYYFRQQDSVDSSTEASGSDAFLSRSNPES-GFLQELSERQSSRHQML---YLKQKDCSELKAIKDELNRRIAIQSAKLLRQVKQKDRLQHKVQKNCDIVTACLQAVSQKRRVDTKLKFTLEPSLGQNGFQQWYDALKAVARLPTGIPKEWRKRVWLTLADHYLHSISIDWDKTMRFTFNDRSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTIGYCQGFNILAALILEVMEGNEGDALKVMIYLIDKVLPDSYFANNLRALSVDMAVFRDLVRMKLPELSQH-----LDVLQRTANKESGGGYEPPLTNVFTMQWFLTLFATCLPNHTVLKIWDSVFFEGSEILLRVSLAIWAKLGEQIECCQNSDDFYSTMGRLTQEMLEDSLIDSNELMQTVYSMAQFPFPQLAELREKYTYNITPF---PAPVKSASFSGRTSKMRDSDEENEIDEDDVNANAVGCLGPFSGFLAPELQKYQKQIKDQKEEQSLKASNIAELSPGAIDSCRSEYHAVFNSMMMERMTTDINALKQQY--------------SRIKKRQLQQINQVYIAAGHGEEKASAIPFDPRDQQNTDKGPVSCILPSQVNNSPVINHLLLGK 712          
BLAST of TBC1 domain family member 2B vs. Ensembl Xenopus
Match: bard1 (BRCA1 associated RING domain 1 [Source:Xenbase;Acc:XB-GENE-492035])

HSP 1 Score: 499.204 bits (1284), Expect = 7.338e-161
Identity = 260/577 (45.06%), Postives = 368/577 (63.78%), Query Frame = 2
Query:  155 KHECKNSGESVIDNLLFEIYDKW-----AYKCRHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGG----MMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQY 1849
            + + ++   S+++ LL E+YD +      Y  R   S DS T  S SDA    +   S G     SE +   +  +    L QK   EL+ +K  + + +AI S++L+RQ+K++D    K+QKNCDI+TA LQA S KRR DTKLKF +EP  G   F+QW +A+K VARLP G+P E RK+VWL+LA++++     DW++ ++F FN+RSNPDDDS+G+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK +GYCQGFN+LAA+ILEVME NE D+LK+M+YL+D +LP+SYFA NL+ALS+DMAVFR+ + + +P+L+ H     L   Q+ A+  +   YEPPLTNVFTMQWFLTLFATCLP   VL IWDS+  EGSEI+ R  LAIW  L +Q+    ++D FY TM  LT ++ +  +   + L+  +Y+MA  PFP L+ LR+++TYNI PF   P+ + S    G  +   D+DE+ +     VN  ++GC G     + P       + K+ +   SL + +I+++ PGA+ +  S +H        ERM TD+  L+ QY
Sbjct:   84 QQQGRSRTSSLVNGLLTELYDTYRGGAGCYYFRQQDSVDSSTEASGSDAFLSRSNPES-GFLQELSERQSSRHQML---YLKQKDCSELKAIKDELNRRIAIQSAKLLRQVKQKDRLQHKVQKNCDIVTACLQAVSQKRRVDTKLKFTLEPSLGQNGFQQWYDALKAVARLPTGIPKEWRKRVWLTLADHYLHSISIDWDKTMRFTFNDRSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTIGYCQGFNILAALILEVMEGNEGDALKVMIYLIDKVLPDSYFANNLRALSVDMAVFRDLVRMKLPELSQH-----LDVLQRTANKESGGGYEPPLTNVFTMQWFLTLFATCLPNHTVLKIWDSVFFEGSEILLRVSLAIWAKLGEQIECCQNSDDFYSTMGRLTQEMLEDSLIDSNELMQTVYSMAQFPFPQLAELREKYTYNITPF---PAPVKSASFSGRTSKMRDSDEENEIDEDDVNANAVGCLGPFSGFLAPELQKYQKQIKDQKEEQSLKASNIAELSPGAIDSCRSEYHAVFNSMMMERMTTDINALKQQY 648          
BLAST of TBC1 domain family member 2B vs. Ensembl Xenopus
Match: bard1 (BRCA1 associated RING domain 1 [Source:Xenbase;Acc:XB-GENE-492035])

HSP 1 Score: 434.876 bits (1117), Expect = 2.196e-138
Identity = 220/475 (46.32%), Postives = 310/475 (65.26%), Query Frame = 2
Query:  464 RQLKRRDHALAKM------QKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGG----MMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQY 1849
            R LKR++  +  +      ++NC   TA     +L+   DTKLKF +EP  G   F+QW +A+K VARLP G+P E RK+VWL+LA++++     DW++ ++F FN+RSNPDDDS+G+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK +GYCQGFN+LAA+ILEVME NE D+LK+M+YL+D +LP+SYFA NL+ALS+DMAVFR+ + + +P+L+ HL+ LQ       A+  +   YEPPLTNVFTMQWFLTLFATCLP   VL IWDS+  EGSEI+ R  LAIW  L +Q+    ++D FY TM  LT ++ +  +   + L+  +Y+MA  PFP L+ LR+++TYNI PF   P+ + S    G  +   D+DE+ +     VN  ++GC G     + P       + K+ +   SL + +I+++ PGA+ +  S +H        ERM TD+  L+ QY
Sbjct:   15 RCLKRKNTGVGNILSKVLKKRNCISRTAPRLLCTLEPGVDTKLKFTLEPSLGQNGFQQWYDALKAVARLPTGIPKEWRKRVWLTLADHYLHSISIDWDKTMRFTFNDRSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTIGYCQGFNILAALILEVMEGNEGDALKVMIYLIDKVLPDSYFANNLRALSVDMAVFRDLVRMKLPELSQHLDVLQRT-----ANKESGGGYEPPLTNVFTMQWFLTLFATCLPNHTVLKIWDSVFFEGSEILLRVSLAIWAKLGEQIECCQNSDDFYSTMGRLTQEMLEDSLIDSNELMQTVYSMAQFPFPQLAELREKYTYNITPF---PAPVKSASFSGRTSKMRDSDEENEIDEDDVNANAVGCLGPFSGFLAPELQKYQKQIKDQKEEQSLKASNIAELSPGAIDSCRSEYHAVFNSMMMERMTTDINALKQQY 481          
BLAST of TBC1 domain family member 2B vs. Ensembl Xenopus
Match: cfap52 (cilia and flagella associated protein 52 [Source:Xenbase;Acc:XB-GENE-989292])

HSP 1 Score: 116.701 bits (291), Expect = 6.812e-26
Identity = 85/295 (28.81%), Postives = 147/295 (49.83%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYD-----WNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPM---PFPGLSNLRDRFTYNI 1519
            G+P E R ++W    N HI   K +     +  +++ A  E+ NP    + L +++ L      T  T      L+ VLLAY+  N  +GYCQG N LAAI L  +  ++ED+   +V +V+  +P  Y+ + L    +D  VF++ +N  +P+L AH                    Y+   T + T  WFL +F   +  D++  IWDS++ EGS++IFR  L +++   +++LK+ D+ S +  +R  +  + D           ++ N+A +   PFP L  +R+R TY++
Sbjct:  573 GIPHEHRSRMWKWFTNLHIKKLKDEAAPGYFQSLLQNAL-EKQNPASKQIELDLMRTLPNNKHYTSPTSEGIQKLRNVLLAYSWRNPDIGYCQGINRLAAIALLYL--DQEDAFWCLVTIVEAFMPRDYYTKTLLGSQVDQRVFKDLMNEKLPRLCAHF-----------------EQYKVDYT-LITFNWFLVVFVDSVVSDILFRIWDSLLYEGSKVIFRFALGLFKYKEEEILKLQDSMSIFKYLRYFSRTILDA---------RKLCNIAFVDMNPFP-LRQIRNRRTYHL 836          
BLAST of TBC1 domain family member 2B vs. Ensembl Xenopus
Match: cfap52 (cilia and flagella associated protein 52 [Source:Xenbase;Acc:XB-GENE-989292])

HSP 1 Score: 116.316 bits (290), Expect = 9.277e-26
Identity = 85/295 (28.81%), Postives = 147/295 (49.83%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYD-----WNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPM---PFPGLSNLRDRFTYNI 1519
            G+P E R ++W    N HI   K +     +  +++ A  E+ NP    + L +++ L      T  T      L+ VLLAY+  N  +GYCQG N LAAI L  +  ++ED+   +V +V+  +P  Y+ + L    +D  VF++ +N  +P+L AH                    Y+   T + T  WFL +F   +  D++  IWDS++ EGS++IFR  L +++   +++LK+ D+ S +  +R  +  + D           ++ N+A +   PFP L  +R+R TY++
Sbjct:  642 GIPHEHRSRMWKWFTNLHIKKLKDEAAPGYFQSLLQNAL-EKQNPASKQIELDLMRTLPNNKHYTSPTSEGIQKLRNVLLAYSWRNPDIGYCQGINRLAAIALLYL--DQEDAFWCLVTIVEAFMPRDYYTKTLLGSQVDQRVFKDLMNEKLPRLCAHF-----------------EQYKVDYT-LITFNWFLVVFVDSVVSDILFRIWDSLLYEGSKVIFRFALGLFKYKEEEILKLQDSMSIFKYLRYFSRTILDA---------RKLCNIAFVDMNPFP-LRQIRNRRTYHL 905          
BLAST of TBC1 domain family member 2B vs. Ensembl Mouse
Match: Tbc1d30 (TBC1 domain family, member 30 [Source:MGI Symbol;Acc:MGI:1921944])

HSP 1 Score: 431.795 bits (1109), Expect = 4.739e-137
Identity = 222/456 (48.68%), Postives = 302/456 (66.23%), Query Frame = 2
Query:  503 QKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGM--MPSNHLSNYKA--KENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQY 1849
            +++C   TA     +L+   DTKLKF +EP  G   F+QW +A+K VARL  G+P E R+KVWL+LA++++     DW++ ++F FNERSNPDDDS+G+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK VGYCQGFN+LAA+ILEVME NE D+LKIM+YL+D +LPESYF  NL+ALS+DMAVFR+ L + +P+L+ HL+ LQ       A+  +   YEPPLTNVFTMQWFLTLFATCLP   VL IWDS+  EGSEII R  LAIW  L +Q+     AD FY TM  LT ++ +  + Q   L+  +Y+MAP PFP L+ LR+++TYNI PF   P+ I      G  +   D+D++     +    +++GC G +  + +  L  Y+   KE     +L S +I+++ PGA+++  S +H A      ERM TD+  L+ QY
Sbjct:   35 KRSCISRTAPRLLCTLEPGVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPKEWRRKVWLTLADHYLHSIAIDWDKTMRFTFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKNVGYCQGFNILAALILEVMEGNEGDALKIMIYLIDKVLPESYFVNNLRALSVDMAVFRDLLRLKLPELSQHLDTLQRT-----ANKESGGGYEPPLTNVFTMQWFLTLFATCLPNHTVLKIWDSVFFEGSEIILRVSLAIWAKLGEQIECCETADEFYGTMGRLTQEMLEQDLLQSHELMQTVYSMAPFPFPQLAELREKYTYNITPF---PATIKPTSVSGRHSKARDSDDENGPDDEDAVASAVGCLGPLSGLLAPELQKYQKQIKEATEEQTLRSNNIAELSPGAINSCRSEYHAAFNSMMMERMTTDINALKRQY 482          
BLAST of TBC1 domain family member 2B vs. Ensembl Mouse
Match: Tbc1d30 (TBC1 domain family, member 30 [Source:MGI Symbol;Acc:MGI:1921944])

HSP 1 Score: 190.66 bits (483), Expect = 1.680e-54
Identity = 99/201 (49.25%), Postives = 132/201 (65.67%), Query Frame = 2
Query:  248 SWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATE 850
            S DS T TS SDA   F   R  G S    E   +    +    L +K   EL+ V   +K  + I S++L+RQLK++D  L K+QKNCDI+TA LQA S KRR DTKLKF +EP  G   F+QW +A+K VARL  G+P E R+KVWL+LA++++     DW++ ++F FNERSNPDDDS+G+QIVKDLHRTGC ++  +
Sbjct:   43 SLDSSTETSGSDA---FLGGRGAGDSRVLQELRERPSLRLQMQYLQRKDSSELKTVLRELKYRIGIQSAKLLRQLKQKDRLLHKVQKNCDIVTACLQAVSQKRRVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPKEWRRKVWLTLADHYLHSIAIDWDKTMRFTFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQ 240          
BLAST of TBC1 domain family member 2B vs. Ensembl Mouse
Match: Tbc1d2 (TBC1 domain family, member 2 [Source:MGI Symbol;Acc:MGI:2652885])

HSP 1 Score: 124.02 bits (310), Expect = 2.691e-28
Identity = 87/288 (30.21%), Postives = 141/288 (48.96%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNE---RSNPDDDSLGLQIVKDLHRTGCD----TFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYN-MAPMPFPGLSNLR 1498
            G+P E R +VW  L +  +       +      + E   R    +     QI  DL+RT       T  T S    L+RVLLA++  N  +GYCQG N LAAI L V+E +EE +   +V +V+ ILP  Y+++ L A  +D  V ++ L+  +P+L AH               +  +  +    ++ T  WFL +FA  L  D++L +WD+ + EG++++FR  LAI++   + +L++ D+   Y  +R  T  + D        L++  +N M P P   L  LR
Sbjct:  619 GVPREHRPRVWRWLVHRRVR------HLQAPGCYQELLARGRACEHPAARQIELDLNRTFPTNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLE-DEESAFWCLVAIVETILPAEYYSKTLTASQVDQRVLQDLLSEKLPRLTAH---------------LGQHRVD---LSLITFNWFLVVFADSLISDILLRVWDAFLYEGTKVVFRYALAIFKYNEEAILQLQDSLEIYQYLRFFTKTICDS-----RKLMSIAFNDMNPFPMKQLRQLR 876          
BLAST of TBC1 domain family member 2B vs. Ensembl Mouse
Match: Tbc1d2b (TBC1 domain family, member 2B [Source:MGI Symbol;Acc:MGI:1914266])

HSP 1 Score: 105.531 bits (262), Expect = 1.639e-22
Identity = 82/294 (27.89%), Postives = 139/294 (47.28%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQK----YDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDG--LIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNIN 1522
            G+P E R KVW    + H    K     D+ + +     E+ NP    + L +++ L      +  T      L+ VLLA++  N  +GYCQG N L A+ L  +  ++ED+   +V +V+  +P  Y+ + L    +D  VFR+ L+  +P+L  H                    Y+   T + T  WFL +F   +  D++  IWDS + EG ++IFR  LA+++   +++LK+ D+ S +  +R  T  + D   LI+     +N        PFP L  +R+R  Y++ 
Sbjct:  664 GIPHEHRSKVWKWCVDRHTRKFKDSMEPDYFQTLLQKALEKQNPASKQIELDLLRTLPNNKHYSSPTSEGIQKLRSVLLAFSWRNPDIGYCQGLNRLVAVALLYL--DQEDAFWCLVTIVEVFMPRDYYTKTLLGSQVDQRVFRDLLSEKLPRLHTHF-----------------EQYKVDYT-LITFNWFLVVFVDSVVSDILFKIWDSFLYEGPKVIFRFALALFKYKEEEILKLQDSMSIFKYLRYFTRTILDARKLISISFGDLN--------PFP-LRQIRNRRAYHLE 928          
BLAST of TBC1 domain family member 2B vs. Ensembl Mouse
Match: Sgsm3 (small G protein signaling modulator 3 [Source:MGI Symbol;Acc:MGI:1916329])

HSP 1 Score: 102.834 bits (255), Expect = 8.471e-22
Identity = 77/277 (27.80%), Postives = 136/277 (49.10%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRT----GCDTFATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDG--LIAQPDHLINRIYNMA 1465
            G+P  +R ++W+ L+     +QK   + +      + S+ D+     QI KDL RT     C  FA  +   +  L+RVL A A     +GYCQG  ++AA +L  +E  EED+  +M  +++ +LP SYF+  L  +  D  V R  +  ++P+L                  +  +  E    ++ T+ WFLT FA+ +   L+L IWD    EGS ++F+T L +  L  ++L++  ++ S + T+  +  Q+ D   L+ +   L   + ++A
Sbjct:  114 GIPHGMRPQLWMRLSG---ALQKKKNSELSYREIIKNSSNDETIAAKQIEKDLLRTMPSNAC--FANVNSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLE--EEDAFWMMCAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLD---------------KLLQEHDIE---LSLITLHWFLTAFASVVHIRLLLRIWDLFFYEGSLVLFQTTLGMLRLKEEELIQSENSASIFNTLSDIPAQMDDAELLLGEAMRLAGSLTDVA 365          
BLAST of TBC1 domain family member 2B vs. UniProt/SwissProt
Match: sp|Q28C33|TBC30_XENTR (TBC1 domain family member 30 OS=Xenopus tropicalis OX=8364 GN=tbc1d30 PE=2 SV=1)

HSP 1 Score: 498.819 bits (1283), Expect = 3.464e-160
Identity = 260/577 (45.06%), Postives = 368/577 (63.78%), Query Frame = 2
Query:  155 KHECKNSGESVIDNLLFEIYDKW-----AYKCRHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGG----MMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQY 1849
            + + ++   S+++ LL E+YD +      Y  R   S DS T  S SDA    +   S G     SE +   +  +    L QK   EL+ +K  + + +AI S++L+RQ+K++D    K+QKNCDI+TA LQA S KRR DTKLKF +EP  G   F+QW +A+K VARLP G+P E RK+VWL+LA++++     DW++ ++F FN+RSNPDDDS+G+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK +GYCQGFN+LAA+ILEVME NE D+LK+M+YL+D +LP+SYFA NL+ALS+DMAVFR+ + + +P+L+ H     L   Q+ A+  +   YEPPLTNVFTMQWFLTLFATCLP   VL IWDS+  EGSEI+ R  LAIW  L +Q+    ++D FY TM  LT ++ +  +   + L+  +Y+MA  PFP L+ LR+++TYNI PF   P+ + S    G  +   D+DE+ +     VN  ++GC G     + P       + K+ +   SL + +I+++ PGA+ +  S +H        ERM TD+  L+ QY
Sbjct:   74 QQQGRSRTSSLVNGLLTELYDTYRGGAGCYYFRQQDSVDSSTEASGSDAFLSRSNPES-GFLQELSERQSSRHQML---YLKQKDCSELKAIKDELNRRIAIQSAKLLRQVKQKDRLQHKVQKNCDIVTACLQAVSQKRRVDTKLKFTLEPSLGQNGFQQWYDALKAVARLPTGIPKEWRKRVWLTLADHYLHSISIDWDKTMRFTFNDRSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTIGYCQGFNILAALILEVMEGNEGDALKVMIYLIDKVLPDSYFANNLRALSVDMAVFRDLVRMKLPELSQH-----LDVLQRTANKESGGGYEPPLTNVFTMQWFLTLFATCLPNHTVLKIWDSVFFEGSEILLRVSLAIWAKLGEQIECCQNSDDFYSTMGRLTQEMLEDSLIDSNELMQTVYSMAQFPFPQLAELREKYTYNITPF---PAPVKSASFSGRTSKMRDSDEENEIDEDDVNANAVGCLGPFSGFLAPELQKYQKQIKDQKEEQSLKASNIAELSPGAIDSCRSEYHAVFNSMMMERMTTDINALKQQY 638          
BLAST of TBC1 domain family member 2B vs. UniProt/SwissProt
Match: sp|Q9Y2I9|TBC30_HUMAN (TBC1 domain family member 30 OS=Homo sapiens OX=9606 GN=TBC1D30 PE=1 SV=2)

HSP 1 Score: 486.878 bits (1252), Expect = 2.739e-155
Identity = 260/541 (48.06%), Postives = 346/541 (63.96%), Query Frame = 2
Query:  248 SWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGG----MMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQY 1849
            S DS T  S SD V G   R   G S    E + +         L QK   EL+ +   +K  + I S++L+R LK++D  L K+Q+NCDI+TA LQA S KRR DTKLKF +EP  G   F+QW +A+K VARL  G+P E R+KVWL+LA++++     DW++ ++F FNERSNPDDDS+G+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK VGYCQGFN+LAA+ILEVME NE D+LKIM+YL+D +LPESYF  NL+ALS+DMAVFR+ L + +P+L+ H     L + Q+ A+  +   YEPPLTNVFTMQWFLTLFATCLP   VL IWDS+  EGSEII R  LAIW  L +Q+     AD FY TM  LT ++ +  + Q   L+  +Y+MAP PFP L+ LR+++TYNI PF   P+ +      G  +   D+DE+ D   +     ++GC G     + P       + KE     SL S +I+++ PGA+++  S +H A      ERM TD+  L+ QY
Sbjct:  114 SLDSSTEASGSDVVLG--GRSGAGDSRVLQELQERPSQRHQMLYLRQKDANELKTILRELKYRIGIQSAKLLRHLKQKDRLLHKVQRNCDIVTACLQAVSQKRRVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPKEWRRKVWLTLADHYLHSIAIDWDKTMRFTFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGFNILAALILEVMEGNEGDALKIMIYLIDKVLPESYFVNNLRALSVDMAVFRDLLRMKLPELSQH-----LDTLQRTANKESGGGYEPPLTNVFTMQWFLTLFATCLPNQTVLKIWDSVFFEGSEIILRVSLAIWAKLGEQIECCETADEFYSTMGRLTQEMLENDLLQSHELMQTVYSMAPFPFPQLAELREKYTYNITPF---PATVKPTSVSGRHSKARDSDEENDPDDEDAVVNAVGCLGPFSGFLAPELQKYQKQIKEPNEEQSLRSNNIAELSPGAINSCRSEYHAAFNSMMMERMTTDINALKRQY 644          
BLAST of TBC1 domain family member 2B vs. UniProt/SwissProt
Match: sp|Q69ZT9|TBC30_MOUSE (TBC1 domain family member 30 OS=Mus musculus OX=10090 GN=Tbc1d30 PE=1 SV=2)

HSP 1 Score: 431.795 bits (1109), Expect = 3.315e-136
Identity = 222/456 (48.68%), Postives = 302/456 (66.23%), Query Frame = 2
Query:  503 QKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGM--MPSNHLSNYKA--KENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQY 1849
            +++C   TA     +L+   DTKLKF +EP  G   F+QW +A+K VARL  G+P E R+KVWL+LA++++     DW++ ++F FNERSNPDDDS+G+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK VGYCQGFN+LAA+ILEVME NE D+LKIM+YL+D +LPESYF  NL+ALS+DMAVFR+ L + +P+L+ HL+ LQ       A+  +   YEPPLTNVFTMQWFLTLFATCLP   VL IWDS+  EGSEII R  LAIW  L +Q+     AD FY TM  LT ++ +  + Q   L+  +Y+MAP PFP L+ LR+++TYNI PF   P+ I      G  +   D+D++     +    +++GC G +  + +  L  Y+   KE     +L S +I+++ PGA+++  S +H A      ERM TD+  L+ QY
Sbjct:   35 KRSCISRTAPRLLCTLEPGVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPKEWRRKVWLTLADHYLHSIAIDWDKTMRFTFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKNVGYCQGFNILAALILEVMEGNEGDALKIMIYLIDKVLPESYFVNNLRALSVDMAVFRDLLRLKLPELSQHLDTLQRT-----ANKESGGGYEPPLTNVFTMQWFLTLFATCLPNHTVLKIWDSVFFEGSEIILRVSLAIWAKLGEQIECCETADEFYGTMGRLTQEMLEQDLLQSHELMQTVYSMAPFPFPQLAELREKYTYNITPF---PATIKPTSVSGRHSKARDSDDENGPDDEDAVASAVGCLGPLSGLLAPELQKYQKQIKEATEEQTLRSNNIAELSPGAINSCRSEYHAAFNSMMMERMTTDINALKRQY 482          
BLAST of TBC1 domain family member 2B vs. UniProt/SwissProt
Match: sp|B5DFA1|TBD2A_RAT (TBC1 domain family member 2A OS=Rattus norvegicus OX=10116 GN=Tbc1d2 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.081e-28
Identity = 90/285 (31.58%), Postives = 140/285 (49.12%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCD----TFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYN-MAPMPFPGLSNLR 1498
            G+P E R +VW  L   H  VQ    +   +     R    +     QI  DL+RT       T  T S    L+RVLLA++  N  +GYCQG N LAAI L V+E +EE +   +V +V+ ILP  Y+++ L A  +D  V ++ L+  +P+L AH               +   H +    ++ T  WFL +FA  L  D++L +WD+ + EG++++FR  LAI++   + +L++ D+   Y  +R  T  + D        L +  +N M P P   L  LR
Sbjct:  621 GVPREHRPRVWRWLV--HRRVQHLHSSGCYQELLA-RGRACEHPAARQIELDLNRTFPTNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLE-DEESAFWCLVAIVETILPAEYYSKTLTASQVDQRVLQDLLSEKLPRLTAH---------------LGQRHVD---LSLITFNWFLVIFADSLISDILLRVWDAFLYEGTKVVFRYALAIFKYNEEAILRLQDSLEIYQYLRFFTKTICDS-----RKLTSIAFNDMNPFPMKQLRQLR 878          
BLAST of TBC1 domain family member 2B vs. UniProt/SwissProt
Match: sp|B1AVH7|TBD2A_MOUSE (TBC1 domain family member 2A OS=Mus musculus OX=10090 GN=Tbc1d2 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.882e-27
Identity = 87/288 (30.21%), Postives = 141/288 (48.96%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNE---RSNPDDDSLGLQIVKDLHRTGCD----TFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYN-MAPMPFPGLSNLR 1498
            G+P E R +VW  L +  +       +      + E   R    +     QI  DL+RT       T  T S    L+RVLLA++  N  +GYCQG N LAAI L V+E +EE +   +V +V+ ILP  Y+++ L A  +D  V ++ L+  +P+L AH               +  +  +    ++ T  WFL +FA  L  D++L +WD+ + EG++++FR  LAI++   + +L++ D+   Y  +R  T  + D        L++  +N M P P   L  LR
Sbjct:  619 GVPREHRPRVWRWLVHRRVR------HLQAPGCYQELLARGRACEHPAARQIELDLNRTFPTNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLE-DEESAFWCLVAIVETILPAEYYSKTLTASQVDQRVLQDLLSEKLPRLTAH---------------LGQHRVD---LSLITFNWFLVVFADSLISDILLRVWDAFLYEGTKVVFRYALAIFKYNEEAILQLQDSLEIYQYLRFFTKTICDS-----RKLMSIAFNDMNPFPMKQLRQLR 876          
BLAST of TBC1 domain family member 2B vs. TrEMBL
Match: A0A1S3HFQ2 (TBC1 domain family member 30-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106154903 PE=4 SV=1)

HSP 1 Score: 548.125 bits (1411), Expect = 9.631e-174
Identity = 286/585 (48.89%), Postives = 382/585 (65.30%), Query Frame = 2
Query:  125 PDSHSESLFEKHECKNSGESVIDNLLFEIYDKWAYKCRHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLS---SVDISQVGPGAVSTSPSIHHNAS----PGATQERMCTDLITLESQY 1849
            PD H  S F K        S++D+LLFEIYD+W     H  S+DSDT T AS     F   R     +   E E +H   ++++ L  K   EL ++   +K +VA  ++RLVRQL++RDH  AK+QKNCD++TA+LQA+SLKRR D+++KF ++P PG++A++QW +AMK V RLP+G+P E R+KVWLSLA+NHI     DW + +K  FNE+SNPDD+ LGLQIVKDLHRTGC  F+    E +RA+LKRVLLAYARWNK VGYCQGFNV+AA+IL VMER E D+LK+M+YL+DH+LP SYFA NL++LS+DMAVFR+ L + +P L+ HL+ LQ  ++     C   N YEPPLTNVFTMQWFLTLFATCLP   VL +WDS++LEGSE++ RTGL IW  L+ +++ V  AD FY  M  LT+++ D  +  PD LI +IY MAP P P L+ LR+++ +NI PF     A ++ G  G  T        +D + +  +  +I CF        L N +   ++  L ++   + DIS VGPGA   +P    NAS      A  ERM TDL  L+ QY
Sbjct:   87 PDDHDIS-FSKRCSFMRQASIVDDLLFEIYDRW--HVTHRDSFDSDTFTEASSTSEVFHSGRYGSYQL---ELEQRHSNKLNKAFLQNKEEAELRRMVHELKHTVAQMNTRLVRQLRKRDHMKAKLQKNCDVVTAVLQAASLKRRVDSRIKFSLQPLPGDDAYQQWLDAMKAVVRLPMGIPKEFRRKVWLSLADNHIKNLSVDWEKTLKVTFNEKSNPDDNKLGLQIVKDLHRTGCSGFSGQDNEQDRAVLKRVLLAYARWNKTVGYCQGFNVIAALILNVMERKEGDTLKVMIYLIDHVLPTSYFANNLRSLSVDMAVFRDLLRMKLPGLSRHLDYLQAAAK----DCTGAN-YEPPLTNVFTMQWFLTLFATCLPKTTVLRVWDSVLLEGSEVLLRTGLGIWAKLAKRIMTVQSADEFYQMMASLTSEMLDTDLIDPDSLIKKIYAMAPFPLPRLTELREKYEFNITPF----QAAMNAGRLGAKTRSSAHIFSDDDEIEEEDFENINCFSAF----GLFNPQGSPSKGDLGVTPSLTFDISSVGPGAFGANP---ENASMQVKNTAYTERMTTDLGALQKQY 649          
BLAST of TBC1 domain family member 2B vs. TrEMBL
Match: A0A1S3HFS5 (TBC1 domain family member 30-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106154903 PE=4 SV=1)

HSP 1 Score: 546.199 bits (1406), Expect = 4.470e-173
Identity = 285/585 (48.72%), Postives = 382/585 (65.30%), Query Frame = 2
Query:  125 PDSHSESLFEKHECKNSGESVIDNLLFEIYDKWAYKCRHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLS---SVDISQVGPGAVSTSPSIHHNAS----PGATQERMCTDLITLESQY 1849
            PD H  S F K        S++D+LLFEIYD+W     H  S+DSDT T AS         R     +   E E +H + ++++ L  K   EL ++   +K +VA  ++RLVRQL++RDH  AK+QKNCD++TA+LQA+SLKRR D+++KF ++P PG++A++QW +AMK V RLP+G+P E R+KVWLSLA+NHI     DW + +K  FNE+SNPDD+ LGLQIVKDLHRTGC  F+    E +RA+LKRVLLAYARWNK VGYCQGFNV+AA+IL VMER E D+LK+M+YL+DH+LP SYFA NL++LS+DMAVFR+ L + +P L+ HL+ LQ  ++     C   N YEPPLTNVFTMQWFLTLFATCLP   VL +WDS++LEGSE++ RTGL IW  L+ +++ V  AD FY  M  LT+++ D  +  PD LI +IY MAP P P L+ LR+++ +NI PF     A ++ G  G  T        +D + +  +  +I CF        L N +   ++  L ++   + DIS VGPGA   +P    NAS      A  ERM TDL  L+ QY
Sbjct:   87 PDDHDIS-FSKRCSFMRQASIVDDLLFEIYDRW--HVTHRDSFDSDTFTEASSTSEVLHSGRYGSYQL---ELEQRHSSKLNKAFLQNKEEAELRRMVHELKHTVAQMNTRLVRQLRKRDHMKAKLQKNCDVVTAVLQAASLKRRVDSRIKFSLQPLPGDDAYQQWLDAMKAVVRLPMGIPKEFRRKVWLSLADNHIKNLSVDWEKTLKVTFNEKSNPDDNKLGLQIVKDLHRTGCSGFSGQDNEQDRAVLKRVLLAYARWNKTVGYCQGFNVIAALILNVMERKEGDTLKVMIYLIDHVLPTSYFANNLRSLSVDMAVFRDLLRMKLPGLSRHLDYLQAAAK----DCTGAN-YEPPLTNVFTMQWFLTLFATCLPKTTVLRVWDSVLLEGSEVLLRTGLGIWAKLAKRIMTVQSADEFYQMMASLTSEMLDTDLIDPDSLIKKIYAMAPFPLPRLTELREKYEFNITPF----QAAMNAGRLGAKTRSSAHIFSDDDEIEEEDFENINCFSAF----GLFNPQGSPSKGDLGVTPSLTFDISSVGPGAFGANP---ENASMQVKNTAYTERMTTDLGALQKQY 649          
BLAST of TBC1 domain family member 2B vs. TrEMBL
Match: C3YVF5 (Rab-GAP TBC domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_70346 PE=4 SV=1)

HSP 1 Score: 541.191 bits (1393), Expect = 7.339e-173
Identity = 295/624 (47.28%), Postives = 392/624 (62.82%), Query Frame = 2
Query:  182 SVIDNLLFEIYDKWAYKCRHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELK----HYTT-ISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYXXXXXXXXXTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTA-SHIIVSSTYPSLQN 2035
            S+ID LL E+YD+  Y    DS  DSDT T  S           +  +   SE EL+     YT+ +  + L +K ++EL ++   + +   + S +LVRQLKRRD   +K+QKNCDILTAILQA S KRR DT++KF +EP PG + FRQW +AMK V RLP GLPSE RK+VWL LA+ HI   + DW+++ + AFNERSNPDDD LG+QIVKDLHRTGC  F  E +R +LKRVLLAYARWNK VGYCQGFNVLAA+ILEV+ER EED+LK+M+YL+D++LP+S+FA NL+ALS+DMAVFRE L I +P L+ H     L   Q+ A+     +YEPPLTNVF MQWFLTLFATCLP   VL +WDS+  EGSEI+ RT LAIW  L D+L  ++ AD FY TM  L  ++    +  P+ L+  +Y++AP PFPGL  LR+++TYNI PFS + +                  ++E    +     +IGCFGG+ P    S  K +  Q P+S    D+ +V PGA S S + H   +  A  ERM TD+  L+ QY +I+ KQ++T L+    G+E  S+ +            S+  R  P A +H+ V+    S+Q 
Sbjct:   82 SLIDGLLCELYDRVPYGLGRDS-LDSDTYTEYSSTSE-------VHCAGTRSEQELEPSHLTYTSRVQSACLREKEVKELRQMVEELSRRTNMISQKLVRQLKRRDRRKSKLQKNCDILTAILQAVSEKRRIDTRMKFSIEPMPGKKGFRQWFDAMKAVVRLPHGLPSEWRKRVWLCLADKHIQNLQLDWDKMCRLAFNERSNPDDDKLGVQIVKDLHRTGCSGFCAEQDRVVLKRVLLAYARWNKSVGYCQGFNVLAALILEVVERVEEDALKVMIYLIDYVLPDSFFANNLRALSVDMAVFRELLRIRLPDLSKH-----LDDLQKRANSNPQGNYEPPLTNVFVMQWFLTLFATCLPKSTVLRVWDSVFFEGSEILLRTALAIWAKLGDRLRDLDSADQFYGTMAMLCQEMLMMNLIDPNELVQTVYSLAPFPFPGLDELREKYTYNITPFSPLGTDKAK-----KAMKMATNSDEEVELDEDDLAMAIGCFGGIFPP-ETSPKKKEGEQKPVS----DMREVSPGAYS-SRTEHIEMTRTALMERMSTDITALKKQYMRIRQKQQRTHLIYPKQGNENKSTSTHKF---------SATARDTPIAMNHLYVARKIASIQG 672          
BLAST of TBC1 domain family member 2B vs. TrEMBL
Match: A0A0L8ICM3 (Rab-GAP TBC domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22018454mg PE=4 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 1.408e-164
Identity = 285/600 (47.50%), Postives = 387/600 (64.50%), Query Frame = 2
Query:  182 SVIDNLLFEIYDKWAYKCRHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPK-PGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGMMPSNHL-SNYKAKENQMPLSLSS----VDISQVGPGAVSTSPSIHHNAS---PGATQERMCTDLITLESQYXXXXXXXXXTSLLMNNIGHEKISSKSQVLAPS 1945
            S+ D+LLFEIYD+W Y    DS +DSDT T  S A        +   S    E E +     S + L  + +E+L++++ +++  +   S+RLVRQLKRRDH +AK+  N D++TA LQASSLKRR DT++KF +EP   G  A+ QW +AMKGVARLPLG+P E R+KVWLSLA+++I     DW + ++FAFN+R NPDD+ LGLQIVKDLHRTGC +F+    E ERA+LKRVLLAYARWNK VGYCQGFNV+AA++L+V +R E+++LK+MVYL+DH+LP+SYFA NL+ALS+DMAVFR+ L+   P L+ HL NLQ  +Q++ +  I    YEPPLTNVFTMQWFLTLFATCLP   VL +WDSI+LEGSEI+ R  L IW  LS ++L V  AD FY  M  LT ++  G    P+ LI  IY+++P PFP LS LR+++TYNI PFS   ++    G   N          +D   +   +A I CF G+     L S  KAK  +  +S ++     DIS VGPG          N +     A  ERM TDL  L+ QY++++ +Q +  ++++     +  S +  + P+
Sbjct:  177 SIFDDLLFEIYDQW-YDSYRDS-FDSDTFTEYSSAAE-IPHYYTTARSEYHLEIEDRRIKKFSRAYLENQGLEKLKEIESSLRYDINQMSARLVRQLKRRDHRIAKLSCNFDLVTAFLQASSLKRRIDTRIKFSIEPPLVGENAYEQWVDAMKGVARLPLGIPEEFRRKVWLSLADHYIKEIHLDWEKTVRFAFNDRCNPDDNKLGLQIVKDLHRTGCRSFSGHDNEEERAVLKRVLLAYARWNKNVGYCQGFNVIAALLLDVFDRREDEALKVMVYLIDHVLPDSYFANNLRALSVDMAVFRDLLHWKFPYLSQHLENLQKAAQEEASGAI----YEPPLTNVFTMQWFLTLFATCLPKKTVLRLWDSILLEGSEILLRAALVIWNKLSKRILMVGSADEFYTLMGELTQEMVSGDKFSPEKLIKAIYSISPFPFPQLSELREKYTYNIRPFSGTANS----GKKVNQFDGGGVSISDDDLDEEDMEA-IRCFTGLFNLQSLNSANKAKGLEGDVSSTANTNCNDISMVGPGIYGMPSVTDSNLTVNRSSAYMERMTTDLCALKKQYQRLRQRQAQAHIILSAANTYQQKSHTDFITPT 764          
BLAST of TBC1 domain family member 2B vs. TrEMBL
Match: A0A0L8ICT6 (Rab-GAP TBC domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22018454mg PE=4 SV=1)

HSP 1 Score: 509.22 bits (1310), Expect = 1.585e-162
Identity = 285/610 (46.72%), Postives = 388/610 (63.61%), Query Frame = 2
Query:  182 SVIDNLLFEIYDKWAYKCRHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPK-PGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCI----------NNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGMMPSNHL-SNYKAKENQMPLSLSS----VDISQVGPGAVSTSPSIHHNAS---PGATQERMCTDLITLESQYXXXXXXXXXTSLLMNNIGHEKISSKSQVLAPS 1945
            S+ D+LLFEIYD+W Y    DS +DSDT T  S A        +   S    E E +     S + L  + +E+L++++ +++  +   S+RLVRQLKRRDH +AK+  N D++TA LQASSLKRR DT++KF +EP   G  A+ QW +AMKGVARLPLG+P E R+KVWLSLA+++I     DW + ++FAFN+R NPDD+ LGLQIVKDLHRTGC +F+    E ERA+LKRVLLAYARWNK VGYCQGFNV+AA++L+V +R E+++LK+MVYL+DH+LP+SYFA NL+ALS+DMAVFR+ L+   P L+ HL NLQ  +Q++ +  I          +   YEPPLTNVFTMQWFLTLFATCLP   VL +WDSI+LEGSEI+ R  L IW  LS ++L V  AD FY  M  LT ++  G    P+ LI  IY+++P PFP LS LR+++TYNI PFS   ++    G   N          +D   +   +A I CF G+     L S  KAK  +  +S ++     DIS VGPG          N +     A  ERM TDL  L+ QY++++ +Q +  ++++     +  S +  + P+
Sbjct:  177 SIFDDLLFEIYDQW-YDSYRDS-FDSDTFTEYSSAAE-IPHYYTTARSEYHLEIEDRRIKKFSRAYLENQGLEKLKEIESSLRYDINQMSARLVRQLKRRDHRIAKLSCNFDLVTAFLQASSLKRRIDTRIKFSIEPPLVGENAYEQWVDAMKGVARLPLGIPEEFRRKVWLSLADHYIKEIHLDWEKTVRFAFNDRCNPDDNKLGLQIVKDLHRTGCRSFSGHDNEEERAVLKRVLLAYARWNKNVGYCQGFNVIAALLLDVFDRREDEALKVMVYLIDHVLPDSYFANNLRALSVDMAVFRDLLHWKFPYLSQHLENLQKAAQEEASGLIKYIPFIPQFESGAIYEPPLTNVFTMQWFLTLFATCLPKKTVLRLWDSILLEGSEILLRAALVIWNKLSKRILMVGSADEFYTLMGELTQEMVSGDKFSPEKLIKAIYSISPFPFPQLSELREKYTYNIRPFSGTANS----GKKVNQFDGGGVSISDDDLDEEDMEA-IRCFTGLFNLQSLNSANKAKGLEGDVSSTANTNCNDISMVGPGIYGMPSVTDSNLTVNRSSAYMERMTTDLCALKKQYQRLRQRQAQAHIILSAANTYQQKSHTDFITPT 778          
BLAST of TBC1 domain family member 2B vs. Ensembl Cavefish
Match: tbc1d30 (TBC1 domain family member 30 [Source:NCBI gene;Acc:103024461])

HSP 1 Score: 425.631 bits (1093), Expect = 9.204e-134
Identity = 233/506 (46.05%), Postives = 324/506 (64.03%), Query Frame = 2
Query:  563 DTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGMMPSNHLSNYKA--KENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYXXXXXXXXXTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTASHIIVSSTYPSLQNSMVNHLFLTR 2065
            DT+LKF +EP  G   F+QW +A+K VARLP G+P E R+KVWL+LA+ ++     DW + ++FAFNERSNPDDDSLG+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK VGYCQGFNVLAA+ILEV E NE D+LK+M+YL+D +LP+SYFA NL+ALS+DMAVFR+ L I +P+L+ HL++LQ       A+      YEPPLTNVFTMQWFLT+FATCLP   VL IWDS+  EGSE++ R  LAIW  L +++ +   AD FY TM  LT ++ +  +   + L+  +Y+MA  PFP L+ LR+++TYNI PF   P+ + + GS G    E D D D D +   V         G + +  +  Y+   KE +  L+ SS +++++ PGAV    + H         ERM TD+  L  QY +IK +Q++ + L+    H  +  +++ +AP +  +  S+     P A+ ++ S  + S    +VNHL L R
Sbjct:   56 DTRLKFTLEPSLGKNGFQQWYDALKSVARLPTGIPKEWRRKVWLTLADQYLHSISIDWEKTMRFAFNERSNPDDDSLGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGFNVLAALILEVTEGNEGDALKVMIYLIDKVLPDSYFANNLRALSVDMAVFRDLLRIKLPELSQHLHHLQKV-----ANRTGGGSYEPPLTNVFTMQWFLTMFATCLPHHTVLKIWDSVFFEGSEVLLRVALAIWAKLGERIEECQTADEFYSTMGILTQEMLEQNLIDSNELMQTVYSMADFPFPQLAELREKYTYNITPF---PAPVKANGSQGIHGWESDDDGDMDDEDSIVTALGCLGPLGGLLAPEIQRYQKHLKEQRGELTSSSSNMAELSPGAVGGGRAEHQATMNSMMLERMSTDIRALTKQYSRIKRRQQQQAGLL--YIHTGLPVETEPVAPHQPSEWASNDSGKCP-ATSVMASQVHTS---PVVNHLLLGR 547          
BLAST of TBC1 domain family member 2B vs. Ensembl Cavefish
Match: tbc1d30 (TBC1 domain family member 30 [Source:NCBI gene;Acc:103024461])

HSP 1 Score: 422.55 bits (1085), Expect = 5.927e-133
Identity = 215/434 (49.54%), Postives = 287/434 (66.13%), Query Frame = 2
Query:  563 DTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGMMPSNHLSNYKA--KENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQY 1849
            DT+LKF +EP  G   F+QW +A+K VARLP G+P E R+KVWL+LA+ ++     DW + ++FAFNERSNPDDDSLG+QIVKDLHRTGC ++     E +R +LKRVLLAYARWNK VGYCQGFNVLAA+ILEV E NE D+LK+M+YL+D +LP+SYFA NL+ALS+DMAVFR+ L I +P+L+ HL++LQ       A+      YEPPLTNVFTMQWFLT+FATCLP   VL IWDS+  EGSE++ R  LAIW  L +++ +   AD FY TM  LT ++ +  +   + L+  +Y+MA  PFP L+ LR+++TYNI PF   P+ + + GS G    E D D D D +   V         G + +  +  Y+   KE +  L+ SS +++++ PGAV    + H         ERM TD+  L  QY
Sbjct:   56 DTRLKFTLEPSLGKNGFQQWYDALKSVARLPTGIPKEWRRKVWLTLADQYLHSISIDWEKTMRFAFNERSNPDDDSLGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGFNVLAALILEVTEGNEGDALKVMIYLIDKVLPDSYFANNLRALSVDMAVFRDLLRIKLPELSQHLHHLQKV-----ANRTGGGSYEPPLTNVFTMQWFLTMFATCLPHHTVLKIWDSVFFEGSEVLLRVALAIWAKLGERIEECQTADEFYSTMGILTQEMLEQNLIDSNELMQTVYSMADFPFPQLAELREKYTYNITPF---PAPVKANGSQGIHGWESDDDGDMDDEDSIVTALGCLGPLGGLLAPEIQRYQKHLKEQRGELTSSSSNMAELSPGAVGGGRAEHQATMNSMMLERMSTDIRALTKQY 481          
BLAST of TBC1 domain family member 2B vs. Ensembl Cavefish
Match: tbc1d2 (TBC1 domain family, member 2 [Source:ZFIN;Acc:ZDB-GENE-140106-100])

HSP 1 Score: 122.865 bits (307), Expect = 4.167e-28
Identity = 87/267 (32.58%), Postives = 137/267 (51.31%), Query Frame = 2
Query:  632 MKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKF--AFNERSNPDDDSLGLQIVKDLHRTGCDT--FATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSD 1414
            +KG+ R   G+P E R++VW  +     T  K D  R         E+S         QI  DLHRT      F++ S  A+  L RVLLA+A  N  VGYCQG N LAA+ L V++ NEED+   +V +V  ++P+ Y+ + L     D  VF++F+   +P+L AHL    +                    ++ T  WFL +F   LP +++L +WD+   EG+++IFR  LA+++   + +LK++D+   Y  +R  T  ++D
Sbjct:  504 LKGLLRW--GIPREYRRRVWSWMVR---TRTKSDRERHPDLFQQLCEKSLTTPHPASRQIQLDLHRTLTTNQHFSSPSSPALQQLHRVLLAFAWQNPEVGYCQGLNRLAALALLVLQ-NEEDAFWCLVTIVQSLMPQDYYTKTLLGSQADQRVFKDFMAEKLPRLVAHLEEHNVD------------------VSLITFNWFLVVFVESLPSEILLKVWDAFFYEGTKVIFRYALALFKYKEEDILKIHDSTEIYQYLRFFTKTVTD 746          
BLAST of TBC1 domain family member 2B vs. Ensembl Cavefish
Match: tbc1d2 (TBC1 domain family, member 2 [Source:ZFIN;Acc:ZDB-GENE-140106-100])

HSP 1 Score: 116.701 bits (291), Expect = 2.904e-26
Identity = 88/296 (29.73%), Postives = 143/296 (48.31%), Query Frame = 2
Query:  632 MKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKF--AFNERSNPDDDSLGLQIVKDLHRTGCDT--FATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGS-EIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLR 1498
            +KG+ R   G+P E R++VW  +     T  K D  R         E+S         QI  DLHRT      F++ S  A+  L RVLLA+A  N  VGYCQG N+ A  +  ++ +NEED+   +V +V  ++P+ Y+ + L     D  VF++F+   +P+L AHL    +                    ++ T  WFL +F   LP +++L +WD+   EG+ ++IFR  LA+++   + +LK++D+   Y  +R  T  ++D  +     +      + P P   L N R
Sbjct:  473 LKGLLRW--GIPREYRRRVWSWMVR---TRTKSDRERHPDLFQQLCEKSLTTPHPASRQIQLDLHRTLTTNQHFSSPSSPALQQLHRVLLAFAWQNPEVGYCQGLNLAALAL--LVLQNEEDAFWCLVTIVQSLMPQDYYTKTLLGSQADQRVFKDFMAEKLPRLVAHLEEHNVD------------------VSLITFNWFLVVFVESLPSEILLKVWDAFFYEGTKQVIFRYALALFKYKEEDILKIHDSTEIYQYLRFFTKTVTDSKL-----MTIAFTELNPFPMKLLRNRR 738          
BLAST of TBC1 domain family member 2B vs. Ensembl Cavefish
Match: sgsm3 (small G protein signaling modulator 3 [Source:NCBI gene;Acc:103030541])

HSP 1 Score: 107.457 bits (267), Expect = 2.466e-23
Identity = 72/257 (28.02%), Postives = 128/257 (49.81%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRT----GCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDG 1417
            G+P  +R ++W+ L+     +QK   + +      + S+ DD +   QI KDL RT     C +  T      LKRVL   A     +GYCQG  ++ + +L  +E  EED+L +M  L++ +LP SYF+  L  +  D  V R+ +  ++P L                  +  +  E    ++ ++ WFLT FA+ +   ++L IWD +  +GS ++F+  L + ++  ++L+   ++ S + T+  L +QL DG
Sbjct:  115 GIPHSMRPQLWMRLSG---ALQKKRTSEISYREIIKNSSNDDTTAAKQIEKDLLRTMPTNACFSTLTSVGVPRLKRVLRGLAWLYPDIGYCQGTGMVVSCLLLFLE--EEDALWMMCALIEDLLPPSYFSSTLLGVQTDQRVLRQLIVQYLPSLD---------------QLLQEHDIE---LSLISLHWFLTSFASVVDIRILLRIWDLLFYDGSIVLFQVTLGMLKIKEEELVSSENSASIFNTLSDLPSQLEDG 348          
BLAST of TBC1 domain family member 2B vs. Ensembl Sea Lamprey
Match: tbc1d2b (TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB-GENE-100922-148])

HSP 1 Score: 132.494 bits (332), Expect = 1.041e-31
Identity = 81/256 (31.64%), Postives = 128/256 (50.00%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDT--FATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSD 1414
            G+P E+R +VW      H+   +            ERS+   +    Q+  DL RT  +   F T+S   I  L+RVLLAYA  N  VGYCQG N LAAI L  +E  EE +   +V +V+ ++P  Y+++ L A  +D  +F+E +   +P+LAAH     +                    ++ T  WFL LF   +  D+V  IWD+ + EG+++IFR  LA+ +   +QL+K +   + +  +R  T+ + D
Sbjct:  655 GVPHELRSRVWRWAVEQHVRAIRGRHAASYYCELLERSHGQHNPAARQVELDLPRTLPNNRHFETQSSEGIVKLRRVLLAYAWHNPEVGYCQGLNRLAAIALIYLE--EEQAFWCLVAIVECLMPPDYYSKTLLASQVDQRLFKELVTEKLPRLAAHFEQHGVD------------------VSLITFNWFLVLFVDSVGSDMVFRIWDAFLYEGTKVIFRYALAMLKCREEQLIKHHSNSAIFNYLRIFTHSIHD 890          
BLAST of TBC1 domain family member 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006389.1 (pep scaffold:Pmarinus_7.0:GL481951:143257:161898:-1 gene:ENSPMAG00000005741.1 transcript:ENSPMAT00000006389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 1.170e-20
Identity = 65/239 (27.20%), Postives = 117/239 (48.95%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYD--WNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVND 1363
            G+P  +R ++W+  +     +  Y   +  +++ +    S   D+     I +DLHR+  +  A +SE  I  L+RVL AYA  N  +GYCQ  N++ +++L  +   EE++  ++V L + +LP+ Y  + + AL +D  VF E    H+P+L   +                    +  + +  ++ WFLTLF + LP    + + D  ML+G  +IF+  LA+      +LL  +D
Sbjct:  432 GIPESLRGELWMHFSGAIHEMNSYPGYYAEIVRSSMGRMSLVTDE-----IERDLHRSLPEHPAFQSEMGIAALRRVLTAYAHRNPSIGYCQAMNIVTSVLL--LYTKEEEAFWLLVALCERMLPDYYNTRVVVAL-VDQGVFEELTREHLPQLCERMQ-------------------DLGVISTISLSWFLTLFLSVLPFSSAVCVVDCFMLDGVRMIFQLALAVLHANMGKLLSCHD 643          
BLAST of TBC1 domain family member 2B vs. Ensembl Sea Lamprey
Match: TBC1D9 (TBC1 domain family member 9 [Source:HGNC Symbol;Acc:HGNC:21710])

HSP 1 Score: 87.8113 bits (216), Expect = 6.988e-18
Identity = 66/237 (27.85%), Postives = 111/237 (46.84%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVND 1363
            G+P  +R+++WL  +     V     N        +RS         +I +DLHR+  +  A +    I  L+RVL AYA  N R+GYCQ  N++ + +L  +  +EE++  ++V L + +LP+ Y  + + AL ID  VF E +   +P L                   +    E       ++ WFLTLF + LP +    + D  ML+G+ ++F+  LA+    ++ LL   D
Sbjct:  443 GIPVRLRRELWLLFSG---AVHDMGSNPGHYAELVDRSLGRASIATEEIERDLHRSLPEHPAFQHPLGIDALRRVLTAYAHRNPRIGYCQAMNIVTSALL--IFASEEEAFWLLVALCERLLPDYYNNRVVGAL-IDQGVFEELIAEFLPTL-------------------HERLQELGFIATTSLSWFLTLFLSVLPLESAACVLDCFMLDGARVLFQLALAVLHANAEPLLACRD 654          
BLAST of TBC1 domain family member 2B vs. Ensembl Sea Lamprey
Match: tbc1d10b (TBC1 domain family, member 10b [Source:ZFIN;Acc:ZDB-GENE-030131-7754])

HSP 1 Score: 75.8702 bits (185), Expect = 1.193e-14
Identity = 70/278 (25.18%), Postives = 116/278 (41.73%), Query Frame = 2
Query:  605 EAFRQWCEAM-KGVARLPL----GLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIV-KDLHRTGC--DTFATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTN--VFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTN 1402
            E  R W + + KG  ++ L    G+P  +R + W  L+ +   +++      +   F E      D   L+++ KDLHR     + F  +  +    L RVL AY  +    GYCQG   +AA++L  M    E++    V + +  LP  Y++  L++L +D  +    L                       S I   H +    +  ++  +WF+ +F+  LP D VL +WD    EG + +FR GL +         +V      Y TM  L N
Sbjct:   15 EMLRYWDKWITKGYKKVKLRCRKGIPPSLRARAWEHLSGSKYIMEQ------MPGKFEELDKLPGDPKWLEVIQKDLHRQFPFHELFRAKGGQGQQDLFRVLKAYTVYRPEEGYCQGQAPVAAVLL--MHMPAEEAFWCFVQICEKYLP-GYYSAGLESLQLDGEILFALLR--------------------KVSLIGYRHLKWHSVDPVLYMTEWFMCVFSRTLPWDSVLRVWDMFFCEGVKTMFRVGLVLLRHALGNSERVRMCPGLYETMEQLKN 263          
BLAST of TBC1 domain family member 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010479.1 (pep scaffold:Pmarinus_7.0:GL480469:1915:23479:-1 gene:ENSPMAG00000009488.1 transcript:ENSPMAT00000010479.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 1.572e-13
Identity = 48/159 (30.19%), Postives = 77/159 (48.43%), Query Frame = 2
Query:  875 VLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLL 1351
            V+ AY+  ++ VGYCQG   +  ++L  M+  EE++  + + L+        F  ++  L + M      +   + +L AHL+              ++ H     T++F   WFLT+F T  P  L   I+D  M EG E+IFR G+AI   L D+LL
Sbjct:   45 VMKAYSLVDREVGYCQGSAFIVGLLL--MQMPEEEAFCVFIRLMHDYRLRELFKPSMAELGLCMYQIESLMQDQLSQLHAHLST-------------HSVH-----TSMFASPWFLTVFLTTFPLPLAARIFDWFMCEGLEVIFRVGVAILSALQDELL 183          
BLAST of TBC1 domain family member 2B vs. Ensembl Yeast
Match: MDR1 (Cytoplasmic GTPase-activating protein; activates Ypt/Rab transport GTPases Ypt6p, Ypt31p and Sec4p; involved in recycling of internalized proteins and regulation of Golgi secretory function [Source:SGD;Acc:S000003332])

HSP 1 Score: 83.5741 bits (205), Expect = 8.190e-17
Identity = 69/264 (26.14%), Postives = 125/264 (47.35%), Query Frame = 2
Query:  656 LGLPSEIRKKVW--LSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPD 1435
            +G+P+ +R ++W   S A         ++ R++    NE +     ++  +I KDL R+  +  A ++E  I  L+ VL AY+  N  VGYCQ  N++ A  L  M  +EE +   +  L D  +P  Y+++ +    +D  VF  F+   +P L  ++                   ++  L+ V ++ WFL+LF T +P +  + I D   + GS  +F+  LA+ ++ +D +L+ +D   F   ++     L  G  A PD
Sbjct:  243 IGVPNRMRGEIWELCSGAMYMRYANSGEYERIL----NENAGKTSQAID-EIEKDLKRSLPEYSAYQTEEGIQRLRNVLTAYSWKNPDVGYCQAMNIVVAGFLIFM--SEEQAFWCLCNLCDIYVP-GYYSKTMYGTLLDQRVFESFVEDRMPVLWEYIL-----------------QHDIQLS-VVSLPWFLSLFFTSMPLEYAVRIMDIFFMNGSITLFQVALAVLKINADDILQADDDGMFIAIIKHYFQTL--GQSAHPD 478          
BLAST of TBC1 domain family member 2B vs. Ensembl Yeast
Match: MSB4 (GTPase-activating protein of the Ras superfamily; acts primarily on Sec4p, localizes to the bud site and bud tip; msb3 msb4 double mutation causes defects in secretion and actin organization; similar to the TBC-domain Tre2 oncogene; MSB4 has a paralog, MSB3, that arose from the whole genome duplication; human homolog USP6NL can complement yeast msb3 msb4 double null mutant [Source:SGD;Acc:S000005472])

HSP 1 Score: 81.2629 bits (199), Expect = 2.493e-16
Identity = 69/250 (27.60%), Postives = 116/250 (46.40%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNH----ITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDT--FATES----ERAI---LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXX---XXXXXASCINNNHY--EPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLK 1354
            G+P+E R   W   A         V  YD    +K    E +    D   ++  +DL+RT  D   F  ES    E AI   L+RVL+A++ ++K +GYCQ  N L  ++L  ME  EE +  ++V +    LP  Y   +L+  ++D  V    +  ++P++ +H+ +  +    S  Q +   +   Y    P   + T  WF++ F   +P +  L IWD +  E S  +F+  L I +L   + L+
Sbjct:  147 GIPAEWRGNAWWYFAGGQRQLDANVGVYD---RLKSDCREGAVSGKDMEAIE--RDLYRTFPDNIHFHKESFQNGEPAIIRSLRRVLMAFSVYDKTIGYCQSMNFLVGLLLLFME--EEKAFWMLVIITGKYLPGVY-ESDLEGANVDQGVLVLCIKEYLPEIWSHIESSYMNGNGSTDQISGPASGEEYLCRLPTLTLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVALGILKLSESEFLE 388          
BLAST of TBC1 domain family member 2B vs. Ensembl Yeast
Match: MSB3 (Rab GTPase-activating protein; regulates endocytosis via inactivation of Vps21p at endosomes and vacuole fusion via inactivation of Ypt7p at vacuoles; also acts on Ypt52p and Sec4p; localizes to plasma membrane, sites of polarized growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; similar to TBC-domain Tre2 oncogene; MSB3 has a paralog, MSB4, that arose from the whole genome duplication; human homolog USP6NL can complement yeast msb3 msb4 double null [Source:SGD;Acc:S000005237])

HSP 1 Score: 72.7886 bits (177), Expect = 1.431e-13
Identity = 69/263 (26.24%), Postives = 122/263 (46.39%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNRVI------KFAFNERSNPDDDSL-GLQIV-KDLHRTGCDTFATESER---------AILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAA--------HXXXXXXXXXXXXASCINNNHYE-----PPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKV 1357
            G+P+E R   W   A      +K + N+ +      K    ++ NP++  +  L I+ +DL+RT  D    +S             L+RVL+A++ +N ++GYCQ  N LA ++L  ++  EE +  ++V +    LP  +   NL+ ++ID  V    +  ++P++ +        H  N +  S        N    E     PP+T + T  WF++ F   +P +  L IWD +  E S  +F+  LA+ +L    L K+
Sbjct:  223 GIPAEWRGNAWWHFARGQ---EKLNKNKGVYSQLLRKMKQIKKQNPNEKQVQDLDIIERDLNRTFPDNIHFQSSLHNKEGPPIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLD--EERAFWMLVIITSRYLPGVHNI-NLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNNKTFSPSNKKVLFNMQKNEFLYRLPPIT-LCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVSLAVLKLSEHDLSKI 478          
BLAST of TBC1 domain family member 2B vs. Ensembl Yeast
Match: GYP5 (GTPase-activating protein (GAP) for yeast Rab family members; involved in ER to Golgi trafficking; exhibits GAP activity toward Ypt1p that is stimulated by Gyl1p, also acts on Sec4p; interacts with Gyl1p, Rvs161p and Rvs167p; involved in recruiting Rvs167p to the bud tip during polarized growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; GYP5 has a paralog, GYL1, that arose from the whole genome duplication [Source:SGD;Acc:S000006170])

HSP 1 Score: 65.855 bits (159), Expect = 2.302e-11
Identity = 57/223 (25.56%), Postives = 96/223 (43.05%), Query Frame = 2
Query:  644 ARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSL-GLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFR 1309
            A +  G+P +IR  +W  +AN+     +  +  ++          D + L    I +DL RT    F  E +   L +V+  Y+ ++  VGY QG   +AA +L +   NE +S  ++V L+ +      F   +  L + +  F   L  H P                  S  N    E   + ++  QWFLT FA   P + VL I+D + +EG E++ +
Sbjct:  446 AHVTNGIPPQIRGIIWQLMANSKSREMEDIYETLL----------DTECLHEATIRRDLRRT---KFVAEDKMESLYKVIKVYSVYDPDVGYTQGMGFIAAPLL-INCENEAESFGLLVGLMKNYGLRELFLPGMPGLMLMLYQFDRLLEEHSP------------------SLYNRLIREGISSTMYATQWFLTFFAYKFPLEFVLRIFDIVFVEGIEVLLK 636          
BLAST of TBC1 domain family member 2B vs. Ensembl Nematostella
Match: EDO34898 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN40])

HSP 1 Score: 331.643 bits (849), Expect = 1.232e-104
Identity = 171/353 (48.44%), Postives = 233/353 (66.01%), Query Frame = 2
Query:  731 DWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFA---TESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFS-SIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGMMPSNHL----SNYKAKENQMPLSLSSVDISQVGPGAVST 1765
            DW + +KF FNERSNPDDD LG QIVKDLHRTGC  F    T  ERA LKRVLLAYARWNK VGYCQGFNV+AA+IL+VM+R+EED+LK+M+Y++DH+LP +YF+ NL+ALS+DMAV R+ + + +P+L+ HL NLQ Q+   +      + YEPPL NVFTMQWFLTLFATCLP ++VL +WDS++LEGSE++ R  LAIW  L  +L  V  +D FY  M  L  +++ G +     ++  +Y++AP P PGL+ LR+++TYNI+PFS S   A  S G               D +    +  ++GC G ++P +          + + + P S  S DI++  PG  +T
Sbjct:    2 DWQKTVKFCFNERSNPDDDELGSQIVKDLHRTGCAWFCGNDTPEERAALKRVLLAYARWNKSVGYCQGFNVIAALILQVMDRSEEDALKVMIYVIDHVLPTNYFSNNLRALSVDMAVCRDLMRLKLPRLSRHLENLQAQATAHHG---GTSVYEPPLINVFTMQWFLTLFATCLPQEIVLRVWDSVLLEGSEVLLRVALAIWAKLGKRLEDVETSDEFYGKMGLLIQEIAVGNLIDCRSIMQAVYSLAPFPLPGLAALREQYTYNIHPFSDSQEKAPRSLGH-----------ASSDEEEDDADLDNVGCLGVLLPFSEFSPPSPAKSSSDGETP-SRRSSDIAEASPGVFAT 339          
BLAST of TBC1 domain family member 2B vs. Ensembl Nematostella
Match: EDO34047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQE4])

HSP 1 Score: 100.523 bits (249), Expect = 3.140e-23
Identity = 65/239 (27.20%), Postives = 123/239 (51.46%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTF----ATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVND 1363
            G+PS  R +VW+ ++     ++K     +  +  +   +  DD +   I+ D+ RT  +      +++S +  LK +L+AYA  N ++GYCQG N +A ++L ++ + EE +  ++  ++   LP+ Y+A+++  L ++  V  E + I +P L  H               I  ++      ++F+ +WF+ L+   LP + VL IWDS+  EGS+I+ R  + +  L  D+LL   D
Sbjct:   58 GVPSSHRAQVWMDISGARKRMKK-----LPGYYQSLLESELDDIVRNSILTDIDRTFPENIYFGSSSDSLKQKLKNILVAYAVHNPKIGYCQGLNYIAGLLLLII-KTEEPAFWLLEAMMMKRLPD-YYAKDMMGLQVEQEVLSELVKIKLPTLHHH------------IESIGLSY------SIFSTKWFICLYIDVLPVETVLRIWDSLFYEGSKILLRVAITLLALHQDKLLAAKD 271          
BLAST of TBC1 domain family member 2B vs. Ensembl Nematostella
Match: EDO34196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ41])

HSP 1 Score: 95.1301 bits (235), Expect = 7.575e-22
Identity = 60/220 (27.27%), Postives = 108/220 (49.09%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQK------YDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEI 1300
            G+P+E R ++W    N+ +   K      Y  + +   A N + +P    + L +++ L           +   +L+ VL+AY+  N  VGYCQG N L AI + +++  EE++   +V +V+HI+P+ YF++ L A   D  V R+ L   +P+L  H  N+++                    ++ T  WFLT+F    P   +L +WD+ + EG+++
Sbjct:   37 GIPNEYRSQIWRQCINHFVRGTKSMAGPNYYAHLLDSIASNIKFSPATKQIELDLLRTLPNNVHYNKPDANGIGMLRNVLMAYSWHNPEVGYCQGLNRLVAIAMLILK--EEEAFWCLVAIVEHIMPKDYFSRTLLAAQADQRVLRDLLMEKLPRLYTHFENVRVD------------------LSLITFNWFLTVFIDSFPIQTILRVWDTFLYEGNKV 236          
BLAST of TBC1 domain family member 2B vs. Ensembl Nematostella
Match: EDO49828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REP1])

HSP 1 Score: 94.3597 bits (233), Expect = 1.461e-19
Identity = 67/239 (28.03%), Postives = 121/239 (50.63%), Query Frame = 2
Query:  659 GLPSEIRKKVWL--SLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVND 1363
            G+P  +R ++WL  S A N I      +  +++    + S   D     +I +DLHR+  +  A +S+  I  L+RVL AYA  N  +GYCQ  N++A+++L  +   EE +  ++V + + +LP+ Y  + + AL +D  VF +    H+P+L  HL                    +  + N+ ++ WFLTLF + +P    ++I D    +G++++F+  LA  +    +LL + D
Sbjct:  520 GIPDNLRAEIWLIFSGAINEIETHPGYYVSLVEQCEGKSSLAFD-----EIERDLHRSLPEHPAFQSDVGIGALRRVLTAYAWRNPSIGYCQAMNIVASVLL--LYCTEEQAFWLLVAVCERLLPDYYNTKVVGAL-VDQGVFEDLTRDHLPELYDHLK-------------------DLGILNMISLSWFLTLFLSVMPFVCAVNIIDCFFYDGAKVLFQIALACLDANRTKLLSIED 731          
BLAST of TBC1 domain family member 2B vs. Ensembl Nematostella
Match: EDO35021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP1])

HSP 1 Score: 83.9593 bits (206), Expect = 1.517e-16
Identity = 62/262 (23.66%), Postives = 121/262 (46.18%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQK-----YDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRT----GCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDG 1417
            G+P  +R  +W+ ++     +QK     + + +V++ + +E S         QI KDL RT     C +  T +    ++R+L + A     +GYCQG  ++ A +L  +E  EED+  +   +++ + P SY++  L  +  D  V R+ +  ++P                    +  +  E  L    T+ WFLT FA+ +   ++L IWD    EGS  +FR  L + +L  + +L ++++   +  +  +   ++D 
Sbjct:   97 GIPHSMRAPIWMRISG---ALQKKINAEFTYKQVVRASSDENSPASK-----QIEKDLLRTMPNNACFSTPTSTGLLRMRRILRSLAWLYPDIGYCQGMGMIVASLLLFVE--EEDAFWLTSTIIEDLNPPSYYSSTLIGVQADQRVLRQLIVSYLPHTDQQ---------------LKEHDIELSL---ITLHWFLTAFASVVHTKILLRIWDIYFYEGSVTLFRATLGMLKLKQEYILTLDNSAQIFNVLSDIPGDITDA 330          
BLAST of TBC1 domain family member 2B vs. Ensembl Medaka
Match: tbc1d30 (TBC1 domain family member 30 [Source:NCBI gene;Acc:101166922])

HSP 1 Score: 401.364 bits (1030), Expect = 7.542e-126
Identity = 187/337 (55.49%), Postives = 246/337 (73.00%), Query Frame = 2
Query:  563 DTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFAT---ESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGS 1564
            DT+LKF +EP  G   F+QW +A+K VARLP G+P E RK+VWL+LA+ ++     DW + ++FAFNERSNPDDDSLG+QIVKDLHRTGC ++     E +R +LKRVLLA+ARWNK VGYCQGFNVLAA+ILEV E +E D+LK+M+YL+D +LP+SYFA NL+ALS+DMAVFR+ L + +P+L+ HL++LQ       A+      YEPPLTNVFTMQWFLT+FATCLP   VL IWDS+  EGSE++FR  LAIWE L +++     AD FY TM  LT ++ +  +     L+  +Y+MA  PFP L+ LR+++TYNI PF   P+++   GS
Sbjct:   56 DTRLKFTIEPSLGKNGFQQWYDALKAVARLPTGVPKEWRKRVWLTLADQYLHSISIDWEKTLRFAFNERSNPDDDSLGIQIVKDLHRTGCSSYCGQEGEQDRVVLKRVLLAFARWNKTVGYCQGFNVLAALILEVTEGSESDALKVMIYLIDKVLPDSYFANNLRALSVDMAVFRDLLRLKLPRLSQHLHHLQKA-----ANREAGGSYEPPLTNVFTMQWFLTMFATCLPAHTVLRIWDSVFFEGSEVLFRVALAIWERLGERIEDCQTADEFYSTMGGLTQEMLEQNLIDATELMQEVYSMAAFPFPQLAELREKYTYNITPF---PTSVKPNGS 384          
BLAST of TBC1 domain family member 2B vs. Ensembl Medaka
Match: ENSORLT00000025434.2 (TBC1 domain family member 2A-like [Source:NCBI gene;Acc:101163797])

HSP 1 Score: 132.88 bits (333), Expect = 1.338e-31
Identity = 84/258 (32.56%), Postives = 134/258 (51.94%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNR-VIKFAFNERSNPDDDSLGLQIVKDLHRTGCDT--FATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDG 1417
            G+P E R +VW  +        +  W+  V++     R+ P   +  +Q+  DLHRT      F++ S  A+  L+R+LL+++  N  VGYCQG N LAAI L V++ NEED+   ++ +V+ I+PE Y+ +NL A  +     R  L   +P+LAAH     +                     + T  WFL +F   LP D++L +WD+ + EG+++IFR  LA+++   D +LK+ND    Y  +R  T  +SD 
Sbjct:  350 GVPQEYRSRVWRWMIRART---RTIWDSGVLQLCEKSRTFPHPATRQIQL--DLHRTLTTNQHFSSPSSPALQELRRILLSFSWHNPTVGYCQGLNRLAAIALLVLQ-NEEDAFWCLLAVVETIMPEDYYTKNLMASQV-----RRLLVEKLPRLAAHFEKHNID------------------VTLITFNWFLVVFVESLPSDILLPLWDAFLYEGTKVIFRYALALFKYKEDDILKINDGVEIYQYLRFFTKTVSDS 578          
BLAST of TBC1 domain family member 2B vs. Ensembl Medaka
Match: tbc1d2b (TBC1 domain family member 2B [Source:NCBI gene;Acc:101174263])

HSP 1 Score: 105.145 bits (261), Expect = 1.740e-22
Identity = 80/291 (27.49%), Postives = 141/291 (48.45%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKY------DWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTN--VFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIY-NMAPMPFPGLSNLR 1498
            G+P E R KVW    + H  V+K+      D+   +     E+ NP    + L +++ L       +A+ S   I  L+ VL+A++  N  +GYCQG N LAAI L  +  ++ED+   +V +V+  +P  Y+ + L    +D  VF++ ++  +P+L AH                    +E  + +  + T  WFL +F   +  D++  IWD+ + EG +IIFR  LA+++   ++ LK++D+ + +  +R  T  + D        L+N  +  M P P   + N R
Sbjct:  628 GVPHEHRSKVWRWCVSFH--VKKFRDHLAPDYYETLLNVAREKPNPASKQIELDLLRTLPNN--KHYASPSAAGIQKLRNVLVAFSWRNPDIGYCQGLNRLAAITLLYL--DQEDAFWALVAIVEVFMPRDYYTKTLLGSQVDQRVFKDLMSEKLPRLHAH--------------------FEQQMVDFSLITFNWFLVVFVDSVVSDILFKIWDAFLFEGPKIIFRFALALFKYKEEEFLKLHDSTATFKYLRYFTRTILDS-----RKLMNIAFAGMNPFPMKQIHNRR 887          
BLAST of TBC1 domain family member 2B vs. Ensembl Medaka
Match: tbc1d2b (TBC1 domain family member 2B [Source:NCBI gene;Acc:101174263])

HSP 1 Score: 104.76 bits (260), Expect = 2.129e-22
Identity = 80/291 (27.49%), Postives = 141/291 (48.45%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKY------DWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAI--LKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTN--VFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIY-NMAPMPFPGLSNLR 1498
            G+P E R KVW    + H  V+K+      D+   +     E+ NP    + L +++ L       +A+ S   I  L+ VL+A++  N  +GYCQG N LAAI L  +  ++ED+   +V +V+  +P  Y+ + L    +D  VF++ ++  +P+L AH                    +E  + +  + T  WFL +F   +  D++  IWD+ + EG +IIFR  LA+++   ++ LK++D+ + +  +R  T  + D        L+N  +  M P P   + N R
Sbjct:  669 GVPHEHRSKVWRWCVSFH--VKKFRDHLAPDYYETLLNVAREKPNPASKQIELDLLRTLPNN--KHYASPSAAGIQKLRNVLVAFSWRNPDIGYCQGLNRLAAITLLYL--DQEDAFWALVAIVEVFMPRDYYTKTLLGSQVDQRVFKDLMSEKLPRLHAH--------------------FEQQMVDFSLITFNWFLVVFVDSVVSDILFKIWDAFLFEGPKIIFRFALALFKYKEEEFLKLHDSTATFKYLRYFTRTILDS-----RKLMNIAFAGMNPFPMKQIHNRR 928          
BLAST of TBC1 domain family member 2B vs. Ensembl Medaka
Match: tbc1d9 (TBC1 domain family member 9B [Source:NCBI gene;Acc:101165539])

HSP 1 Score: 101.293 bits (251), Expect = 3.351e-21
Identity = 77/276 (27.90%), Postives = 133/276 (48.19%), Query Frame = 2
Query:  659 GLPSEIRKKVWL--SLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCD--TFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMP 1474
            G+P  +R ++WL  S A N I      +  +++ A  + S   +     +I +DLHR+  +   F  E+  A L+RVL AYA  N  +GYCQ  N++ +++L  +   EE++  ++V L + +LP+ Y  + + AL +D  VF E     +P+L  H+                    E  + +  ++ WFLTLF + +P D  + + D+   EG ++IF+  LA+ +   + LL  +D       M  L   L        D+++NR    AP+P
Sbjct:  500 GIPERLRGELWLLFSGAQNEIVSHPGYYGDLVEAAMGQCSLATE-----EIERDLHRSMPEHRAFQNETGIAALRRVLTAYAHRNPGIGYCQAMNIVTSVLL--LYCTEEEAFWLLVALCERMLPDYYNTRVVGAL-VDQGVFEELTRDFLPQLYEHMQ-------------------ELGVISTISLSWFLTLFLSAMPFDSAVLLIDNFFYEGIKVIFQVALAVLQDNMNALLCCSDEGE---AMTILGRYL--------DNVVNRQTVSAPIP 737          
BLAST of TBC1 domain family member 2B vs. Planmine SMEST
Match: SMESG000078416.1 (SMESG000078416.1)

HSP 1 Score: 1802.72 bits (4668), Expect = 0.000e+0
Identity = 938/941 (99.68%), Postives = 939/941 (99.79%), Query Frame = 2
Query:   86 MIDSEPCIVVDGIPDSHSESLFEKHECKNSGESVIDNLLFEIYDKWAYKCRHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYXXXXXXXXXTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTASHIIVSSTYPSLQNSMVNHLFLTRSSTHNVTQRPFLMRQNRXXXXXXXXXXXXXKPLGVDIIRTNRNVFNFEHMNSFNSYTIPESSVSSIRPAXXXXXXXXXXXXXXXXDVGTSCEDASTPRARSVSLSDLSNKQMTLLELSKIAQISYAPKVDVDKSDISPKVIDQIKSPDLNLVLERHHQRIQNGPPYLKCLKAKEDSLKILPLDDLNSLTEYGHTARWVAEHHMNSPYSIGISTEVTGIIRASSVICTSNKSSQNALFGTKLGLYKTMAQSRLYRSRINGILHSAYINELQRNTKLGMVNCE 2908
            MIDSEPCI VDGIPDSHSESLFEKHECKNSGESVIDNLLFEIYDKWAYKCRHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHLNNLQLQSQQQNASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMR LTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNDTAEDDADEDEDYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYKKIKDKQKKTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTASHIIVSSTYPSLQNSMVNHLFLTRSSTHNVTQRPFLMRQNRLDSSASDSNSLSNKPLGVDIIRTNRNVFNFEHMNSFNSYTIPESSVSSIRPASDSSSVNRLRRSLSKSDVGTSCEDASTPRARSVSLSDLSNKQMTLLELSKIAQISYAPKVDVDKSDISPKV+DQIKSPDLNLVLERHHQRIQNGPPYLKCLKAKEDSLKILPLDDLNSLTEYGHTARWVAEHHMNSPYSIGISTEVTGIIRASSVICTSNKSSQNALFGTKLGLYKTMAQSRLYRSRINGILHSAYINELQRNTKLGMVNCE
Sbjct:    1 MIDSEPCIAVDGIPDSHSESLFEKHECKNSGESVIDNLLFEIYDKWAYKCRHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLNQKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAILQASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHLNNLQLQSQQQNASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRDLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNDTAEDDADEDEDYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYKKIKDKQKKTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTASHIIVSSTYPSLQNSMVNHLFLTRSSTHNVTQRPFLMRQNRLDSSASDSNSLSNKPLGVDIIRTNRNVFNFEHMNSFNSYTIPESSVSSIRPASDSSSVNRLRRSLSKSDVGTSCEDASTPRARSVSLSDLSNKQMTLLELSKIAQISYAPKVDVDKSDISPKVVDQIKSPDLNLVLERHHQRIQNGPPYLKCLKAKEDSLKILPLDDLNSLTEYGHTARWVAEHHMNSPYSIGISTEVTGIIRASSVICTSNKSSQNALFGTKLGLYKTMAQSRLYRSRINGILHSAYINELQRNTKLGMVNCE 941          
BLAST of TBC1 domain family member 2B vs. Planmine SMEST
Match: SMESG000078416.1 (SMESG000078416.1)

HSP 1 Score: 1477.61 bits (3824), Expect = 0.000e+0
Identity = 781/783 (99.74%), Postives = 782/783 (99.87%), Query Frame = 2
Query:  560 EDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYXXXXXXXXXTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTASHIIVSSTYPSLQNSMVNHLFLTRSSTHNVTQRPFLMRQNRXXXXXXXXXXXXXKPLGVDIIRTNRNVFNFEHMNSFNSYTIPESSVSSIRPAXXXXXXXXXXXXXXXXDVGTSCEDASTPRARSVSLSDLSNKQMTLLELSKIAQISYAPKVDVDKSDISPKVIDQIKSPDLNLVLERHHQRIQNGPPYLKCLKAKEDSLKILPLDDLNSLTEYGHTARWVAEHHMNSPYSIGISTEVTGIIRASSVICTSNKSSQNALFGTKLGLYKTMAQSRLYRSRINGILHSAYINELQRNTKLGMVNCE 2908
            EDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHLNNLQLQSQQQNASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMR LTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNDTAEDDADEDEDYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYKKIKDKQKKTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTASHIIVSSTYPSLQNSMVNHLFLTRSSTHNVTQRPFLMRQNRLDSSASDSNSLSNKPLGVDIIRTNRNVFNFEHMNSFNSYTIPESSVSSIRPASDSSSVNRLRRSLSKSDVGTSCEDASTPRARSVSLSDLSNKQMTLLELSKIAQISYAPKVDVDKSDISPKV+DQIKSPDLNLVLERHHQRIQNGPPYLKCLKAKEDSLKILPLDDLNSLTEYGHTARWVAEHHMNSPYSIGISTEVTGIIRASSVICTSNKSSQNALFGTKLGLYKTMAQSRLYRSRINGILHSAYINELQRNTKLGMVNCE
Sbjct:   51 EDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHLNNLQLQSQQQNASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRDLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNDTAEDDADEDEDYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYKKIKDKQKKTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTASHIIVSSTYPSLQNSMVNHLFLTRSSTHNVTQRPFLMRQNRLDSSASDSNSLSNKPLGVDIIRTNRNVFNFEHMNSFNSYTIPESSVSSIRPASDSSSVNRLRRSLSKSDVGTSCEDASTPRARSVSLSDLSNKQMTLLELSKIAQISYAPKVDVDKSDISPKVVDQIKSPDLNLVLERHHQRIQNGPPYLKCLKAKEDSLKILPLDDLNSLTEYGHTARWVAEHHMNSPYSIGISTEVTGIIRASSVICTSNKSSQNALFGTKLGLYKTMAQSRLYRSRINGILHSAYINELQRNTKLGMVNCE 833          
BLAST of TBC1 domain family member 2B vs. Planmine SMEST
Match: SMESG000078416.1 (SMESG000078416.1)

HSP 1 Score: 1476.84 bits (3822), Expect = 0.000e+0
Identity = 781/783 (99.74%), Postives = 782/783 (99.87%), Query Frame = 2
Query:  560 EDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNXXXXXXXXXXXXYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYXXXXXXXXXTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTASHIIVSSTYPSLQNSMVNHLFLTRSSTHNVTQRPFLMRQNRXXXXXXXXXXXXXKPLGVDIIRTNRNVFNFEHMNSFNSYTIPESSVSSIRPAXXXXXXXXXXXXXXXXDVGTSCEDASTPRARSVSLSDLSNKQMTLLELSKIAQISYAPKVDVDKSDISPKVIDQIKSPDLNLVLERHHQRIQNGPPYLKCLKAKEDSLKILPLDDLNSLTEYGHTARWVAEHHMNSPYSIGISTEVTGIIRASSVICTSNKSSQNALFGTKLGLYKTMAQSRLYRSRINGILHSAYINELQRNTKLGMVNCE 2908
            EDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHLNNLQLQSQQQNASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMR LTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNDTAEDDADEDEDYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYKKIKDKQKKTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTASHIIVSSTYPSLQNSMVNHLFLTRSSTHNVTQRPFLMRQNRLDSSASDSNSLSNKPLGVDIIRTNRNVFNFEHMNSFNSYTIPESSVSSIRPASDSSSVNRLRRSLSKSDVGTSCEDASTPRARSVSLSDLSNKQMTLLELSKIAQISYAPKVDVDKSDISPKV+DQIKSPDLNLVLERHHQRIQNGPPYLKCLKAKEDSLKILPLDDLNSLTEYGHTARWVAEHHMNSPYSIGISTEVTGIIRASSVICTSNKSSQNALFGTKLGLYKTMAQSRLYRSRINGILHSAYINELQRNTKLGMVNCE
Sbjct:   47 EDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHLNNLQLQSQQQNASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRDLTNQLSDGLIAQPDHLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNDTAEDDADEDEDYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLSSVDISQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYKKIKDKQKKTSLLMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTASHIIVSSTYPSLQNSMVNHLFLTRSSTHNVTQRPFLMRQNRLDSSASDSNSLSNKPLGVDIIRTNRNVFNFEHMNSFNSYTIPESSVSSIRPASDSSSVNRLRRSLSKSDVGTSCEDASTPRARSVSLSDLSNKQMTLLELSKIAQISYAPKVDVDKSDISPKVVDQIKSPDLNLVLERHHQRIQNGPPYLKCLKAKEDSLKILPLDDLNSLTEYGHTARWVAEHHMNSPYSIGISTEVTGIIRASSVICTSNKSSQNALFGTKLGLYKTMAQSRLYRSRINGILHSAYINELQRNTKLGMVNCE 829          
BLAST of TBC1 domain family member 2B vs. Planmine SMEST
Match: SMESG000042564.1 (SMESG000042564.1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.718e-18
Identity = 70/238 (29.41%), Postives = 107/238 (44.96%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNR--VIKFAFNERSNPDDDSLGLQIVKDLHRTG------CDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQL 1348
            G+P E R +VW  L+      + YD N+    K+     S P++      I+ D+ RT        D    ES    L+R+L A+   N  +GYCQG N +A +IL VM  +EE +  I   L+  IL ESY+   +  + +D  V  E L   +P++          + +   SC+           +   +WF+  F   LP    L + D +M EG +I+FR  LAI  L  D +
Sbjct:   63 GIPDEYRPEVWFILSGAK---KMYDENKGSYDKWHSQSISEPNEAV----ILADVPRTFPENTKFLDRNHPESLLPHLQRILTAFVFKNPTIGYCQGMNFIAGLILMVMMPDEEKAFWIFDTLITEIL-ESYYIPGMLRIQVDCMVLEELLRNKLPQV------HHSITAKCEGSCV-----------ILGAKWFICAFVDVLPIQTCLRVLDCVMFEGDKILFRAALAIIRLNQDAI 275          
BLAST of TBC1 domain family member 2B vs. Planmine SMEST
Match: SMESG000012909.1 (SMESG000012909.1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.501e-18
Identity = 67/263 (25.48%), Postives = 121/263 (46.01%), Query Frame = 2
Query:  659 GLPSEIRKKVWLSLANNHITVQKYDWNRVIKFAFNERSNP---DDDSLGLQIVKDLHRT----GCDTFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSLKIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPK----LAAHXXXXXXXXXXXXASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIMLEGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSD 1414
            G+P  +R ++W+ ++   I        +  K ++ E  N    D      QI KDL RT     C +  + +    L+R+L   A     +GYCQG  V+ + +L  +E  EED+  +M  +++ +LP SY++ NL  +  D    RE +  ++PK    LA H                          ++ T+ WFLT+F + L    +L +WD    EGS ++FR  L + +L   ++L+ ++    +  +  L ++++D
Sbjct:  131 GIPHSLRPQLWMRMSGALIK------RKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTGIPRLRRILRGLAWLYPDIGYCQGMGVIVSHLLLFLE--EEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLPKIHELLAEHDIE----------------------ISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKLPSEITD 363          
The following BLAST results are available for this feature:
BLAST of TBC1 domain family member 2B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TBC1D309.654e-13747.70TBC1 domain family member 30 [Source:HGNC Symbol;A... [more]
TBC1D302.146e-11150.40TBC1 domain family member 30 [Source:HGNC Symbol;A... [more]
TBC1D305.279e-4447.06TBC1 domain family member 30 [Source:HGNC Symbol;A... [more]
TBC1D302.362e-4172.53TBC1 domain family member 30 [Source:HGNC Symbol;A... [more]
TBC1D28.204e-2830.90TBC1 domain family member 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc-25.805e-2229.46TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-25.805e-2229.46TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-199.083e-1926.53TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-181.252e-1728.10TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-64.525e-1729.02Growth hormone-regulated TBC protein 6 [Source:Un... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG427951.555e-8546.60gene:FBgn0261928 transcript:FBtr0345170[more]
CG427951.828e-8546.60gene:FBgn0261928 transcript:FBtr0332437[more]
CG427952.435e-8546.60gene:FBgn0261928 transcript:FBtr0303601[more]
CG427952.503e-8546.60gene:FBgn0261928 transcript:FBtr0345169[more]
CG427952.726e-8546.60gene:FBgn0261928 transcript:FBtr0303602[more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d304.782e-15744.10TBC1 domain family, member 30 [Source:ZFIN;Acc:ZDB... [more]
tbc1d29.176e-3030.57TBC1 domain family, member 2 [Source:ZFIN;Acc:ZDB-... [more]
sgsm32.368e-2428.79small G protein signaling modulator 3 [Source:NCBI... [more]
grtp1b1.899e-2228.74growth hormone regulated TBC protein 1b [Source:ZF... [more]
tbc1d2b4.126e-2227.59TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bard19.148e-16342.29BRCA1 associated RING domain 1 [Source:Xenbase;Acc... [more]
bard17.338e-16145.06BRCA1 associated RING domain 1 [Source:Xenbase;Acc... [more]
bard12.196e-13846.32BRCA1 associated RING domain 1 [Source:Xenbase;Acc... [more]
cfap526.812e-2628.81cilia and flagella associated protein 52 [Source:X... [more]
cfap529.277e-2628.81cilia and flagella associated protein 52 [Source:X... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tbc1d304.739e-13748.68TBC1 domain family, member 30 [Source:MGI Symbol;A... [more]
Tbc1d301.680e-5449.25TBC1 domain family, member 30 [Source:MGI Symbol;A... [more]
Tbc1d22.691e-2830.21TBC1 domain family, member 2 [Source:MGI Symbol;Ac... [more]
Tbc1d2b1.639e-2227.89TBC1 domain family, member 2B [Source:MGI Symbol;A... [more]
Sgsm38.471e-2227.80small G protein signaling modulator 3 [Source:MGI ... [more]
back to top
BLAST of TBC1 domain family member 2B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28C33|TBC30_XENTR3.464e-16045.06TBC1 domain family member 30 OS=Xenopus tropicalis... [more]
sp|Q9Y2I9|TBC30_HUMAN2.739e-15548.06TBC1 domain family member 30 OS=Homo sapiens OX=96... [more]
sp|Q69ZT9|TBC30_MOUSE3.315e-13648.68TBC1 domain family member 30 OS=Mus musculus OX=10... [more]
sp|B5DFA1|TBD2A_RAT1.081e-2831.58TBC1 domain family member 2A OS=Rattus norvegicus ... [more]
sp|B1AVH7|TBD2A_MOUSE1.882e-2730.21TBC1 domain family member 2A OS=Mus musculus OX=10... [more]
back to top
BLAST of TBC1 domain family member 2B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HFQ29.631e-17448.89TBC1 domain family member 30-like isoform X2 OS=Li... [more]
A0A1S3HFS54.470e-17348.72TBC1 domain family member 30-like isoform X1 OS=Li... [more]
C3YVF57.339e-17347.28Rab-GAP TBC domain-containing protein OS=Branchios... [more]
A0A0L8ICM31.408e-16447.50Rab-GAP TBC domain-containing protein OS=Octopus b... [more]
A0A0L8ICT61.585e-16246.72Rab-GAP TBC domain-containing protein OS=Octopus b... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d309.204e-13446.05TBC1 domain family member 30 [Source:NCBI gene;Acc... [more]
tbc1d305.927e-13349.54TBC1 domain family member 30 [Source:NCBI gene;Acc... [more]
tbc1d24.167e-2832.58TBC1 domain family, member 2 [Source:ZFIN;Acc:ZDB-... [more]
tbc1d22.904e-2629.73TBC1 domain family, member 2 [Source:ZFIN;Acc:ZDB-... [more]
sgsm32.466e-2328.02small G protein signaling modulator 3 [Source:NCBI... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d2b1.041e-3131.64TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB... [more]
ENSPMAT00000006389.11.170e-2027.20pep scaffold:Pmarinus_7.0:GL481951:143257:161898:-... [more]
TBC1D96.988e-1827.85TBC1 domain family member 9 [Source:HGNC Symbol;Ac... [more]
tbc1d10b1.193e-1425.18TBC1 domain family, member 10b [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000010479.11.572e-1330.19pep scaffold:Pmarinus_7.0:GL480469:1915:23479:-1 g... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
MDR18.190e-1726.14Cytoplasmic GTPase-activating protein; activates Y... [more]
MSB42.493e-1627.60GTPase-activating protein of the Ras superfamily; ... [more]
MSB31.431e-1326.24Rab GTPase-activating protein; regulates endocytos... [more]
GYP52.302e-1125.56GTPase-activating protein (GAP) for yeast Rab fami... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348981.232e-10448.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340473.140e-2327.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341967.575e-2227.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498281.461e-1928.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350211.517e-1623.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d307.542e-12655.49TBC1 domain family member 30 [Source:NCBI gene;Acc... [more]
ENSORLT00000025434.21.338e-3132.56TBC1 domain family member 2A-like [Source:NCBI gen... [more]
tbc1d2b1.740e-2227.49TBC1 domain family member 2B [Source:NCBI gene;Acc... [more]
tbc1d2b2.129e-2227.49TBC1 domain family member 2B [Source:NCBI gene;Acc... [more]
tbc1d93.351e-2127.90TBC1 domain family member 9B [Source:NCBI gene;Acc... [more]
back to top
BLAST of TBC1 domain family member 2B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078416.10.000e+099.68SMESG000078416.1[more]
SMESG000078416.10.000e+099.74SMESG000078416.1[more]
SMESG000078416.10.000e+099.74SMESG000078416.1[more]
SMESG000042564.11.718e-1829.41SMESG000042564.1[more]
SMESG000012909.13.501e-1825.48SMESG000012909.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007341 ID=SMED30007341|Name=TBC1 domain family member 2B|organism=Schmidtea mediterranea sexual|type=transcript|length=3059bp
CTCTGAATGGCGCTTAGTATATCACGCGAGTTATAATTAAGATTATATAT
TATTTTATGTTGTAATAAAAAAAAAAAAAAAAATTATGATTGATTCAGAA
CCATGTATTGTTGTCGATGGCATACCCGATTCTCACTCGGAGTCTTTGTT
CGAAAAGCATGAATGTAAAAATTCTGGAGAAAGTGTAATAGACAATCTTT
TATTTGAAATCTATGACAAATGGGCTTACAAATGTCGTCACGATAGTAGT
TGGGATAGTGATACGATTACTTCTGCATCTGACGCAGTGAGTGGGTTTGC
ATGGAGGAGATCAATAGGAGTATCTGTAAATGGATCAGAAAATGAACTTA
AACACTATACAACAATATCAGAATCAACTTTAAATCAAAAATCGATTGAA
GAACTTGAAAAAGTAAAAATGAATATGAAGCAATCAGTGGCGATATTTTC
TTCCAGACTTGTGAGACAGTTAAAGCGTAGAGACCACGCATTAGCGAAAA
TGCAGAAAAATTGCGATATATTAACGGCAATCCTACAAGCTTCGTCCTTA
AAAAGAAGAGAAGACACTAAATTAAAGTTTGTTATGGAACCTAAACCAGG
AAATGAAGCTTTTCGACAGTGGTGTGAAGCTATGAAAGGTGTTGCACGAT
TACCACTTGGTTTGCCATCGGAAATTCGTAAAAAAGTGTGGTTGTCACTT
GCAAACAATCATATAACAGTTCAGAAATATGATTGGAATCGAGTCATTAA
ATTTGCCTTCAATGAAAGATCAAATCCAGATGATGATTCACTTGGTTTAC
AAATTGTCAAGGATCTTCATAGAACAGGATGTGATACATTTGCTACTGAA
TCTGAAAGAGCAATTTTGAAACGAGTTCTTCTTGCATACGCAAGGTGGAA
TAAGCGCGTCGGTTATTGCCAGGGATTCAATGTTCTCGCAGCAATTATTT
TAGAAGTTATGGAACGAAACGAAGAAGATTCTTTAAAAATTATGGTGTAC
CTCGTTGATCACATTTTACCCGAGAGTTATTTTGCTCAAAATCTTCAAGC
TCTTTCAATAGATATGGCGGTTTTTCGTGAATTTCTCAATATTCATGTTC
CAAAGTTGGCGGCACATTTAAATAATTTACAACTTCAATCTCAACAACAA
AATGCTTCGTGTATAAATAACAATCACTATGAACCTCCTTTAACTAATGT
TTTCACAATGCAATGGTTTCTCACGCTTTTTGCTACTTGTCTTCCACCTG
ATCTTGTTTTACATATTTGGGATTCAATAATGCTCGAAGGATCTGAAATT
ATTTTTCGAACTGGACTAGCTATTTGGGAATTATTATCTGATCAACTGCT
CAAAGTTAATGACGCTGATTCATTTTATTGTACAATGAGATGTCTAACAA
ATCAGTTATCAGATGGTTTAATTGCTCAACCAGATCATCTTATCAATAGA
ATCTACAATATGGCTCCTATGCCCTTTCCAGGACTGTCTAATCTCAGAGA
TAGATTCACATATAACATTAATCCATTCTCATCAATACCTAGTGCTATCG
TTTCTTATGGAAGTCCAGGCAATGATACAGCTGAAGACGATGCTGATGAA
GATGAAGACTATAAATCCAAGCATGTAAATAAAGCTTCTATTGGATGTTT
CGGAGGAATGATGCCATCGAATCACTTGTCAAATTACAAGGCGAAAGAGA
ATCAAATGCCGTTATCACTGTCATCCGTGGATATTAGTCAAGTTGGTCCA
GGAGCTGTGTCGACAAGTCCTTCAATTCATCACAATGCAAGTCCTGGAGC
AACTCAGGAAAGAATGTGCACAGATTTAATTACCCTTGAAAGTCAATATA
AAAAAATTAAGGACAAGCAAAAAAAGACAAGTCTCTTGATGAACAACATT
GGTCATGAAAAAATTTCATCAAAATCACAAGTTCTAGCTCCAAGTAGGCA
CGGGAAACGTAAAAGTTCTGTTGGAAGACCTAATCCAACGGCGTCACACA
TTATTGTCAGTTCTACTTATCCCTCTCTTCAAAATTCAATGGTCAACCAT
TTATTTTTAACCCGCTCCTCTACACACAACGTCACTCAACGGCCTTTTTT
AATGAGGCAAAATCGTCTTGATAGTTCTGCTAGTGATTCTAATTCTCTCT
CTAATAAACCTCTCGGTGTTGACATTATCAGAACGAATCGAAATGTTTTT
AATTTCGAGCACATGAATAGTTTCAATTCATATACAATTCCTGAGTCTTC
TGTTTCTAGTATTAGGCCGGCATCTGACTCATCGTCAGTTAATAGACTTA
GACGATCTCTCAGCAAATCTGATGTTGGAACATCTTGTGAAGATGCTAGT
ACACCTAGAGCTAGATCTGTATCTCTTTCTGACCTGTCGAACAAGCAAAT
GACATTATTGGAATTATCAAAAATCGCTCAAATAAGTTATGCACCAAAGG
TTGATGTGGATAAATCTGACATAAGTCCTAAAGTTATTGATCAAATAAAA
TCTCCAGATCTAAATTTGGTCTTAGAAAGACACCATCAGCGTATTCAAAA
TGGACCGCCATATCTTAAATGTTTGAAAGCTAAGGAAGATTCATTGAAAA
TATTACCATTAGATGATCTCAACTCACTAACAGAATATGGACACACAGCG
AGATGGGTAGCGGAGCATCATATGAATTCTCCCTATTCAATTGGTATTAG
CACGGAAGTCACTGGAATTATTCGCGCTTCATCTGTGATTTGCACATCAA
ATAAATCCTCCCAAAATGCACTTTTCGGTACAAAACTTGGTTTGTATAAA
ACAATGGCTCAGAGTCGTCTGTATCGTAGCAGAATTAATGGAATATTACA
TTCTGCATATATAAATGAACTCCAAAGAAACACAAAATTAGGAATGGTAA
ATTGCGAATAGATTTCTCAATTTAAAAAAAACTTGCTTGGTGCAGTTTTA
TTCTCAATAATTTTCATTTTAAAAGATATTGTTGGTGTTGACTATTGTGT
ATTTTATTTTTGTATTTGGTTGTTTTGTCCCTTTCAGTACTGCAAAATTG
TAATTCGCA
back to top

protein sequence of SMED30007341-orf-1

>SMED30007341-orf-1 ID=SMED30007341-orf-1|Name=SMED30007341-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=942bp
MIDSEPCIVVDGIPDSHSESLFEKHECKNSGESVIDNLLFEIYDKWAYKC
RHDSSWDSDTITSASDAVSGFAWRRSIGVSVNGSENELKHYTTISESTLN
QKSIEELEKVKMNMKQSVAIFSSRLVRQLKRRDHALAKMQKNCDILTAIL
QASSLKRREDTKLKFVMEPKPGNEAFRQWCEAMKGVARLPLGLPSEIRKK
VWLSLANNHITVQKYDWNRVIKFAFNERSNPDDDSLGLQIVKDLHRTGCD
TFATESERAILKRVLLAYARWNKRVGYCQGFNVLAAIILEVMERNEEDSL
KIMVYLVDHILPESYFAQNLQALSIDMAVFREFLNIHVPKLAAHLNNLQL
QSQQQNASCINNNHYEPPLTNVFTMQWFLTLFATCLPPDLVLHIWDSIML
EGSEIIFRTGLAIWELLSDQLLKVNDADSFYCTMRCLTNQLSDGLIAQPD
HLINRIYNMAPMPFPGLSNLRDRFTYNINPFSSIPSAIVSYGSPGNDTAE
DDADEDEDYKSKHVNKASIGCFGGMMPSNHLSNYKAKENQMPLSLSSVDI
SQVGPGAVSTSPSIHHNASPGATQERMCTDLITLESQYKKIKDKQKKTSL
LMNNIGHEKISSKSQVLAPSRHGKRKSSVGRPNPTASHIIVSSTYPSLQN
SMVNHLFLTRSSTHNVTQRPFLMRQNRLDSSASDSNSLSNKPLGVDIIRT
NRNVFNFEHMNSFNSYTIPESSVSSIRPASDSSSVNRLRRSLSKSDVGTS
CEDASTPRARSVSLSDLSNKQMTLLELSKIAQISYAPKVDVDKSDISPKV
IDQIKSPDLNLVLERHHQRIQNGPPYLKCLKAKEDSLKILPLDDLNSLTE
YGHTARWVAEHHMNSPYSIGISTEVTGIIRASSVICTSNKSSQNALFGTK
LGLYKTMAQSRLYRSRINGILHSAYINELQRNTKLGMVNCE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035969Rab-GTPase_TBC_sf
IPR000195Rab-GTPase-TBC_dom
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
GO:0017137Rab GTPase binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0012505endomembrane system
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0031338regulation of vesicle fusion
GO:0090630activation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000195Rab-GTPase-TBC domainSMARTSM00164tbc_4coord: 189..425
e-value: 6.8E-39
score: 145.2
IPR000195Rab-GTPase-TBC domainPFAMPF00566RabGAP-TBCcoord: 196..422
e-value: 2.6E-36
score: 125.3
IPR000195Rab-GTPase-TBC domainPROSITEPS50086TBC_RABGAPcoord: 192..402
score: 32.742
NoneNo IPR availableGENE3DG3DSA:1.10.8.270coord: 218..314
e-value: 2.7E-19
score: 70.9
NoneNo IPR availableGENE3DG3DSA:1.10.472.80coord: 315..464
e-value: 3.4E-28
score: 100.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 724..756
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 611..633
NoneNo IPR availablePANTHERPTHR22957TBC1 DOMAIN FAMILY MEMBER GTPASE-ACTIVATING PROTEINcoord: 27..695
NoneNo IPR availablePANTHERPTHR22957:SF291TBC1 DOMAIN FAMILY MEMBER 30coord: 27..695
IPR035969Rab-GTPase-TBC domain superfamilySUPERFAMILYSSF47923Ypt/Rab-GAP domain of gyp1pcoord: 191..344
IPR035969Rab-GTPase-TBC domain superfamilySUPERFAMILYSSF47923Ypt/Rab-GAP domain of gyp1pcoord: 320..440