slc6a-17

Overview
Nameslc6a-17 (AKN21437.1)
Smed IDSMED30007332
Length (bp)2294
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007332

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30007332SMESG000054997.1 Contig49952newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30007332SMESG000054997.1 Contig49952uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
proximal tubuleSMED30007332SMESG000054997.1 Smed-slc6a-17smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc6a-17 vs. Ensembl Human
Match: SLC6A7 (solute carrier family 6 member 7 [Source:HGNC Symbol;Acc:HGNC:11054])

HSP 1 Score: 316.235 bits (809), Expect = 3.392e-97
Identity = 203/539 (37.66%), Postives = 311/539 (57.70%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCIS-----SGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDE----SPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYK 1767
            RG WT + +F+LSCIG+ VGLGNVWRFP R Y +GGGAFL  Y ++  I G PL F+EL +GQFSS  P   +K+ P+F G G +M+ I  +V +YY ++I++   YLF S    +PW  C   +N++ C+       G     +NLT   ++ +EEYW  YV           H        SPG  +W++ L L+L W++  L ++ GVK S KV+YFT  FPY+++  L+V G +LPGA  GI FYL P +  ++  KV +    Q+ +S  +  GG+LT+ASYN F +NIY+DTFI+   + ITS L+G ++F++LGYM+++ GVP+++V  +G GL ++ Y  A+  LP   FW+F+F  M + LGLDSQFA LE I   + D +P+  + K  KA+    I    +L G++L + GG YW V+LD   +++GL VV     + V  +YG ++   D  +M+     + +     F+ P  +  +++ +I  Y+         P W E++  L   L  L I  GM+  V++ +
Sbjct:   37 RGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCT-VSPSEEYWSRYV----------LHIQGSQGIGSPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALMVYSIVKYQPSEYGSYRFPPWAELLGILMGLLSCLMIPAGMLVAVLREE 562          
BLAST of slc6a-17 vs. Ensembl Human
Match: SLC6A7 (solute carrier family 6 member 7 [Source:HGNC Symbol;Acc:HGNC:11054])

HSP 1 Score: 317.005 bits (811), Expect = 4.415e-97
Identity = 214/599 (35.73%), Postives = 329/599 (54.92%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCIS-----SGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDE----SPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPN---YWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSE 1938
            RG WT + +F+LSCIG+ VGLGNVWRFP R Y +GGGAFL  Y ++  I G PL F+EL +GQFSS  P   +K+ P+F G G +M+ I  +V +YY ++I++   YLF S    +PW  C   +N++ C+       G     +NLT   ++ +EEYW  YV           H        SPG  +W++ L L+L W++  L ++ GVK S KV+YFT  FPY+++  L+V G +LPGA  GI FYL P +  ++  KV +    Q+ +S  +  GG+LT+ASYN F +NIY+DTFI+   + ITS L+G ++F++LGYM+++ GVP+++V  +G GL ++ Y  A+  LP   FW+F+F  M + LGLDSQFA LE I   + D +P+  + K  KA+    I    +L G++L + GG YW V+LD   +++GL VV     + V  +YG ++   D  +M+     + +     F+ P  +  +++ +I  Y+         P W E++  L   L  L I  GM+  V++ +           +++L  A      WGP  L     G Y      +    P+ +  R G+ 
Sbjct:   37 RGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCT-VSPSEEYWSRYV----------LHIQGSQGIGSPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALMVYSIVKYQPSEYGSYRFPPWAELLGILMGLLSCLMIPAGMLVAVLREE--------GSLWERLQQASRPAMDWGP-SLEENRTGMYVATLAGSQSPKPLMVHMRKGTS 613          
BLAST of slc6a-17 vs. Ensembl Human
Match: SLC6A5 (solute carrier family 6 member 5 [Source:HGNC Symbol;Acc:HGNC:11051])

HSP 1 Score: 307.375 bits (786), Expect = 3.056e-92
Identity = 181/545 (33.21%), Postives = 293/545 (53.76%), Query Frame = 1
Query:   61 VNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCN---------------------------QVFNSKNCISSGLSVRRMNLTS----AYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICP 1602
            VN     + L+  G + + P            +G+    RG W+S+ +FILS +G+AVGLGNVWRFP   +++GGGAFL  Y+++  + G P+ F+E+ +GQF+S+ P + +K +P   G G +M+ IS ++ +YY V+I +   YLF SF  ++PW  CN                           Q+ NS  C+++  +V  +N TS     +++ +EEY+ Y+V               E PG  +W + L L L W++   SL  G+K S KV+YFT  FPYVV+  L++ G +LPGA  GI++++ P W+K+ D  V      Q+ FS + A GG++T +SYN F  N Y+DT I+   +  TS  +G  +F+++G+MA +  V I  V   G G+ ++ Y +A+  LP   FW  +F LM + LGLD+ FA +E I   I D +P   +T   K +         F+ G  + + GG Y F ++D+  ++Y L ++A  E++ +  +YG ++   D  +M+    +I W +  AF+ P
Sbjct:  152 VNMSQSTVVLATDGITSVLPGSVATVATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVL--------KISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT--HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTP 686          
BLAST of slc6a-17 vs. Ensembl Human
Match: SLC6A2 (solute carrier family 6 member 2 [Source:HGNC Symbol;Acc:HGNC:11048])

HSP 1 Score: 293.893 bits (751), Expect = 7.239e-89
Identity = 180/509 (35.36%), Postives = 271/509 (53.24%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESP-----GYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGE 1689
            R  W  + +F+LS +GFAV L NVWRFP  CY++GGGAFL  Y +  +I G PL ++EL +GQ++     T +K+ P F G+G+++I I+  V  YY V+I+W+  YLF SF   +PWT C   +NS NC    L      L  + + +  +Y  Y  T   ++ ER    + ES      G PQW + L LM+  I+   SL  GVK S KV++ T   PY V+  L+V G +LPGAS GI  YL  D+ ++ +  V +    Q+ FS     G ++ +ASYN F  N Y+D  +   I+ ITSF+SG ++F+ILGYMA +  V I  V T G GL +I Y +AI+TL G  FW  +F +M +ALGLDS    +E +  G+ D +  +++    + L  + +    FL  +   + GG Y   +LD+  +   +     +E I V   YG  +   D   MM     + W +   F+ P  +  +++ +I  +K L+      P W  
Sbjct:   56 RETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKL------LNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSSINCITSFVSGFAIFSILGYMAHEHKVNIEDVATEGAGLVFILYPEAISTLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKR---HRKLFTFGVTFSTFLLALFCITKGGIYVLTLLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFRPGLYWRLCWKFVSPAFLLFVVVVSIINFKPLTYDDYIFPPWAN 555          
BLAST of slc6a-17 vs. Ensembl Human
Match: SLC6A2 (solute carrier family 6 member 2 [Source:HGNC Symbol;Acc:HGNC:11048])

HSP 1 Score: 293.508 bits (750), Expect = 8.291e-89
Identity = 180/509 (35.36%), Postives = 271/509 (53.24%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESP-----GYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGE 1689
            R  W  + +F+LS +GFAV L NVWRFP  CY++GGGAFL  Y +  +I G PL ++EL +GQ++     T +K+ P F G+G+++I I+  V  YY V+I+W+  YLF SF   +PWT C   +NS NC    L      L  + + +  +Y  Y  T   ++ ER    + ES      G PQW + L LM+  I+   SL  GVK S KV++ T   PY V+  L+V G +LPGAS GI  YL  D+ ++ +  V +    Q+ FS     G ++ +ASYN F  N Y+D  +   I+ ITSF+SG ++F+ILGYMA +  V I  V T G GL +I Y +AI+TL G  FW  +F +M +ALGLDS    +E +  G+ D +  +++    + L  + +    FL  +   + GG Y   +LD+  +   +     +E I V   YG  +   D   MM     + W +   F+ P  +  +++ +I  +K L+      P W  
Sbjct:   56 RETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKL------LNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSSINCITSFVSGFAIFSILGYMAHEHKVNIEDVATEGAGLVFILYPEAISTLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKR---HRKLFTFGVTFSTFLLALFCITKGGIYVLTLLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFRPGLYWRLCWKFVSPAFLLFVVVVSIINFKPLTYDDYIFPPWAN 555          
BLAST of slc6a-17 vs. Ensembl Celegans
Match: dat-1 (Sodium-dependent dopamine transporter [Source:UniProtKB/Swiss-Prot;Acc:Q03614])

HSP 1 Score: 285.034 bits (728), Expect = 5.257e-86
Identity = 176/539 (32.65%), Postives = 291/539 (53.99%), Query Frame = 1
Query:  103 KSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAF-KLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCIS-----SGLSVRR---MNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDE--SPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGG---KYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIP 1677
             + L  +GP  T+    +       R +W+ + +F+LS +GFAV LGN+WRFP  C+++GGG FL  Y I+ ++ G PL ++EL +GQ+  +   T + ++ P+F GIG+ +I  +  V+ +Y V+++W   YL+ SF + +PW  CN  +NS  C        G ++ R    ++++  I++ EEY+     G  +      H +      G  +W + LSL + +++   S+  G+  S KV++FT +FPYVV+  L + G +LPG   GI +YL P+++ +  P V      Q+ FS     G ++ Y+SYN+F  N+Y D     FI+  TSFLSG  +F++LGYM+ KSG PI  V   G GL ++ Y +A++T+P   FW+ +F LM + LGLDS F   E I  G+ D +P ++K    + + +  +   + + GI +C+ GG     W +I     +T+GL +  F E +++  IYG RQ  +D   MM       W    +   P I+  ++ +N   Y+ L+      P
Sbjct:   22 NATLPIDGPVNTEPKDPA-------REQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKNGGGVFLIPYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLFKGIGYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWASCNNSYNSPACYEPHWSEDGTAMCRSANQSVSAEKISAAEEYFYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIALSLFVVYLICYFSMWKGIHTSGKVVWFTALFPYVVLGILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFGVLMAYSSYNDFHNNVYVDALFTSFINCATSFLSGFVIFSVLGYMSCKSGKPIEAVAQEGPGLVFVVYPEALSTMPYAPFWSVLFFLMLMTLGLDSSFGGSEAIITGLSDEFPILKK---NREVFVGCLFAFYMVIGIAMCTEGGILIMEWLIIYG---TTWGLLIAVFCEAMVIAYIYGLRQFVHDVKEMMGFRPGNYWKFCWSCAAPFILLSMITSNFINYQALTYQDYTYP 547          
BLAST of slc6a-17 vs. Ensembl Celegans
Match: snf-11 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43])

HSP 1 Score: 268.085 bits (684), Expect = 9.010e-80
Identity = 178/554 (32.13%), Postives = 283/554 (51.08%), Query Frame = 1
Query:  157 EGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYI-MPWTVCNQVFNSKNCISSGLSV--------------------------------RRMNLTS------AYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILD-SRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVN--IPLWGEI 1692
            E  SV  R +W+S  +FI+SCIG+A+GLGNVWRFP  CY++GGGAFL  Y I  V  GAPL  +E   GQ  S      FK+ PIF G+G +   ++  + +YY VV+SWA  YL+ SF    +PW  C+  +N+ NC S  + +                                 +MN T       + ++  +E+W++ V G          +  E+PG  +W + L L+L WI+  L +  GVK + KV+Y T  FPY+++ CL++ G +L GA  G+ FYL PD+ K+++ KV +  + Q+ FS  + +G ++   SYN F  N+Y+    + F++  TS  +G  +F+ +G+MA +    + +V  +G GL ++ Y   I  LP   FW+ +F LM + LG+DSQF  +E     I D +P +R+ K  + + +  I  + +L G+   + GG Y F + D    S + L  + F E I +    G  + +     M+       W     F  P++ F +L+  +  Y+ L +   N   P+WG I
Sbjct:    3 EATSVAEREQWSSWADFIMSCIGYAIGLGNVWRFPYLCYQNGGGAFLIPYCISLVFCGAPLFILETSWGQLMSVGGLGMFKICPIFKGVGIAAAVMAFWLNIYYIVVLSWAATYLYNSFTMSDVPWKNCDHAWNTPNCRSEYVKIPCDSNRTIAEFFNVKVLTHDHIHEYKKQFFVGEKMNWTVCSAADLSVVSPVKEFWNHRVLGI--------SSGLENPGGIRWDLALFLLLVWIICYLCIFKGVKWTGKVVYITASFPYMMLFCLLIRGLTLEGAGVGLEFYLKPDFSKLLESKVWVDAVTQVFFSYGLGLGALVALGSYNKFNNNVYKQALTVCFVNSGTSVFAGFVIFSFIGFMATQQEKSVAEVAQAGPGLLFLAYPSGILQLPYTQFWSCLFFLMVLFLGVDSQFCTMEGFFTAIIDEFPQIRRKKYGREIFVGVICVISYLIGLTTVTEGGFYVFQLFDFYAASGWALLWLLFFECIAISWSLGIDRWYEHMKSMIGYYPSAWWKFCWVFATPSVCFGVLLFGLIKYQPLRIDAYNYDYPVWGHI 548          
BLAST of slc6a-17 vs. Ensembl Celegans
Match: snf-3 (Sodium- and chloride-dependent betaine transporter [Source:UniProtKB/Swiss-Prot;Acc:G5EBN9])

HSP 1 Score: 249.98 bits (637), Expect = 4.171e-73
Identity = 152/495 (30.71%), Postives = 262/495 (52.93%), Query Frame = 1
Query:  118 PEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFH-TMDESP-GYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDS-RVSTYGLTVVAFLEIIIVGIIYGF------RQLHYDFSVMMALPIDIIW 1575
            P    +  +   S+      RG+WT + +F++S + +AVGLGNVWRFP  CY++GGG+FL +Y+I   +   P+  +E+ +GQ+  +     + + P+F G+G   + I+ +   Y+ V+++WA  Y+  S  ++ PW  CN  +N   C++   +   +    A + S   +    V  F++  +R  H T D S  G  QW +   +   W++   +L  G+  + K +YF  +FPYV++  L++ G +L GA TGIYFYL P+  +++D  V      Q+ +S  +  G ++   S+N F  N ++D   + FI+  TS  +G +VF+ILGYM+  +   I++++  G GL ++ Y +  + LP    +  +F LM   LGLDSQ   +E +   + D +P +RK K +++L I+ +    F  GI + +  G +W  + D+   S Y L  V F E  +VG+ YGF      + LH    V +   I+ +W
Sbjct:   10 PTDEAKAKELEQSQHSEEPDRGQWTGKFDFLMSMVAYAVGLGNVWRFPYLCYKNGGGSFLVVYMIFFCLAAVPIFLMEVTVGQYLQKGAMEMWLMCPLFRGVGIGNVVIAFMCIAYFCVIVAWAMFYMISSIAWVFPWETCNNYWNDATCVTGKENFTELARIKALVASAGGHTQTSVEQFWE--KRVLHDTGDISEFGGIQWELFFIMAAAWLIVYFALWKGITQARKFVYFCALFPYVLIFILLIRGLTLEGAGTGIYFYLKPNATRLLDTAVWKDAGTQVFYSYGVGFGALIALGSHNKFNHNCFKDAITMCFINGCTSITAGFAVFSILGYMSHVAQKDISEIVKPGVGLAFLAYPEVASNLPMKQVFAVLFFLMITILGLDSQVCMMEGLFTALEDAFPILRKYK-KQSLGIFCLF--FFCIGIPMVTHSGSHWLTLFDAYGASGYALLFVVFFE--VVGLAYGFGAHNIRKALHEMIGVTLPKGIEYVW 497          
BLAST of slc6a-17 vs. Ensembl Celegans
Match: mod-5 (Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7])

HSP 1 Score: 220.32 bits (560), Expect = 8.761e-62
Identity = 160/491 (32.59%), Postives = 255/491 (51.93%), Query Frame = 1
Query:  127 PHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAF-KLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYI----MPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEG-LFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMI 1581
            P +    +     S  +R KW ++ EF+L+ +G+AV LGN+WRFP  CY+ GGGAFL  Y I+ +I G P+ ++EL +GQF      + + K+ P+F GIG+ +  I + + ++Y  +I+ A  +   S   I    +PW  C   +N+  C S  L+V      +   T +EEY+ Y V       E    T  +  G  +  + + L+  +I+   +L  G + S K+++ T   PY++++ L++ G  LPGA  G+Y+Y+ PD++K+ DP V      Q+ FS     G +L  +SYN+F  N Y+D      I+  TSF SG  VF+ LGYM+  +  PIN+V+   +  L +I Y  A+AT+    FW+F+F +M I LG+DS FA +E    G  D   F+ K   RK  ++   I  +FL+   + S GG++    LD    +  +  +   E+I V   YG  Q   D   M+     I W +
Sbjct:   83 PTKEGRVAALRRRSSMVRDKWATKMEFLLAVVGYAVDLGNIWRFPSVCYKHGGGAFLIPYFIMLMIGGLPMFYMELVLGQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAIFYNAIIAQAVYFAIVSLSKIWDSEVPWASCGNPWNTPRC-SDDLNVTISRNGTPLTTPSEEYYLYKVL------EVQKSTGFDDLGGVKTSMAVCLLAVFIMVYFALWKGPQSSGKIVWVTATAPYIILSILLIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNNNCYRDAVTTSIINCATSFFSGCVVFSTLGYMSLLTNKPINEVVGEHDASLIFIVYPQALATMDYSCFWSFIFFVMLITLGIDSTFAGIEAFITGFCDESRFLSKN--RKWFVLVICIIYYFLSFPAI-SYGGQFVIPFLDEYGVSLSVLFIVTCEMIAVCWFYGVDQFSKDIRAMLGFYPGIYWRV 563          
BLAST of slc6a-17 vs. Ensembl Celegans
Match: snf-2 (Transporter [Source:UniProtKB/TrEMBL;Acc:P90890])

HSP 1 Score: 208.764 bits (530), Expect = 3.762e-57
Identity = 142/494 (28.74%), Postives = 247/494 (50.00%), Query Frame = 1
Query:  202 EFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFK-LVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRR---------------MNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMD-------------ESPGYPQWH-----VTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXI-LGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGV------PINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALP 1560
            E +LS +G A+GLGN+WRFP   Y++GG +FL +Y+I   +   P + +E  +GQ++++SP   F+ ++P   G+GW    + +++ VYY ++ISW  +Y+   F Y+     C+  +N  NC       R                +N T A + S+      Y+ G  K  + T  +++              S G+  ++     +  ++ L W++  + L+ G+K   K+ Y TVI PY ++  L++ G SLPGA  G+Y          +  +      ++Q+ FS +I  GG++  ASYN    N Y+D +IIVF+D + S L GI+VF+ LG++A + G+        N ++  G  L +I YT+AIA +P    W  +F +M   LG+ ++   +E + + + D + ++R+   R+ L + S+  V FL G+++ +  G YWF + D   +    T    +  + V   YG      D +VM   P
Sbjct:  116 ESLLSSLGQAIGLGNIWRFPTVAYQNGGTSFLIVYIICAFVFAVPAIHMEFALGQYAAKSPPAVFRRIMPALEGVGWMTCIVGAVIGVYYMILISWIVLYIINIF-YVNNMGRCDNPWNQNNCYDGSEQSRCNKGLYSNMTANASSFLNTTMAPLMSSGSKRILYING--KCQDATNMSVEVGTEQFFSKSVIRPSAGFTDFNSINLPILGAVALCWVIAAVVLIRGMKAIGKLSYVTVILPYFIIVSLLICGVSLPGAKDGLYHLFGQTDFNYLYKRETWTAALQQICFSLSIGQGGLMNIASYNKKTYNWYRDVYIIVFLDTLMSILGGITVFSTLGFLAYERGINSTDIDAFNHIVKEGHALAFIVYTEAIAEMPVPYLWYALFFIMLFLLGISTEVVIVEIVCSCLADRFRYLRE---RRWLTVLSVSAVFFLLGLVMTTDAGFYWFDMFDEYSTGISATFGTAIMCMTVFWCYGTNHFREDIAVMWGEP 603          
BLAST of slc6a-17 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0087125)

HSP 1 Score: 308.531 bits (789), Expect = 1.358e-94
Identity = 194/575 (33.74%), Postives = 300/575 (52.17%), Query Frame = 1
Query:   73 SPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAF-KLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCI-----------------------------------SSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGE 1689
            SP  H+SK   SK TP  PH  D++S S+      R  W+ + +F+LS IGFAV L NVWRFP  CY++GGGAFL  Y I+ V+ G PL ++EL +GQ + +   T + +LVP+F GIG++++ I+  V+ YY V+I+W+  + F SF   +PWT CN ++N+ NC                                     S L    +     + ++  EY++ Y+    +      H +    G  +W + L L++ +++   SL  G+  S KV++FT +FPY V+  L++ G +LPG+  GI +YL P++  +   +V +    Q+ FS     G +L YASYN +  N+Y+D  +  FI+  TSF++G  +F++LGYMA   GV I  V T G GL ++ Y  AIAT+P   FW  +F +M + LGLDS F   E I   + D +P   K K  + L +  +  ++F+ G+  C+ GG Y+F +LD   + Y + V  F E I V  IYG  +   D   M+  P    W +   F+ P  +  I +  +  Y+ L+ A    P W  
Sbjct:    2 SPTGHISK---SK-TPT-PHDNDNNSISDE-----RETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNR--SEGIHDL----GAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFP---KIKRNRELFVAGLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTYADYVYPSWAN 557          
BLAST of slc6a-17 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0330002)

HSP 1 Score: 308.531 bits (789), Expect = 1.824e-94
Identity = 194/575 (33.74%), Postives = 300/575 (52.17%), Query Frame = 1
Query:   73 SPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAF-KLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCI-----------------------------------SSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGE 1689
            SP  H+SK   SK TP  PH  D++S S+      R  W+ + +F+LS IGFAV L NVWRFP  CY++GGGAFL  Y I+ V+ G PL ++EL +GQ + +   T + +LVP+F GIG++++ I+  V+ YY V+I+W+  + F SF   +PWT CN ++N+ NC                                     S L    +     + ++  EY++ Y+    +      H +    G  +W + L L++ +++   SL  G+  S KV++FT +FPY V+  L++ G +LPG+  GI +YL P++  +   +V +    Q+ FS     G +L YASYN +  N+Y+D  +  FI+  TSF++G  +F++LGYMA   GV I  V T G GL ++ Y  AIAT+P   FW  +F +M + LGLDS F   E I   + D +P   K K  + L +  +  ++F+ G+  C+ GG Y+F +LD   + Y + V  F E I V  IYG  +   D   M+  P    W +   F+ P  +  I +  +  Y+ L+ A    P W  
Sbjct:    2 SPTGHISK---SK-TPT-PHDNDNNSISDE-----RETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNR--SEGIHDL----GAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFP---KIKRNRELFVAGLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTYADYVYPSWAN 557          
BLAST of slc6a-17 vs. Ensembl Fly
Match: Gat (gene:FBgn0039915 transcript:FBtr0089972)

HSP 1 Score: 282.337 bits (721), Expect = 9.159e-85
Identity = 170/473 (35.94%), Postives = 267/473 (56.45%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISS-------------------GLSVRRMNLTSAYITS-TEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYP-FMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDS-RVSTYGLTVVAFLEIIIVGIIYGFRQLH 1530
            RG W+S+ +FILS +G A+GLGNVWRFP  CY++GGGAF+  Y+I   + G P+ F+EL +GQ  +      FK+ PIF GIG++   +S  + VYY V+++WA  Y F S    +PW  CN  +N+ NC+S                      SV  +N+TS  +T   +E+W+       +   +  H ++E  G  +W +  +L+L WIL    +  GVK + KV+YFT +FPYV++T L+V G +LPGA  GI FY++P++ K+ + +V +  + Q+ FS  + +G ++   SYN F  N+Y+D  I+  ++  TS  +G  +F+++G+MA +   P+  V  SG GL ++ Y  A+  LPG   W+ +F  M + +GLDSQF  +E     I D +P  +RK   RK + I  +  + +L G+   + GG Y F ILDS  VS + L  + F E + +   YG  + +
Sbjct:   58 RGSWSSKMDFILSVVGLAIGLGNVWRFPYLCYKNGGGAFILPYIITLFLAGIPMFFMELALGQMLTIGGLGVFKIAPIFKGIGYAAAVMSCWMNVYYIVILAWAVFYFFMSMRADVPWRTCNNWWNTVNCVSQYERKNLHCWDKIINGTTQKVCSVSALNITSLELTDPVKEFWE-------RRALQISHGIEEI-GNIRWELAGTLLLVWILCYFCIWKGVKWTGKVVYFTALFPYVLLTILLVRGITLPGALEGIKFYIIPNFSKLTNSEVWIDAVTQIFFSYGLGLGTLVALGSYNKFTNNVYKDALIVCTVNSSTSMFAGFVIFSVIGFMAHEQQRPVADVAASGPGLAFLVYPSAVLQLPGSPMWSCLFFFMLLLIGLDSQFCTMEGFITAIIDEWPQLLRK---RKEIFIAIVCALSYLVGLTCITQGGMYIFQILDSYAVSGFCLLWLIFFECVSISWCYGVDRFY 519          
BLAST of slc6a-17 vs. Ensembl Fly
Match: GlyT (gene:FBgn0034911 transcript:FBtr0301162)

HSP 1 Score: 291.197 bits (744), Expect = 3.444e-84
Identity = 183/512 (35.74%), Postives = 285/512 (55.66%), Query Frame = 1
Query:  163 ESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAF-KLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCIS--------------------SGLSVRRMNLTSAYITS-----TEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVH---FLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPI---DIIWMILIAFICP 1602
            ES   RG WT R +F+LS +G++VGLGNVWRFP  CY +GGGAFL  + I+ VI G PL+F+EL  GQ+++  P   + +  P+F G+G  MI +S+IV +YY ++I+W   Y+F SF  ++PW  C   +++K C S                    +  S    N+T+  + +      EEY++ +V G  K  E T        G  +  +   L L W +  L L  GV+ S KV+YFT +FPYVV+  L V G +LPGASTGI FYL PDWK++ + +V      Q+ F+ + A GG++T +SYN F  N Y+D+ I+ F +  TSF +G+ +F+I+G++A +  V + KV+  G GL +I Y + +  LP    W  +F +M + LGLDSQFA +E ++  I D +P +R+ K      IW ++ V    ++ G+   +  G YW  ++D   + + + ++A  E I++  IYG ++   D   M+       +  W I+  +I P
Sbjct:   52 ESEHERGTWTGRFDFLLSLLGYSVGLGNVWRFPYLCYNNGGGAFLIPFTIMLVIAGLPLMFMELSFGQYAALGPVAVYRRFCPLFRGLGTGMILVSAIVMLYYNLIIAWTIFYMFASFAPVLPWQNCEPAWSTKYCFSYAQADQCEATNGTYYLRTCHNATSAAENNITTLALGALKRPPAEEYFNNFVLGLSKGIEET--------GSIKLSLAACLFLAWTIVFLCLCKGVQSSGKVVYFTALFPYVVLVILFVRGVTLPGASTGILFYLTPDWKQLANAQVWGDAAVQIFFALSPAWGGLITLSSYNKFSNNCYKDSLIVAFCNIATSFFAGLVIFSIIGFLAHELNVDVEKVVDQGAGLAFIVYPEVVTRLPVSPVWAVLFFVMLLTLGLDSQFALMETVTTAILDRFPNLRQYK------IWVVLSVAIFGYIGGLGFTTNSGMYWLQLMDKYAANWSVLLIAISECILIAWIYGSQRFLNDIQGMIGKRSWFWNFFWGIMWRYITP 549          
BLAST of slc6a-17 vs. Ensembl Fly
Match: Ntl (gene:FBgn0267326 transcript:FBtr0079478)

HSP 1 Score: 271.937 bits (694), Expect = 2.739e-81
Identity = 187/525 (35.62%), Postives = 289/525 (55.05%), Query Frame = 1
Query:  118 PEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEI 1692
            P       D      E+   RG+W S+ EFILS +G+A+G+GNVWRFP  CY SGG AFL  Y+++ ++ G PL ++E+ IGQFSS   T  F++ P+  G G + + +++    YY+V+IS+    +F  F   +PW  C+  +N+ +C+++   + + N +  + TS +E        FF        T     G   W    +L++TWI+    LM G+K   KV+YFTV FPY+++  L++ G +LPGA  GI FYL P+W +++D KV      Q+ F      GG++  AS+++FR N   D+ +IV I+  TS L+G  VF++LG+++EKSG+P+  V T G GL ++TY +AIA LP    W  MF  M   LG+DS F  LE I + I D + ++R  K +  L+  S +    L+ IM C+ GG +   + D   S   + V+  +EII+V  IYG +    D   M+     + W I+   + P II  ILIT+I   + ++   +  P W  I
Sbjct:    7 PTTNATRKDKRIERDEN---RGQWKSKSEFILSLLGYAIGIGNVWRFPYLCYRSGGAAFLIPYLLMVILAGIPLFYMEILIGQFSSTGCTGMFRMTPLLKGTGIAQVVVNAYCVCYYSVIISYPIRMIFYCFFKKVPWEDCSNSWNTDDCVTAS-DMGKQNSSDVFKTSADE--------FFHLEVLRISTDISDLGGMVWEQLTALIITWIIIYFCLMRGIKSVGKVVYFTVPFPYLLLFILLIRGATLPGAWKGIKFYLYPEWHRLLDLKVWADAAVQMFFGIGPGWGGIVNMASFSSFRNNAKCDSVLIVSINVFTSLLAGFVVFSVLGFLSEKSGIPVESVATGGAGLAFVTYPEAIALLPVPQLWALMFFFMLFLLGIDSVFVQLEAIMSSILDEWYWVRSHKCKLTLI--SCLIFLGLSSIM-CTNGGMFILQLFDWYSSAIAVIVICLVEIIMVAWIYGIKNFMLDVEFMLGKRPTLYWRIVWQVVTPVIIIFILITSIVFIRTITYNNIPYPQWAII 516          
BLAST of slc6a-17 vs. Ensembl Zebrafish
Match: slc6a14 (solute carrier family 6 member 14 [Source:ZFIN;Acc:ZDB-GENE-130411-2])

HSP 1 Score: 310.842 bits (795), Expect = 1.466e-95
Identity = 192/557 (34.47%), Postives = 310/557 (55.66%), Query Frame = 1
Query:   40 EEMDIKNVNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITS---TEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXIL--GVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIA---FICPXXXXXXXXXXXXXYKKLSVAGVNIPLWG 1686
            ++  +KN+ G      +        + +  H   +   S+      RG W+S++E++LS IG+AVGLGNVWRFP   Y+ GGGAFL  Y I+  + G PL F+E   GQF S+ P   +K VPI  G+G +M+ +S+ V +YY V+I+++  YLF SF   +PW++ N      N  +S +S   +N++   I+    +E+YWD       +   +   +MDE+ G   WH+ L L+L+WIL G +L  G+K S KV+YFT  FPY+V+  L++ G +L GA  GI FY+          +  +      Q+ FS +IA GG++  +SYN F  N YQD+ ++   +  TS  +G ++F++LG+MA     P+++V  +G  L +I Y DA++ LP    W+ +F  M I LGLDSQFA +E IS  + D YP + K+K  + L+  ++  + FL G+   +  G YW  ++D+  + + L V   LE++ + I+YG  +   D  +M+     + W+   A   FI P ++ +ILI +++T+   + + V  P WG
Sbjct:    2 KDYSLKNIRGVLFKNSVGDEQDKDKSDKAEHVVQNDENSD------RGNWSSKREYMLSMIGYAVGLGNVWRFPYLAYKHGGGAFLIPYTIMLAVSGLPLFFMESSFGQFCSQGPINVWKAVPILQGVGITMMLVSTFVAIYYNVIIAYSIYYLFASFQDPLPWSIKNC-----NTTASNISTAAVNVSCGQISGQSLSEKYWD-------EVALQRSSSMDET-GPVVWHLALCLLLSWILVGAALFKGIKSSGKVVYFTATFPYIVLLILLIRGATLEGAKDGIEFYIGSQSNLTKLAEAEVWKDAATQIFFSLSIAWGGLMALSSYNKFYNNCYQDSIVVCVTNCGTSIFAGFAIFSVLGHMAHVYQRPVSEVADAGFALAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVISTCLLDAYPEVLKSK--RGLVTTAVCIILFLLGLPCVTRAGIYWVNLIDTFSAGWILLVAGLLEVLGLCILYGGNRFIKDIEMMIGTKSSLFWLWWRACWFFITPVVLSIILIWSLYTFTSPTYSSVAYPDWG 537          
BLAST of slc6a-17 vs. Ensembl Zebrafish
Match: slc6a7 (solute carrier family 6 member 7 [Source:ZFIN;Acc:ZDB-GENE-070112-1492])

HSP 1 Score: 297.36 bits (760), Expect = 4.697e-90
Identity = 174/459 (37.91%), Postives = 261/459 (56.86%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMA 1554
            R +W  + EF+LSCIG+ VGLGNVWRFP  CY +GGG FL  Y I+    G PL  +EL +GQ+ +  P T +K  P+  GIG  M+ +S++V +YY V+I+W F YL  SF   +PW+ C+ + N   C          N T++  + +E +W+  V G          T    PG  +W + L L+  WI+  L ++ G+  S KV+Y T  FPY V+  LI+ G +L G+  G+ FYL P W ++ D +V      Q+ +S  I +GG+L+ ASYN F  N+ +DT II   +  TSF +G ++F+ILG+MA K GVP++KV  SG GL ++ Y +A+A LPG  FW+ +F LM   LG+D+ F  +E I   + D +P +R     K L +  +    +L G++L + GG YWF ++DS  +++GL ++     I +   YG  Q   D   M+ 
Sbjct:   71 RDQWGGKYEFLLSCIGYCVGLGNVWRFPYLCYRNGGGVFLIPYFIMLFFTGMPLFLMELSLGQYGAAGPITVWKCCPLLKGIGIGMLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWS-CDALQNIALC---------ANKTNSTQSPSEVFWNEKVLGVVH------STGLSDPGPVRWPLALCLLAAWIIIFLCMLKGIHSSGKVVYVTATFPYFVLLVLIIRGATLEGSLDGVAFYLTPKWDQLADAQVWNDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTIIITIGNCSTSFFAGFAIFSILGHMAFKKGVPVDKVADSGPGLAFVAYPEALALLPGSVFWSILFFLMLFMLGVDTLFGNMEGICTAVLDEFPQLRSNLKHKTLFLAVLCFSFYLMGLLLITDGGIYWFTLIDSFSTSFGLIIITLFMCIGISFFYGVNQFCQDIVDMIC 513          
BLAST of slc6a-17 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 296.975 bits (759), Expect = 1.046e-88
Identity = 195/617 (31.60%), Postives = 324/617 (52.51%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSV------RRMNLTS---------------------------AYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYP-FMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYK-KLFTAPN-YWGPYHLRNWLYGKYYRDKLLAFKDNPVFLK 1920
            RG W+++ +FILS +G+AVGLGNVWRFP   +++GGGAFL  Y+I+  + G P+  +E+ +GQF+S+ P + +K +P   G G +M+ IS ++ +YY +++ W   YLF S    +PW  C   +N+  C    + +      R  N+TS                            Y++ +EEY        FKY         E PG  +W +   L L W++   SL  G+K S KV+YFT  FPYVV+  L++ G +LPGA +GI +++ P W+K+ D KV      Q+ FS + A GG++T +SYN F  N Y+DT I+   +  TS  +G  +F+++G+MA +  VPI  V   G G+ ++ Y +A+  LP   FW  +F LM + LGLD+ FA +E I   + D +P ++RK K +  L+        F+ G  + +  G Y   ++D+  ++Y L ++A  E++ +  IYG ++   D  +M+    +  W +  AF+ PTI+  IL  +++ +K ++      P W  ++ +L        ++  +I   I + IK     G    + KL  +P   WGP+ +++   G+ Y++ +     N + LK
Sbjct:  169 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEY--------FKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPQFTLV---CCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLM-------VICSVIWIPIMFAIKMHLAPGSLIERLKLVCSPQPDWGPFLMKH--RGERYKNMIDPLGTNSLGLK 765          
BLAST of slc6a-17 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 296.975 bits (759), Expect = 1.269e-88
Identity = 195/617 (31.60%), Postives = 324/617 (52.51%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSV------RRMNLTS---------------------------AYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYP-FMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYK-KLFTAPN-YWGPYHLRNWLYGKYYRDKLLAFKDNPVFLK 1920
            RG W+++ +FILS +G+AVGLGNVWRFP   +++GGGAFL  Y+I+  + G P+  +E+ +GQF+S+ P + +K +P   G G +M+ IS ++ +YY +++ W   YLF S    +PW  C   +N+  C    + +      R  N+TS                            Y++ +EEY        FKY         E PG  +W +   L L W++   SL  G+K S KV+YFT  FPYVV+  L++ G +LPGA +GI +++ P W+K+ D KV      Q+ FS + A GG++T +SYN F  N Y+DT I+   +  TS  +G  +F+++G+MA +  VPI  V   G G+ ++ Y +A+  LP   FW  +F LM + LGLD+ FA +E I   + D +P ++RK K +  L+        F+ G  + +  G Y   ++D+  ++Y L ++A  E++ +  IYG ++   D  +M+    +  W +  AF+ PTI+  IL  +++ +K ++      P W  ++ +L        ++  +I   I + IK     G    + KL  +P   WGP+ +++   G+ Y++ +     N + LK
Sbjct:  177 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEY--------FKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPQFTLV---CCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLM-------VICSVIWIPIMFAIKMHLAPGSLIERLKLVCSPQPDWGPFLMKH--RGERYKNMIDPLGTNSLGLK 773          
BLAST of slc6a-17 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 296.975 bits (759), Expect = 1.309e-88
Identity = 195/617 (31.60%), Postives = 324/617 (52.51%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSV------RRMNLTS---------------------------AYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYP-FMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYK-KLFTAPN-YWGPYHLRNWLYGKYYRDKLLAFKDNPVFLK 1920
            RG W+++ +FILS +G+AVGLGNVWRFP   +++GGGAFL  Y+I+  + G P+  +E+ +GQF+S+ P + +K +P   G G +M+ IS ++ +YY +++ W   YLF S    +PW  C   +N+  C    + +      R  N+TS                            Y++ +EEY        FKY         E PG  +W +   L L W++   SL  G+K S KV+YFT  FPYVV+  L++ G +LPGA +GI +++ P W+K+ D KV      Q+ FS + A GG++T +SYN F  N Y+DT I+   +  TS  +G  +F+++G+MA +  VPI  V   G G+ ++ Y +A+  LP   FW  +F LM + LGLD+ FA +E I   + D +P ++RK K +  L+        F+ G  + +  G Y   ++D+  ++Y L ++A  E++ +  IYG ++   D  +M+    +  W +  AF+ PTI+  IL  +++ +K ++      P W  ++ +L        ++  +I   I + IK     G    + KL  +P   WGP+ +++   G+ Y++ +     N + LK
Sbjct:  177 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEY--------FKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPQFTLV---CCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLM-------VICSVIWIPIMFAIKMHLAPGSLIERLKLVCSPQPDWGPFLMKH--RGERYKNMIDPLGTNSLGLK 773          
BLAST of slc6a-17 vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 310.071 bits (793), Expect = 6.624e-95
Identity = 206/564 (36.52%), Postives = 318/564 (56.38%), Query Frame = 1
Query:  112 LTPE---GPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNC-----ISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDES----PGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYK 1767
            +TP+    P   DD+   + E    RG W+ + +F+LSCIG+ VGLGNVWRFP R Y +GGGAFL  Y I+  I G PL F+EL +GQFSS  P   +K+ P+F G+G  M+ I ++V +YY ++I++   YLF S    +PW  C   +N+  C     I +  S   +N+++  ++ +EEYW  YV           H    S    PG  +W + L L+L+W +  L ++ GVK S KV+YFT  FPY+++  L++ G +L GA  GI FYL P ++ ++  KV +    Q+ +S  +  GG+LT+ASYN F +NIY+DTFI+   +  TS L+G ++F++LGYM+++ GVP+++V  +G GL ++ Y  A+  LP   FW+F+F  M + LGLDSQFA +E I   I D +P+  + K  KA+    I    FL G++L + GG YW V+LD   + +GL V+     + V  +YG +    D  +M+     + +     F+ P  +  +L  +I  Y+         PLW E +  L   L  + I  GM+  ++K +
Sbjct:    9 VTPDLLMSPSDRDDTEL-DIEYPEDRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTDLCLDHHVIRASNSALLVNISNT-VSPSEEYWSRYV----------LHIQGSSGIGDPGQLRWKLCLCLLLSWTIVYLCILKGVKSSGKVVYFTATFPYIILVMLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAFTSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFMETIVTAITDEFPYYLRPK--KAVFSAIICVALFLLGLILATDGGMYWLVLLDDYSAGFGLLVIVITFGLSVSRVYGIKNFCRDIQMMLGFKPGLYFKACWIFLSPVTLMCLLAYSILKYQPSQYGSYKFPLWSEALGILMGLLSCMMIPIGMLVAILKEE 558          
BLAST of slc6a-17 vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 309.686 bits (792), Expect = 8.906e-95
Identity = 206/564 (36.52%), Postives = 318/564 (56.38%), Query Frame = 1
Query:  112 LTPE---GPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNC-----ISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDES----PGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYK 1767
            +TP+    P   DD+   + E    RG W+ + +F+LSCIG+ VGLGNVWRFP R Y +GGGAFL  Y I+  I G PL F+EL +GQFSS  P   +K+ P+F G+G  M+ I ++V +YY ++I++   YLF S    +PW  C   +N+  C     I +  S   +N+++  ++ +EEYW  YV           H    S    PG  +W + L L+L+W +  L ++ GVK S KV+YFT  FPY+++  L++ G +L GA  GI FYL P ++ ++  KV +    Q+ +S  +  GG+LT+ASYN F +NIY+DTFI+   +  TS L+G ++F++LGYM+++ GVP+++V  +G GL ++ Y  A+  LP   FW+F+F  M + LGLDSQFA +E I   I D +P+  + K  KA+    I    FL G++L + GG YW V+LD   + +GL V+     + V  +YG +    D  +M+     + +     F+ P  +  +L  +I  Y+         PLW E +  L   L  + I  GM+  ++K +
Sbjct:   12 VTPDLLMSPSDRDDTEL-DIEYPEDRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTDLCLDHHVIRASNSALLVNISNT-VSPSEEYWSRYV----------LHIQGSSGIGDPGQLRWKLCLCLLLSWTIVYLCILKGVKSSGKVVYFTATFPYIILVMLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAFTSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFMETIVTAITDEFPYYLRPK--KAVFSAIICVALFLLGLILATDGGMYWLVLLDDYSAGFGLLVIVITFGLSVSRVYGIKNFCRDIQMMLGFKPGLYFKACWIFLSPVTLMCLLAYSILKYQPSQYGSYKFPLWSEALGILMGLLSCMMIPIGMLVAILKEE 561          
BLAST of slc6a-17 vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 310.071 bits (793), Expect = 9.465e-95
Identity = 206/564 (36.52%), Postives = 318/564 (56.38%), Query Frame = 1
Query:  112 LTPE---GPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNC-----ISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDES----PGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYK 1767
            +TP+    P   DD+   + E    RG W+ + +F+LSCIG+ VGLGNVWRFP R Y +GGGAFL  Y I+  I G PL F+EL +GQFSS  P   +K+ P+F G+G  M+ I ++V +YY ++I++   YLF S    +PW  C   +N+  C     I +  S   +N+++  ++ +EEYW  YV           H    S    PG  +W + L L+L+W +  L ++ GVK S KV+YFT  FPY+++  L++ G +L GA  GI FYL P ++ ++  KV +    Q+ +S  +  GG+LT+ASYN F +NIY+DTFI+   +  TS L+G ++F++LGYM+++ GVP+++V  +G GL ++ Y  A+  LP   FW+F+F  M + LGLDSQFA +E I   I D +P+  + K  KA+    I    FL G++L + GG YW V+LD   + +GL V+     + V  +YG +    D  +M+     + +     F+ P  +  +L  +I  Y+         PLW E +  L   L  + I  GM+  ++K +
Sbjct:   12 VTPDLLMSPSDRDDTEL-DIEYPEDRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTDLCLDHHVIRASNSALLVNISNT-VSPSEEYWSRYV----------LHIQGSSGIGDPGQLRWKLCLCLLLSWTIVYLCILKGVKSSGKVVYFTATFPYIILVMLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAFTSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFMETIVTAITDEFPYYLRPK--KAVFSAIICVALFLLGLILATDGGMYWLVLLDDYSAGFGLLVIVITFGLSVSRVYGIKNFCRDIQMMLGFKPGLYFKACWIFLSPVTLMCLLAYSILKYQPSQYGSYKFPLWSEALGILMGLLSCMMIPIGMLVAILKEE 561          
BLAST of slc6a-17 vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 302.368 bits (773), Expect = 6.248e-93
Identity = 191/493 (38.74%), Postives = 290/493 (58.82%), Query Frame = 1
Query:  112 LTPE---GPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNC-----ISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDES----PGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMA 1554
            +TP+    P   DD+   + E    RG W+ + +F+LSCIG+ VGLGNVWRFP R Y +GGGAFL  Y I+  I G PL F+EL +GQFSS  P   +K+ P+F G+G  M+ I ++V +YY ++I++   YLF S    +PW  C   +N+  C     I +  S   +N+++  ++ +EEYW  YV           H    S    PG  +W + L L+L+W +  L ++ GVK S KV+YFT  FPY+++  L++ G +L GA  GI FYL P ++ ++  KV +    Q+ +S  +  GG+LT+ASYN F +NIY+DTFI+   +  TS L+G ++F++LGYM+++ GVP+++V  +G GL ++ Y  A+  LP   FW+F+F  M + LGLDSQFA +E I   I D +P+  + K  KA+    I    FL G++L + GG YW V+LD   + +GL V+     + V  +YG +    D  +M+ 
Sbjct:    5 VTPDLLMSPSDRDDTEL-DIEYPEDRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTDLCLDHHVIRASNSALLVNISNT-VSPSEEYWSRYV----------LHIQGSSGIGDPGQLRWKLCLCLLLSWTIVYLCILKGVKSSGKVVYFTATFPYIILVMLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAFTSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFMETIVTAITDEFPYYLRPK--KAVFSAIICVALFLLGLILATDGGMYWLVLLDDYSAGFGLLVIVITFGLSVSRVYGIKNFCRDIQMMLG 483          
BLAST of slc6a-17 vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 301.982 bits (772), Expect = 1.525e-92
Identity = 191/512 (37.30%), Postives = 292/512 (57.03%), Query Frame = 1
Query:   49 DIKNVNGFSPALHLSKFGKSKLTPEGPHRTD-DSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNC-----ISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDES----PGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMA 1554
            D   +  F       +   S       + +D D +  + E    RG W+ + +F+LSCIG+ VGLGNVWRFP R Y +GGGAFL  Y I+  I G PL F+EL +GQFSS  P   +K+ P+F G+G  M+ I ++V +YY ++I++   YLF S    +PW  C   +N+  C     I +  S   +N+++  ++ +EEYW  YV           H    S    PG  +W + L L+L+W +  L ++ GVK S KV+YFT  FPY+++  L++ G +L GA  GI FYL P ++ ++  KV +    Q+ +S  +  GG+LT+ASYN F +NIY+DTFI+   +  TS L+G ++F++LGYM+++ GVP+++V  +G GL ++ Y  A+  LP   FW+F+F  M + LGLDSQFA +E I   I D +P+  + K  KA+    I    FL G++L + GG YW V+LD   + +GL V+     + V  +YG +    D  +M+ 
Sbjct:    6 DTAKIWAFLAGFRFDQINDSGFCQISKYPSDRDDTELDIEYPEDRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTDLCLDHHVIRASNSALLVNISNT-VSPSEEYWSRYV----------LHIQGSSGIGDPGQLRWKLCLCLLLSWTIVYLCILKGVKSSGKVVYFTATFPYIILVMLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAFTSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFMETIVTAITDEFPYYLRPK--KAVFSAIICVALFLLGLILATDGGMYWLVLLDDYSAGFGLLVIVITFGLSVSRVYGIKNFCRDIQMMLG 504          
BLAST of slc6a-17 vs. Ensembl Mouse
Match: Slc6a7 (solute carrier family 6 (neurotransmitter transporter, L-proline), member 7 [Source:MGI Symbol;Acc:MGI:2147363])

HSP 1 Score: 318.546 bits (815), Expect = 3.252e-98
Identity = 209/566 (36.93%), Postives = 322/566 (56.89%), Query Frame = 1
Query:  103 KSKLTPEGPHRTDDSSYSEGESVFL--RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCIS-----SGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDES----PGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYK 1767
            +  +TP+      D    + +  F   RG WT + +F+LSCIG+ VGLGNVWRFP R Y +GGGAFL  Y ++  I G PL F+EL +GQFSS  P   +K+ P+F G G +M+ I  +V +YY ++I++   YLF S    +PW  C   +N++ C+      SG  V  +NL+S  ++ +EEYW  YV           H         PG  +W++ L L+L W++  L ++ GVK S KV+YFT  FPY+++  L+V G +LPGA  GI FYL P +  ++  KV +    Q+ +S  +  GG+LT+ASYN F +NIY+DTFI+   + ITS L+G ++F++LGYM+++ GVP+++V  +G GL ++ Y  A+  LP   FW+F+F  M + LGLDSQFA LE I   + D +P+  + K  KA+    I    +L G++L + GG YW V+LD   +++GL VV     + V  +YG ++   D  +M+     + +     F+ P  +  +L+ +I  Y+         P W E++  L   L  L I  GM+  V++ +
Sbjct:   10 RKPITPDLLMTPSDQGDVDLDVDFAADRGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTELCLEHRGPKSGNGVLPLNLSST-VSPSEEYWSRYV----------LHIQGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMIPAGMLVAVLREE 562          
BLAST of slc6a-17 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 303.908 bits (777), Expect = 3.487e-91
Identity = 180/545 (33.03%), Postives = 292/545 (53.58%), Query Frame = 1
Query:   61 VNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCN---------------------------QVFNSKNCISSGLSVRRMNLTS----AYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICP 1602
            VN     + L   G + + P     T      +G+    RG W+S+ +FILS +G+AVGLGNVWRFP   +++GGGAFL  Y+++  + G P+ F+E+ +GQF+S+ P + +K +P   G G +M+ IS ++ +YY V+I +   YLF SF  ++PW  CN                           Q+ NS  C+++  ++  +N TS     +++ +EEY+ Y+V               E PG  +W +   L L W++   SL  G+K S KV+YFT  FPYVV+  L++ G +LPGA  GI++++ P W+K+ D  V      Q+ FS + A GG++T +SYN F  N Y+DT I+   +  TS  +G  +F+++G+MA +  V I  V   G G+ ++ Y +A+  LP   FW  +F LM + LGLD+ FA +E I   I D +P   +T   K +         F+ G  + + GG Y F ++D+  ++Y L ++A  E++ +  +YG ++   D  +M+    +I W +  AF+ P
Sbjct:  146 VNMSQSTVVLGTDGIASVLPGSVATTTIPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVL--------KISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT--HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTP 680          
BLAST of slc6a-17 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 303.908 bits (777), Expect = 3.487e-91
Identity = 180/545 (33.03%), Postives = 292/545 (53.58%), Query Frame = 1
Query:   61 VNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCN---------------------------QVFNSKNCISSGLSVRRMNLTS----AYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICP 1602
            VN     + L   G + + P     T      +G+    RG W+S+ +FILS +G+AVGLGNVWRFP   +++GGGAFL  Y+++  + G P+ F+E+ +GQF+S+ P + +K +P   G G +M+ IS ++ +YY V+I +   YLF SF  ++PW  CN                           Q+ NS  C+++  ++  +N TS     +++ +EEY+ Y+V               E PG  +W +   L L W++   SL  G+K S KV+YFT  FPYVV+  L++ G +LPGA  GI++++ P W+K+ D  V      Q+ FS + A GG++T +SYN F  N Y+DT I+   +  TS  +G  +F+++G+MA +  V I  V   G G+ ++ Y +A+  LP   FW  +F LM + LGLD+ FA +E I   I D +P   +T   K +         F+ G  + + GG Y F ++D+  ++Y L ++A  E++ +  +YG ++   D  +M+    +I W +  AF+ P
Sbjct:  146 VNMSQSTVVLGTDGIASVLPGSVATTTIPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVL--------KISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT--HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTP 680          
BLAST of slc6a-17 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 303.908 bits (777), Expect = 3.487e-91
Identity = 180/545 (33.03%), Postives = 292/545 (53.58%), Query Frame = 1
Query:   61 VNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCN---------------------------QVFNSKNCISSGLSVRRMNLTS----AYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICP 1602
            VN     + L   G + + P     T      +G+    RG W+S+ +FILS +G+AVGLGNVWRFP   +++GGGAFL  Y+++  + G P+ F+E+ +GQF+S+ P + +K +P   G G +M+ IS ++ +YY V+I +   YLF SF  ++PW  CN                           Q+ NS  C+++  ++  +N TS     +++ +EEY+ Y+V               E PG  +W +   L L W++   SL  G+K S KV+YFT  FPYVV+  L++ G +LPGA  GI++++ P W+K+ D  V      Q+ FS + A GG++T +SYN F  N Y+DT I+   +  TS  +G  +F+++G+MA +  V I  V   G G+ ++ Y +A+  LP   FW  +F LM + LGLD+ FA +E I   I D +P   +T   K +         F+ G  + + GG Y F ++D+  ++Y L ++A  E++ +  +YG ++   D  +M+    +I W +  AF+ P
Sbjct:  146 VNMSQSTVVLGTDGIASVLPGSVATTTIPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVL--------KISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT--HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTP 680          
BLAST of slc6a-17 vs. Ensembl Mouse
Match: Slc6a2 (solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2 [Source:MGI Symbol;Acc:MGI:1270850])

HSP 1 Score: 295.049 bits (754), Expect = 1.349e-89
Identity = 180/517 (34.82%), Postives = 272/517 (52.61%), Query Frame = 1
Query:  154 SEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESP-----GYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGE 1689
            S+      R  W  + +F+LS +GFAV L NVWRFP  CY++GGGAFL  Y +  +I G PL ++EL +GQ++     T +K+ P F G+G+++I I+  V  YY V+I+W+  YLF SF   +PWT C   +NS NC    L      L ++ +    +Y  Y  T   ++ ER    + ES      G PQW + L LM+  ++   SL  GVK S KV++ T   PY V+  L+V G +LPGAS GI  YL  D+ ++ +  V +    Q+ FS     G ++ +ASYN F  N Y+D  +   I+ +TSF+SG ++F+ILGYMA +  V I  V T G GL +I Y +AI+TL G  FW  +F LM +ALGLDS    +E +  G+ D +  +++    + L    +    FL  +   + GG Y   +LD+  +   +     +E I V   YG  +   D   MM     + W +   F+ P  +  +++ +I  +K L+      P W  
Sbjct:   48 SQDSDAQPRETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLNLPWTNCGHSWNSPNCTDPKL------LNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVIVVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTINCVTSFISGFAIFSILGYMAHEHKVNIEDVATEGAGLVFILYPEAISTLSGSTFWAVLFFLMLLALGLDSSMGGMEAVITGLADDFQVLKR---HRKLFTCVVTISTFLLALFCITKGGIYVLTLLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLLFVVVVSIINFKPLTYDDYTYPPWAN 555          
BLAST of slc6a-17 vs. UniProt/SwissProt
Match: sp|Q6PGE7|SC6A7_MOUSE (Sodium-dependent proline transporter OS=Mus musculus OX=10090 GN=Slc6a7 PE=1 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.275e-97
Identity = 209/566 (36.93%), Postives = 322/566 (56.89%), Query Frame = 1
Query:  103 KSKLTPEGPHRTDDSSYSEGESVFL--RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCIS-----SGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDES----PGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYK 1767
            +  +TP+      D    + +  F   RG WT + +F+LSCIG+ VGLGNVWRFP R Y +GGGAFL  Y ++  I G PL F+EL +GQFSS  P   +K+ P+F G G +M+ I  +V +YY ++I++   YLF S    +PW  C   +N++ C+      SG  V  +NL+S  ++ +EEYW  YV           H         PG  +W++ L L+L W++  L ++ GVK S KV+YFT  FPY+++  L+V G +LPGA  GI FYL P +  ++  KV +    Q+ +S  +  GG+LT+ASYN F +NIY+DTFI+   + ITS L+G ++F++LGYM+++ GVP+++V  +G GL ++ Y  A+  LP   FW+F+F  M + LGLDSQFA LE I   + D +P+  + K  KA+    I    +L G++L + GG YW V+LD   +++GL VV     + V  +YG ++   D  +M+     + +     F+ P  +  +L+ +I  Y+         P W E++  L   L  L I  GM+  V++ +
Sbjct:   10 RKPITPDLLMTPSDQGDVDLDVDFAADRGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTELCLEHRGPKSGNGVLPLNLSST-VSPSEEYWSRYV----------LHIQGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMIPAGMLVAVLREE 562          
BLAST of slc6a-17 vs. UniProt/SwissProt
Match: sp|P28573|SC6A7_RAT (Sodium-dependent proline transporter OS=Rattus norvegicus OX=10116 GN=Slc6a7 PE=1 SV=2)

HSP 1 Score: 317.005 bits (811), Expect = 8.361e-97
Identity = 203/539 (37.66%), Postives = 311/539 (57.70%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCIS-----SGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDES----PGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYK 1767
            RG WT + +F+LSCIG+ VGLGNVWRFP R Y +GGGAFL  Y ++  I G PL F+EL +GQFSS  P   +K+ P+F G G +M+ I  +V +YY ++I++   YLF S    +PW  C   +N++ C+       G     +NL+S  ++ +EEYW  YV           H         PG  +W++ L L+L W++  L ++ GVK S KV+YFT  FPY+++  L+V G +LPGA  GI FYL P +  ++  KV +    Q+ +S  +  GG+LT+ASYN F +NIY+DTFI+   + ITS L+G ++F++LGYM+++ GVP+++V  +G GL ++ Y  A+  LP   FW+F+F  M + LGLDSQFA LE I   + D +P+  + K  KA+    I    +L G++L + GG YW V+LD   +++GL VV     + V  +YG ++   D  +M+     + +     F+ P  +  +L+ +I  Y+         P W E++  L   L  L I  GM+  V++ +
Sbjct:   37 RGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTERCLEHRGPKDGNGALPLNLSST-VSPSEEYWSRYV----------LHIQGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVIYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMIPAGMLVAVLREE 562          
BLAST of slc6a-17 vs. UniProt/SwissProt
Match: sp|Q99884|SC6A7_HUMAN (Sodium-dependent proline transporter OS=Homo sapiens OX=9606 GN=SLC6A7 PE=2 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 1.629e-96
Identity = 203/539 (37.66%), Postives = 311/539 (57.70%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCIS-----SGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDE----SPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYK 1767
            RG WT + +F+LSCIG+ VGLGNVWRFP R Y +GGGAFL  Y ++  I G PL F+EL +GQFSS  P   +K+ P+F G G +M+ I  +V +YY ++I++   YLF S    +PW  C   +N++ C+       G     +NLT   ++ +EEYW  YV           H        SPG  +W++ L L+L W++  L ++ GVK S KV+YFT  FPY+++  L+V G +LPGA  GI FYL P +  ++  KV +    Q+ +S  +  GG+LT+ASYN F +NIY+DTFI+   + ITS L+G ++F++LGYM+++ GVP+++V  +G GL ++ Y  A+  LP   FW+F+F  M + LGLDSQFA LE I   + D +P+  + K  KA+    I    +L G++L + GG YW V+LD   +++GL VV     + V  +YG ++   D  +M+     + +     F+ P  +  +++ +I  Y+         P W E++  L   L  L I  GM+  V++ +
Sbjct:   37 RGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCT-VSPSEEYWSRYV----------LHIQGSQGIGSPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALMVYSIVKYQPSEYGSYRFPPWAELLGILMGLLSCLMIPAGMLVAVLREE 562          
BLAST of slc6a-17 vs. UniProt/SwissProt
Match: sp|Q7K4Y6|DAT_DROME (Sodium-dependent dopamine transporter OS=Drosophila melanogaster OX=7227 GN=DAT PE=1 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.361e-93
Identity = 194/575 (33.74%), Postives = 300/575 (52.17%), Query Frame = 1
Query:   73 SPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAF-KLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCI-----------------------------------SSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGE 1689
            SP  H+SK   SK TP  PH  D++S S+      R  W+ + +F+LS IGFAV L NVWRFP  CY++GGGAFL  Y I+ V+ G PL ++EL +GQ + +   T + +LVP+F GIG++++ I+  V+ YY V+I+W+  + F SF   +PWT CN ++N+ NC                                     S L    +     + ++  EY++ Y+    +      H +    G  +W + L L++ +++   SL  G+  S KV++FT +FPY V+  L++ G +LPG+  GI +YL P++  +   +V +    Q+ FS     G +L YASYN +  N+Y+D  +  FI+  TSF++G  +F++LGYMA   GV I  V T G GL ++ Y  AIAT+P   FW  +F +M + LGLDS F   E I   + D +P   K K  + L +  +  ++F+ G+  C+ GG Y+F +LD   + Y + V  F E I V  IYG  +   D   M+  P    W +   F+ P  +  I +  +  Y+ L+ A    P W  
Sbjct:    2 SPTGHISK---SK-TPT-PHDNDNNSISDE-----RETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNR--SEGIHDL----GAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFP---KIKRNRELFVAGLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTYADYVYPSWAN 557          
BLAST of slc6a-17 vs. UniProt/SwissProt
Match: sp|Q9Y345|SC6A5_HUMAN (Sodium- and chloride-dependent glycine transporter 2 OS=Homo sapiens OX=9606 GN=SLC6A5 PE=1 SV=3)

HSP 1 Score: 307.375 bits (786), Expect = 1.468e-91
Identity = 181/545 (33.21%), Postives = 293/545 (53.76%), Query Frame = 1
Query:   61 VNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCN---------------------------QVFNSKNCISSGLSVRRMNLTS----AYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICP 1602
            VN     + L+  G + + P            +G+    RG W+S+ +FILS +G+AVGLGNVWRFP   +++GGGAFL  Y+++  + G P+ F+E+ +GQF+S+ P + +K +P   G G +M+ IS ++ +YY V+I +   YLF SF  ++PW  CN                           Q+ NS  C+++  +V  +N TS     +++ +EEY+ Y+V               E PG  +W + L L L W++   SL  G+K S KV+YFT  FPYVV+  L++ G +LPGA  GI++++ P W+K+ D  V      Q+ FS + A GG++T +SYN F  N Y+DT I+   +  TS  +G  +F+++G+MA +  V I  V   G G+ ++ Y +A+  LP   FW  +F LM + LGLD+ FA +E I   I D +P   +T   K +         F+ G  + + GG Y F ++D+  ++Y L ++A  E++ +  +YG ++   D  +M+    +I W +  AF+ P
Sbjct:  152 VNMSQSTVVLATDGITSVLPGSVATVATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVL--------KISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT--HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTP 686          
BLAST of slc6a-17 vs. TrEMBL
Match: A0A0H3YF56 (Slc6a-17 OS=Schmidtea mediterranea OX=79327 GN=slc6a-17 PE=2 SV=1)

HSP 1 Score: 1192.18 bits (3083), Expect = 0.000e+0
Identity = 645/645 (100.00%), Postives = 645/645 (100.00%), Query Frame = 1
Query:   46 MDIKNVNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENINHYVEIIKKSHK 1980
            MDIKNVNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLVPDWKKVVDPKVILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQDTFIIVFIDFITSFLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPTIIFLILITNIFTYKKLSVAGVNIPLWGEIVAFLFLALVLLPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENINHYVEIIKKSHK
Sbjct:    1 MDIKNVNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLVPDWKKVVDPKVILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQDTFIIVFIDFITSFLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPTIIFLILITNIFTYKKLSVAGVNIPLWGEIVAFLFLALVLLPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENINHYVEIIKKSHK 645          
BLAST of slc6a-17 vs. TrEMBL
Match: A0A0H3YEX6 (Slc6a-10 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc6a-10 PE=2 SV=1)

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 327/632 (51.74%), Postives = 455/632 (71.99%), Query Frame = 1
Query:   82 LHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENINHYVEIIKKSH 1977
            L +SKF +  L      R+++      +   LRG+W +R EF+LSCIGFAVGLGNVWRFPI+ YE+GGGAFL  Y I+C+ILG PLL +ELG+GQF+ R PT AFK+VPI YGIGWSM+ IS I+E+YYA +I+ ++ YLFGS + +MPWTVCN  FNSK C+ S      +N+ S Y++S+ EYWDYYVTGF KYPERT +T++E PG PQWH+TL L+ TWI  G +LM G+KVS K++YF+V++PY  +  +  +  SLPGA  GI FYL P+WKK+ DP V+   IEQL FS +IAMGGM+TYASYN+FR+N Y+D  II+ ID+ TS L+G+++F +LGY+++++G  I KVI+SG  LF+IT T+A+AT+PG   W  + M+MAI+LGLDSQ A  E +S GI D  P ++  K  K +++W++  + FL G++L +PGGKYWF ILD RVS++GL ++A LE I +G+IYGF+QL YD+ +M    +   W I+IAF+ P  IF+I +T++     + V G+ IP+WGE++A  FL +VL PI  G+I+T++ Y  KYP+++GK F KKL   P YWGP++ + W+    YR KLL +KD+P+FLKY +  E+IN  V I++K +
Sbjct:   21 LMISKFNEKSLRSLSALRSEEDYIEIHDVTALRGRWNTRFEFLLSCIGFAVGLGNVWRFPIKVYENGGGAFLITYTIICIILGVPLLMLELGLGQFTGRGPTKAFKVVPIMYGIGWSMVMISLIIEIYYAPIIAISYFYLFGSLNKVMPWTVCNHEFNSKKCLGSFQENMDLNI-SDYVSSSSEYWDYYVTGFVKYPERTIYTLNEFPGPPQWHLTLCLLFTWITGGFALMNGIKVSGKIMYFSVLYPYFALISIFCVASSLPGAMNGIKFYLTPNWKKLYDPTVLRVAIEQLFFSCSIAMGGMITYASYNDFRDNFYRDAIIIIIIDYFTSVLAGLAIFPVLGYLSQRTGAKIEKVISSGSSLFFITLTEALATIPGSQLWTILLMVMAISLGLDSQIAMFETVSTGIMDAIPILQTKKEYKFMMVWALCSLFFLCGLLLITPGGKYWFDILDKRVSSFGLPILAILETICLGLIYGFKQLRYDYRMMTGFSLSWYWFIVIAFVGPLAIFVIFLTSLINVDYIYVNGIPIPMWGEVIALTFLFIVLFPIFYGIIYTIVTYFKKYPEIKGKAFLKKLIEPPIYWGPHYKKYWISSSKYRKKLLQYKDDPLFLKYVSEVEDINIIVSIVEKEN 651          
BLAST of slc6a-17 vs. TrEMBL
Match: A0A0H3YK23 (Slc6a-23 OS=Schmidtea mediterranea OX=79327 GN=slc6a-23 PE=2 SV=1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 318/629 (50.56%), Postives = 448/629 (71.22%), Query Frame = 1
Query:   82 LHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENINHYVEIIK 1968
            L   +F K  L  +     D+    + ++  +RGKW +R EF+LSC+GFAVGLGNVWRFPIR YESGGGAFL  Y  LC+ LG PLL +ELGI QFS R PT AFK+VPI YGIGW M+F++  + +YY+ +I+W++ YLF S   ++PW+VC+  FN+  C++S  +   +N +  Y++ST EYWDYYVTGF KYP R  + M+E PG PQWH+ L L+LTW + GL LMFGVKVS K++YFTV++PY  + CLI+LGC+LPG++ GI FYL PDW K+ DPKV+ G +EQL FS +IA GGM+TY+SYN+F +N Y+D+ I++F+D+ TS ++G +VF ILGYMA+++G  I  +I SG  LF+IT+T+A++TLP   FW  + MLMAI LG+DSQFA  E +   + D YPF++ ++  KA+ +W +  + F++G++L SPGG++WF ILD RVS++GL ++A  E I VG+IYGF+Q  YDF +M    + + W I++AF+ P IIF IL+ +   + ++ V  + +P+W E +AF+FL +VLLPI  G++HT+ K+K++Y QL  K F KKL   P YWGPY+ +NWL G +YR KLL   +NP FLKY +  E++   VE+ K
Sbjct:   24 LCTGRFDKRNLRSKSAGTLDEVEVID-KTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPLLLLELGIAQFSGRGPTKAFKMVPILYGIGWCMVFVAISILIYYSAIIAWSYFYLFASLTSVLPWSVCSHDFNTNKCLASLANKSALNSSIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWILCFLLFISGLLLVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAK 651          
BLAST of slc6a-17 vs. TrEMBL
Match: A0A0H3YIU9 (Slc6a-11 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc6a-11 PE=2 SV=1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 307/620 (49.52%), Postives = 438/620 (70.65%), Query Frame = 1
Query:  106 SKLTPEGPHRTDDSSYSEGESVF--LRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENINHYVE 1959
            S  T E      D+S  +   VF  +RG+W +R EF+L+CIG  +G GNVWRFPI+ YE GGG+FL  Y ILC+++G PLL +E+GIGQFS R P+  FKLVPI YG+GWSMI  +  V +YYA +I+W   Y F SF  +MPWTVC  VFNS NC+ +  +    N+T  Y++ST EYWDYYVTGF KYP R  + M+E PG P WH++L L++TW+LTG+++M GV+++ K++YFTV+FPY  +  LI LG SLPGA  G+ FYL P W K+ D  V+   I QL FSS +A GG++TYAS+N+FR+N Y+D+FII+  DF TS L+G ++F ILGYMAE+SGV I K+ITSG  LF++++T+A++TLPG  FW  +FMLMAI LG+D QFA  E ++ G+ DVYP ++ T++ KA+++W +   +FL G+++ +PGGKYWFVIL+ RV  + L  +  +E I++G +YGF++L YDF +MM   +   W ++I+F+CP IIF ILI  +   +++ V G+ IP+WGE +  + + ++++P + G+  T+I Y+ KY +L GK F KKLF  P YWGPY+   W+  ++YR+KLL +KD+P FL+Y +  E+I HY+ 
Sbjct:   44 STFTNEPIGFASDASLIK-RDVFSTIRGRWNNRAEFLLACIGSVIGFGNVWRFPIQVYECGGGSFLITYTILCLLMGVPLLVMEMGIGQFSGRGPSKVFKLVPIMYGLGWSMILTAMFVGMYYAAIIAWCLYYFFASFKKVMPWTVCTHVFNSPNCLGTLNNKTNPNIT-IYVSSTVEYWDYYVTGFIKYPSRKPYLMNEWPGTPMWHLSLCLLITWVLTGMAIMKGVRITGKIMYFTVLFPYFCIIVLIGLGFSLPGAMKGLLFYLTPHWYKIFDFNVLFVAIGQLFFSSGMARGGLMTYASFNDFRDNFYRDSFIIILSDFTTSVLAGFAIFPILGYMAERSGVKIEKLITSGSSLFFVSFTEALSTLPGAQFWTILFMLMAITLGMDCQFALFETVTTGLMDVYPLLQLTRVFKAVVVWIMCFFYFLIGLLIITPGGKYWFVILNGRVMAFALPFILCVETIVIGHLYGFKKLRYDFRMMMGFYLGWYWFVMISFVCPFIIFCILIGGLLKSERVKVYGLLIPVWGEAIGIILIIILIMPTIFGIFETIIHYRKKYKKLHGKIFLKKLFDPPIYWGPYYKHEWMKSQFYRNKLLKYKDDPRFLRYVSAFEDI-HYIS 660          
BLAST of slc6a-17 vs. TrEMBL
Match: A0A0H3YIZ3 (Slc6a-14 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc6a-14 PE=2 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 8.802e-124
Identity = 228/590 (38.64%), Postives = 347/590 (58.81%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCIS-SGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENI 1944
            RGKW S  E++LSC+G+ VGLGNVWRFP + Y+ GGG+FL  Y+  C++ G P+L +E  +GQFSS+    AF++ PIF G+G++++ +  ++   Y+V+I+W  +Y   SF+YI+PW+VC   FN+  C   S  +  + N  S+Y +ST E+W+ YV    +  + TF  + +S G+P     L L     L  + +MFGVKVS KV+Y TVI PY+V+   IVLGCSLPGA  GI FYL P   +++DP   +  +EQL+FS ++  GG++T +SYN F++NI ++ FI++ +DF TS +SG + F +LGYM+ ++G  I ++I +   LF++ + + ++TL   N W+ +FM MA  LG+DS F  LE I   I D++P  R+ K  K +L   +    FL  ++  +PGG  W  ILD     + L VV FLE+ ++ ++YG RQ  +D  +M    + I W+    F  P I  ++ +  I   K +   GV+ P W  I+ +    L L PI    I  V++  IK+P L   +  K  F  P +WGP   R W+   +Y  KL+ +KDN  FL      +NI
Sbjct:   68 RGKWNSELEYLLSCVGYTVGLGNVWRFPGKVYQGGGGSFLLPYIFFCIVFGCPMLMLETALGQFSSKGIIEAFQICPIFSGLGYTIVIVVFLIATSYSVIIAWCVLYFVSSFNYILPWSVCTNKFNTPLCFGVSETNYSKYN--SSYRSSTFEFWNRYVLADERL-DGTFVKVTDSIGFPNVPSLLCLFAVLCLASIIIMFGVKVSGKVVYLTVILPYIVIFQFIVLGCSLPGALNGIKFYLYPRLSRLLDPHTYVLAMEQLMFSLSVGAGGLVTMSSYNKFQQNIQRNVFILMSVDFSTSLISGFATFPVLGYMSYRTGKDIEELIVADSSLFFLIFPEVLSTLTSSNAWSILFMFMAFTLGIDSLFVMLEVIITSISDLFPAFRQ-KNSKIVLTLIVSSSLFLIALIYTTPGGLNWLDILDENCPNFILPVVIFLEVFMLIVVYGHRQFQHDIWLMNGENLGIYWISSYLFFIPLISIVMWVEVIRQTKIVVRHGVDFPRWTYILNWFLNILFLSPIFVKAIKVVLQNIIKHPNLGIIQILKLCFKPPPFWGPRSKRFWIRSVFYSKKLIRYKDNKTFLNSLEKEDNI 653          
BLAST of slc6a-17 vs. Ensembl Cavefish
Match: slc6a14 (solute carrier family 6 member 14 [Source:NCBI gene;Acc:103047067])

HSP 1 Score: 305.064 bits (780), Expect = 3.845e-93
Identity = 188/523 (35.95%), Postives = 287/523 (54.88%), Query Frame = 1
Query:   91 SKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCN------------QVFNSKNCISSGLSVRR-------------MNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXIL--GVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWM 1578
            S   K+ +  + PH   +   +E      RG W+S++E++LS IG+AVGLGNVWRFP   Y+ GGGAFL  YVI+  I G PL F+E   GQF S+ P   +K VPI  G+G +M+ +S+ V +YY V+++++  YLF SF Y +PW+ C+            +  N+ +   S +++ R             + +++   T +E+YWD          +RT  +MDE+ G   WH+ L L+L WI+ G +L  G+K S KV+YFT  FPY V+  L++ G +L GA  GI +Y+          +  +      Q+ FS +IA GG+   ASYN F  N Y+D+ I+   +  TS  +G ++F+ILG+MA   G P+++V  +G GL +I Y DA++ LP    W+ +F  M I LGLDSQFA +E I+  + D YP   K+K  + L+   I  V FL G+   +  G YW  ++D+ V+ + L V   LE+  +  IYG  +   D  +M+     I W+
Sbjct:   20 SDEAKNAVKSQDPHVGTEDENAE------RGNWSSKREYMLSMIGYAVGLGNVWRFPYLAYKHGGGAFLIPYVIMLSIAGLPLFFLESSFGQFCSQGPINVWKAVPILQGVGITMMLVSTFVAIYYNVILAYSIYYLFASFQYPLPWSNCSGWSDMGCNINATEYCNTTSYNGSLVALNRSAGADGNQSCPEELIVSTPLQTISEQYWDVVAL------QRT-SSMDET-GPVVWHLALCLLLGWIMIGAALFKGIKSSGKVVYFTATFPYAVLLILLIRGVTLEGARNGIEYYIGSQSNLTKLSEAEVWKDAATQIFFSLSIAWGGLTALASYNKFHNNCYKDSIIVCVTNCGTSIFAGFAIFSILGHMAHVYGKPVSEVAQAGFGLAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVITTCLQDAYPKFLKSK--RGLITVIICVVLFLLGLPCVTGAGIYWVNLIDTFVAGWILLVAGLLEVFGLSCIYGGNRFIKDIEMMIGNKSAIFWI 526          
BLAST of slc6a-17 vs. Ensembl Cavefish
Match: slc6a7 (sodium-dependent proline transporter-like [Source:NCBI gene;Acc:103039122])

HSP 1 Score: 303.523 bits (776), Expect = 2.489e-92
Identity = 171/460 (37.17%), Postives = 267/460 (58.04%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMAL 1557
            R +W  + EF+LSCIG+ VGLGNVWRFP  CY +GGG FL  Y I+    G PL  +EL +GQ+ +  P T +K  P+  GIG  M+ +S++V +YY V+I+W F YL  SF   +PW+ C+ + N+K C          N T+  ++ +E +W+  V G       +  T   +PG  +W + L L+  W++  L ++ G++ S KV+Y T  FPY+V+  LI+ G +L G+  G+ FYL P W ++ + +V      Q+ +S  I +GG+L+ ASYN F  N+ +DT +I   +  TSF +G ++F+ILG+MA + GVP+ KV  SG GL ++ Y +A+A LPG  FW  +F LM   LG+D+ F  +E I+  + D +P +R     K L +  +    +L G++L + GG YWF ++DS  +++GL ++     + +   YG  Q   D   M+ L
Sbjct:   79 REQWGGKYEFLLSCIGYCVGLGNVWRFPYLCYRNGGGVFLIPYFIMLFFTGMPLFLMELSLGQYGAAGPITVWKCCPLLKGIGIGMLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWS-CDAIANAKLC---------RNNTNGTLSPSEFFWNERVLGV------SHSTGLSNPGPVRWQLALCLLAAWVIIFLCMLKGIRSSGKVVYVTATFPYLVLVVLIIRGATLEGSLQGVAFYLTPVWGRLANAQVWNDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTLVITIGNCATSFFAGFAIFSILGHMAWRKGVPVEKVAISGPGLAFVAYPEALALLPGSVFWAILFFLMLFMLGVDTLFGNMEGITTAVLDEFPQLRSNMKYKTLFLGLLCFGFYLMGLLLVTNGGIYWFTLIDSSSTSFGLIIITLFMCLGISFFYGVNQFCQDIVDMICL 522          
BLAST of slc6a-17 vs. Ensembl Cavefish
Match: slc6a11b (solute carrier family 6 member 11 [Source:NCBI gene;Acc:103035223])

HSP 1 Score: 285.804 bits (730), Expect = 4.094e-86
Identity = 188/519 (36.22%), Postives = 280/519 (53.95%), Query Frame = 1
Query:  106 SKLTPEGPHRTDDSSYSEGESVFL-----------RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAF-KLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCIS-SGLSVRRMNLTSAYITS-TEEYWDYYVTGFFKYPERTFHTMD--ESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDS-RVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMAL-PIDII---WMILIAFIC 1599
             K  P    + DD+  +E  +  L           RG+W ++ EF+LS  G  +GLGNVWRFP  CY++GGGAF   YVI  V  G P+ F+E  +GQF+S    T + K+ P+F GIG++   I + + VYY V++SWA  YL   F   +PW  C   +N++NC+  +  S+   NLT+ Y TS   E+W+           R     D  E  G  +W + L L++ WI+    +  G K + KV+Y T  FPY ++  L++ G +LPGA+ GI FYL PD  ++ DP+V +    Q+ FS  I +G +    SYN++  N Y+D  ++  ++  TSF++G ++F++LG+MA +  VPI  V  SG GL +I Y  A+  +P    W F F +M I LGLDSQF  +E +   + D+YP   +   R+ LLI  +  V +L G+ + + GG Y F + DS   S   L  VA  E I +G +YG  + + +   M+   PI  I   W IL   IC
Sbjct:    4 EKTIPIINGKPDDAMDAEASNTNLVRSNDKKVVNERGQWNNKIEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFVPYVIFFVCCGIPVFFLETALGQFTSEGGITCWRKVCPLFEGIGYATQVIEAHLNVYYVVILSWAIFYLLNCFTTELPWANCGHYWNTENCVDFNNASIE--NLTNPYATSPVMEFWE----------RRVLSISDGIEHVGKLRWELALCLLVAWIICYFCIWKGPKSTGKVVYVTATFPYFMLVILLIRGITLPGAADGIKFYLYPDISRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNSYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQNVPIEAVAESGPGLAFIAYPKAVTMMPWAPLWAFFFFVMLIFLGLDSQFVCVESLVTAVVDMYPKTFRVGYRRELLILGMSVVSYLLGLTMLTEGGMYVFQLFDSYAASGMCLLFVAIFESICIGWVYGSDRFYMNIEDMIGYKPIFFIKWCWKILTPGIC 510          
BLAST of slc6a-17 vs. Ensembl Cavefish
Match: slc6a3 (solute carrier family 6 member 3 [Source:NCBI gene;Acc:103026128])

HSP 1 Score: 284.263 bits (726), Expect = 1.170e-85
Identity = 178/502 (35.46%), Postives = 270/502 (53.78%), Query Frame = 1
Query:  109 KLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMD----ESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICP 1602
            + T      +   ++  GE    R  W  + +F+LS IGFAV L NVWRFP  CY++GGGAFL  Y++  VI G PL ++EL +GQ++       +K+ P+F G+G+++I IS  V  YY V+I+WA  YLF SF   +PW  CN  +NS NC  S L+   +N  S  +T   EY++  V           H  D    +  G P+W +T  L +  ++   SL  GVK S KV++ T   PYVV+T L++ G +LPGA  GI  YL  D+ ++ D +V +    Q+ FS  +  G ++ ++SYN F  N Y+D  I   I+ +TSF SG  +F+ LGYM++K  V ++KV T G GL +I Y +AIATLPG + W  +F +M + LG+DS    +E +  G+ D + F+ +    + L    I+ + FL  +   + GG Y F +LD   +   +     +E I +   YG  +   D   M+     + W +   F+ P
Sbjct:   41 QFTSSALVTSTGQTHPSGEQ---RETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQYNREGAAGVWKICPVFKGVGFTVILISLYVGFYYNVIIAWALFYLFSSFSGELPWVNCNNTWNSANC--SDLNATLLN-DSHKVTPALEYFERGV----------LHMQDSRGIDDLGLPRWQLTCCLAVVIVVLYFSLWKGVKTSGKVVWITATMPYVVLTVLLLRGVTLPGAIDGIKAYLSVDFLRLCDAQVWIEAATQICFSLGVGFGVLIAFSSYNKFSNNCYRDAIITSSINSLTSFFSGFVIFSFLGYMSQKHNVALDKVATDGPGLVFIIYPEAIATLPGSSVWAVIFFIMLLTLGIDSAMGGMESVITGLIDEFKFLHR---HRELFTLFIVVLTFLISLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGIAWFYGVDRFSDDIQEMIGHRPGLYWRLCWKFVSP 523          
BLAST of slc6a-17 vs. Ensembl Cavefish
Match: ENSAMXT00000015774.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:26496274:26511103:1 gene:ENSAMXG00000015324.2 transcript:ENSAMXT00000015774.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 276.944 bits (707), Expect = 3.912e-83
Identity = 180/505 (35.64%), Postives = 279/505 (55.25%), Query Frame = 1
Query:  121 EGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAF-KLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCI-----SSGLSVRRM-NLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILD-SRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALP----IDIIWMILIAFIC 1599
             G +R+ D   S  E +  RG+W+++ EF+LS  G  +GLGNVWRFP  CY++GGGAF   Y+I     G P+ F+E  +GQ++S    T + K+ P+F G+G++   I +++ VYY +V++W   YL  SF   +PW+ CN  +N++ C+     +  +  R M N TS  I    E+W+  V        R    +DE  G   W + L L+L WIL    +  GVK + KV+YFT  FPY+++  L++ G +LPGAS GI FYL PD  ++ DP+V +    Q+ FS  I +G +    SYN +  N Y+D   + F++  TSF++G ++F+ILG+M+ +  V I++V  SG GL +I Y  A++ +P    W   F +M + LGLDSQF  +E +   + D+YP   + K R+ LLI ++    FL G+++ + GG Y F + D    S   L  VA  E + +  IYG  + + +   M+       I   W+ L    C
Sbjct:    5 NGLNRSLDIVPSTEEKMKDRGQWSNKLEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLIFLATCGIPVFFLETALGQYTSEGGITCWRKISPLFEGVGYATQVIVALLNVYYIIVLAWGIFYLAFSFSSNLPWSSCNNTWNTEACMEFQRRNESIDQRHMENATSPVI----EFWERRVL-------RISSGIDEI-GELHWDMVLCLLLAWILCYFCIWKGVKSTGKVVYFTATFPYLMLLILLIRGITLPGASIGIQFYLYPDLGRLADPQVWMDAGTQIFFSYAICLGCLTALGSYNKYNNNCYKDCLALCFLNSGTSFVAGFAIFSILGFMSFEQNVHISEVAESGPGLAFIAYPRAVSMMPFSPLWACFFFIMIVLLGLDSQFVCVESLVTAMVDMYPSTFRRKNRRELLILAVAICSFLLGLIMLTQGGMYVFQLFDYYAASGMCLLFVAIFETVCIAWIYGADRFYDNIEDMIGYRPGPYIKFCWLFLTPATC 497          
BLAST of slc6a-17 vs. Ensembl Sea Lamprey
Match: slc6a1a (solute carrier family 6 member 1a [Source:ZFIN;Acc:ZDB-GENE-060519-23])

HSP 1 Score: 267.7 bits (683), Expect = 5.828e-81
Identity = 166/510 (32.55%), Postives = 274/510 (53.73%), Query Frame = 1
Query:  175 LRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMD---ESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIY-QXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILD-SRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGE 1689
            +RG W  R +F++SC+G+A+GLGNVWRFP  C ++GGGAFL  Y +  V  G PL  +E  +GQ++S      +KL P+F G+G + + IS  + +YY V+ISWA  YL+ SF  ++PW  CN  +N+  C S+   +   NLTS  +    E+W           ER  H +    + PG  +  + ++L ++W++    +  GV  + KV+YF+  FPYV++  L   G +LPGA  GI FY+ PD++++ D  V L    Q+ FS  + +G ++   SYN F  N+Y +D+ I+  I+ +TS  +G  +F+I+G+M+  +  P+ ++  SG GL ++ Y  A+  LP    W+ +F  M + LGLDSQF  +E     + D YP  +  +  K + I  I  + ++ G+   + GG Y F + D    S   L  + F E I +   YG  + + +   M+   +   W I   F  P ++  + + ++     L++     P+WG+
Sbjct:    9 VRGAWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLVFAGIPLFLLETSLGQYTSVGGLGVWKLAPMFKGVGLASVVISFYLNIYYIVIISWAIYYLYNSFTSMLPWQDCNNPWNTDKCFSNYSILDTTNLTSTVV----EFW-----------ERNMHQLSSGLDEPGQVRGPLAITLAISWVMVYFCIWKGVAWTGKVVYFSATFPYVMLFVLFFRGITLPGAKEGILFYITPDFRRLTDSAVWLDAATQIFFSYGLGLGSLVALGSYNPFHNNVYNRDSIIVCCINSVTSVFAGFVIFSIVGFMSHITKKPVKELAASGPGLAFLAYPQAVTQLPISPLWSILFFSMLLMLGLDSQFCTVEGFVTALSDEYP--QYLRGHKEIFIAVICVISYIIGLANITQGGLYVFKMFDYYSASGMSLLFLVFFETIAISWCYGVDRFNDNICEMIGHKVHKWWNICWVFFTPLVVVGVFMFSVVEMTPLTLGSYTYPMWGQ 501          
BLAST of slc6a-17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001684.1 (pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 gene:ENSPMAG00000001516.1 transcript:ENSPMAT00000001684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.534 bits (532), Expect = 1.172e-62
Identity = 108/248 (43.55%), Postives = 157/248 (63.31%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQ-------VFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYL 900
            RG W S+ E++LS IG AVGLGN+WRFP   Y++GGGAFL  Y+I+   +G PL F+E  IGQF+S  P T +K+VP+  G+GW M+  SS++ +YY  +I++   YLF SF   +PW+ C +        F+   C SS       ++ S+  T +E+YW+       KY  R   +MDE+ G   WH+ L+L+L+WI+T  +L+ G+K S KV+YFT IFPYVV+  L++ G +LPGA  GI +Y+
Sbjct:    6 RGNWASKSEYMLSMIGNAVGLGNLWRFPYLAYKNGGGAFLIPYIIMLAFVGLPLFFLECSIGQFASLGPITIWKVVPLLKGLGWMMVITSSLIALYYNSIIAYGLFYLFASFTSELPWSSCKKWWGADENCFDRSVCNSSLAEGNCSSVNSSKQTPSEQYWN-------KYALRRSESMDET-GDVVWHLALTLLLSWIVTCAALVKGIKSSGKVVYFTAIFPYVVLIILLIRGATLPGAILGIEYYI 245          
BLAST of slc6a-17 vs. Ensembl Sea Lamprey
Match: slc6a4b (solute carrier family 6 member 4b [Source:ZFIN;Acc:ZDB-GENE-060314-2])

HSP 1 Score: 211.075 bits (536), Expect = 3.103e-60
Identity = 155/481 (32.22%), Postives = 237/481 (49.27%), Query Frame = 1
Query:  286 GAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFK-LVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMD----------ESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITS-GEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEI 1692
            GAFL  Y ++ V  G PL ++EL +GQF      + ++ + PIF G+G+++  I+  V  YY  +I+WA  YL+ SF   +PWT C+  +N+ NC S             Y  +T   W  +     + P   F+T +             G  +W + L L L + +   SL  GVK S KV++ T  FPYVV+  L++ G +LPGA  G+ FYL P+WKK++  +V +    Q+ FS     G +L  ASYN F  N Y+D  +   ++  TSF+SG  +F +LGYMAE   V +  V    G  L +ITY +AIA + G  FW  +F +M I LGLDS F  LE I   + D YP +     R+   +  ++ + F+  +   + GG Y   +L+   S   +  +  LE I V   YG ++   D   M+       W +    I P  +  I+++ +   K L +   + P W  I
Sbjct:    1 GAFLIPYCLMAVFGGIPLFYMELALGQFHRNGAISIWRRICPIFKGVGFAICIINFYVAFYYNTIIAWALYYLYSSFTSTLPWTKCDNPWNTVNCTS-------------YFDTTGVAWGKHS----RSPAEEFYTRNVLEIQYSKGLGGVGGLRWQLLLCLFLIFTIVYFSLWKGVKTSGKVVWVTATFPYVVLFILLIRGATLPGAWRGVLFYLKPNWKKLLTTEVWVDAAAQIFFSLGPGFGVLLALASYNKFNNNCYRDALVTSSVNCFTSFMSGFVIFTVLGYMAEMRNVEVEDVAKDMGPSLLFITYPEAIANMMGSTFWAILFFMMMITLGLDSTFGGLEAIITAVMDEYPSLFSK--RREYFVLGLVTICFMGALSTLTYGGAYIVKLLEEFGSGCSIIGIVLLEAIAVSWFYGVKRFCADIHSMLGFSPGYFWRLCWVAISPLFLSFIVVSFLTGSKPLKLFDYDFPDWSMI 462          
BLAST of slc6a-17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008631.1 (pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 gene:ENSPMAG00000007785.1 transcript:ENSPMAT00000008631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.836 bits (390), Expect = 2.142e-40
Identity = 138/434 (31.80%), Postives = 227/434 (52.30%), Query Frame = 1
Query:  286 GAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYI-MPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFL--EIIIVGIIYGFRQLHYDFSVMMAL-PIDIIW 1575
            GAFL  Y +  V +G PL F+E+ +GQ + +     +K+VP+F G+G + + +  + ++YY VV++W+  YL  S     +PWT C   + +  C  +  + R  +  S   ++ ++     V  + +   R    M +  G   W + L L+  W+L   S+  G+K S KV+Y T   PYV++  L+V G  LPGA  GI +YL PDW K+  P+V +    Q+ +   +  G +    SYN F  N Y+D+ I+  I+  TSF SG  VF+ LG+MA++ GV I+ V  +G GL ++ Y  AI+ LP    W  +  +M + LG+DS+FA +E    G+ D++P     K R+         V FL  + + + GG Y F + DS  ++ G++++  +  E I V  +YG  +   D + M+   P   +W
Sbjct:    1 GAFLVPYGLTVVCVGIPLFFLEVALGQLTQQGTIGVWKIVPLFTGVGVASMVVVFLSDLYYIVVLAWSLYYLLHSLTTAQLPWTHCQGWWATAACSDTLGTSRAASNASEGASACQDTTSPAVEFWERNVLRVSSGMHDL-GSVNWEMLLCLLAVWLLVYFSVWKGIKFSGKVVYVTGSVPYVLLLVLLVQGVMLPGALDGITYYLQPDWAKLATPQVWVEASTQVFYCYGVGFGVLPALGSYNKFHNNCYRDSIILTIINSATSFFSGFVVFSFLGFMAQEQGVDISHVAETGPGLVFVVYPRAISLLPVPALWATLLFIMLLLLGVDSEFAGMEGFVTGLTDLFPSQLSGKRRREAFTGLCCLVSFLLSVTMVTQGGIYVFQLFDSYAAS-GISMLWLMGWECIAVAWVYGANRFMQDLTAMLGFRPHAWVW 432          
BLAST of slc6a-17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004857.1 (pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 gene:ENSPMAG00000004412.1 transcript:ENSPMAT00000004857.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 2.691e-33
Identity = 118/357 (33.05%), Postives = 180/357 (50.42%), Query Frame = 1
Query:  796 KVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVV--AFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILI-AFICPXXXXXXXXXXXXXYKKLSV-AGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYK-KLFTAPNYWGPYHLR 1851
            +V+YFT  FPY+V+  L + G +LPG+  GI +YL PDW K+  P+V +    Q+ FS  I +G +    SYN F  N Y+DTFI+  ++  TSF +G  VF+ LG+MA + GV I++V  SG GL +I Y  A++ +P    W  +F  M I LGLDSQF  +E    GI D++P       R+ + +       FL  I + + GG Y F + D   S  G+T++  A  E I+V  +Y       D   +M       WM    AF+ P +   I + N+  YK L+   G   P WGE + +          L+ M+   +    +  + +G    + ++ T P  WG +H+ 
Sbjct:    1 QVVYFTATFPYLVLIILFINGMTLPGSYDGIMYYLKPDWSKLGQPQVWIDAGTQIFFSYAIGLGALSALGSYNRFNNNCYRDTFILALVNSGTSFFAGFVVFSTLGFMAAEQGVDISQVAESGPGLAFIAYPKAVSLMPMAPLWAALFFFMLILLGLDSQFVGVEGFVTGISDLFPAALTGGYRREVFVGVCCFTSFLIAISMVTEGGMYVFQLFD-YYSASGMTLLWQAGWECIVVAWVYAGGDRFMDNIALMIGYRPFPWMRWCWAFVTPCVCTGIFLFNLLNYKPLTYNKGYVYPWWGEALGWCMA-------LSSMLCIPVVAIYRLARTKGNLLERWRILTTP-VWGCHHME 348          
BLAST of slc6a-17 vs. Ensembl Nematostella
Match: EDO40151 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6])

HSP 1 Score: 287.73 bits (735), Expect = 8.357e-88
Identity = 181/522 (34.67%), Postives = 290/522 (55.56%), Query Frame = 1
Query:  127 PHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAF-KLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGE 1689
            P + D+    +  +V  R +W  + EF+ +CIGFAVG GN WRFP  C+++GGGAFL  YV+   + G PL F+EL +GQ     P  A+ K+ P+F GIG++ I IS IV +YY V+++W+  +L+ SF   +PW  C+  +N+ +C      V   +  ++ ++S+ E+    V    K          E PG    H+TL L++ WIL   S+  G++ + KV+Y T   PY+++    + G +LPGA  G+ +++ P W ++ DPKV +    Q+L+S  I  G ++ +ASYN  + N++ D  +I  I+  TS  +G  +FAI+GYMA      + +V + G GL +I Y  AI+ LP    W  +F LM IALGLDSQF  +E ++A + + +P  R+    + L++  I  V FL G+   S GG + F + DS      L  V   E++++G IYG R+   + S M+  P+   W+I   +I P ++  I + ++  YK+++   V  P W E
Sbjct:    8 PLKNDEKK--DLVTVESRERWDRKIEFLFACIGFAVGYGNFWRFPYMCFKNGGGAFLIPYVLFLCLGGIPLFFMELSLGQLLQEGPIKAWQKICPLFSGIGFASIVISFIVSIYYNVILAWSLYFLYNSFFADIPWVGCHHSWNTPDCY-----VYNASANASGVSSSREFLVKNVLEITK--------SIEEPGGLSVHLTLCLLVAWILVYFSIWRGIRTTGKVVYVTATLPYIILVIFFIKGVTLPGAIDGVLYFITPQWDRLQDPKVWIDAASQILYSLTIGFGVLIGFASYNPRKNNVFSDALLISVINCATSVFAGFVIFAIVGYMAHVQEKSVPEVASQGPGLVFIVYPAAISQLPFPQIWAVIFFLMLIALGLDSQFGQVEVVAAALIEQWP--RQLHKHRELVVLVICFVMFLLGLSCVSKGGMFVFNLFDSFSCGLSLLFVVCFELLVIGWIYGARRYADNISQMIGRPVLQWWVICWKYISPIMVLGIFVFSLAKYKRITYENVPYPAWAE 512          
BLAST of slc6a-17 vs. Ensembl Nematostella
Match: EDO49218 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4])

HSP 1 Score: 288.115 bits (736), Expect = 1.054e-87
Identity = 179/505 (35.45%), Postives = 281/505 (55.64%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFK-LVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGE 1689
            R KW  + EF L+C+G+AVGLGNVWRFP  C+++GGGAFL  Y+ + +I G PL F+EL +GQF S  P T++  + PI  G+G++M+ +S +  VYY V+I+W   YLF SF   +PW  C+  +N+    +S L+   +     Y + ++E+++ YV        R    +D + G  +W + + L+L W+L    L  G+K S KV+YFT  FPY+V+  L++ G +LPGA  G+ FYL P++ K+ D  V +    Q+ +S  I  G ++   SYN F  N ++D   +  I+  TS  +G+ +F++LG+MAE  G  +++V TSG GL ++ Y + IA +P   FW+  F  M + LGLD+QFA  E ++ G+GD Y  +R  + RK L    +    FL G+ + S  G +   +   +     L  +AF E+I+V   YG  +   D   M    +   W I   +I P +I  I I ++  ++ +S      P W E
Sbjct:   38 REKWGRKVEFFLACVGYAVGLGNVWRFPYLCFKNGGGAFLIPYLCMLLICGMPLFFMELSLGQFVSLGPVTSWAAICPISKGVGFAMLVVSFLCCVYYNVIIAWCLYYLFESFAKDVPWKTCDNWWNTATNCTSNLTDTALK---EYSSPSKEFYENYVL-------RITPDID-TFGVMRWQLVVCLILAWVLVYFCLWKGIKSSGKVVYFTATFPYLVLVILLIRGLTLPGAMKGLSFYLKPNFSKLGDAIVWVDAATQIFYSLGIGFGSLIAMGSYNKFHNNCFRDAMTVSVINCSTSVFAGLVIFSVLGFMAEVLGKEVSEVATSGPGLAFVVYPEGIAQMPISPFWSICFFFMLLTLGLDTQFAMFEAVTTGLGDEY--VRLLRNRKELFTAFLCFCCFLLGLPIVSQSGAFIMNLYVWQAGGVSLVFLAFFEVIVVAWGYGADRFALDIETMTGNKVWPWWPIAWKYITPAVITGIFIFSLVQWQGVSYDDYQYPPWAE 529          
BLAST of slc6a-17 vs. Ensembl Nematostella
Match: EDO32356 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2])

HSP 1 Score: 287.345 bits (734), Expect = 1.924e-87
Identity = 181/516 (35.08%), Postives = 286/516 (55.43%), Query Frame = 1
Query:  166 SVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGF-FKYPERTFHTMDESPGYPQ-----WHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDS-RVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVA-GVNIPLWGE 1689
             V  R  W  + +FIL+ IGF+VGLGN+WRFP  CY++GGG FL  Y+I  ++ G PLL +E+ +GQF S+   TA+K+ P+F GIG++ + I   + +YY V++ WAF Y+F SF  ++PW+ C+  +N++ C      V R  +T+    S  +    ++  F   + +   + ++ S G  Q     W + L L+  WI+  L +  GVK + +V+YFT  FPYV++T + V   +LPGA  GI FYL PDW ++ D  V L    Q+ FS +I +G ++   SYN F+ N Y+D  I   ++  TSF  G  +F++LG+MAEK GVPI +V  SG GL +I Y  A+A +P    W+ +F  M I LGLDS+F  +E     I D++P   +   RK + I +     F  G+++ + GG Y F + D+   S   L  ++  E I +G +YG  + + + + M+   I+    +   F  P     + I ++  Y+ L+       P+WG+
Sbjct:    5 EVVERETWVGKLDFILALIGFSVGLGNIWRFPYLCYKNGGGCFLIPYLICLLLAGVPLLILEVCLGQFMSQGGITAWKICPLFQGIGYASVVIVQYLNIYYIVILGWAFYYMFHSFQAVLPWSHCDNDWNTEKC-----HVGRKMITT--FNSGSKCCQLFIKSFKCLWKDAADYVLNISGGLDQIGTINWQMALCLLFAWIVCYLCVFKGVKSTGRVVYFTATFPYVLLTIICVRAVTLPGAREGIRFYLEPDWSRLQDGSVWLQAATQVFFSYSIGLGTLIALGSYNKFKNNCYRDCIIFACVNSGTSFYGGFVIFSVLGFMAEKQGVPIQEVAESGPGLAFIAYPAAVAEMPISPLWSILFFFMVILLGLDSEFVGVEGFVTAIVDMFPGYLRRGYRKEIFIAACSTFWFFIGLVMVTEGGMYVFQLFDNYSASGICLLWISLFESIGIGWVYGAERFYQNMTDMIGFRINPYLKVCWIFCTPIFCLAVFIFSLVNYEPLTYNLTYKYPVWGD 513          
BLAST of slc6a-17 vs. Ensembl Nematostella
Match: EDO39707 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977])

HSP 1 Score: 281.567 bits (719), Expect = 3.706e-85
Identity = 186/544 (34.19%), Postives = 297/544 (54.60%), Query Frame = 1
Query:  136 TDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFK-LVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESP-GYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIK 1761
            ++DS   + E    R KW+S+ EF+LS +G+ VG GNVWRFP  CY++GG  FL  Y I+ ++ G PL F+EL IGQ+ S      +K + P+  GIG+++  IS +  +YY V+++W F YLF SF  ++PW  C+  +N+K C +       +N T   +           +G F        T D S  G  +W +  + +L+WI+    L  G+K S KV+YFT  FP++V+  L++ G +L G+  G+ +YL PDW+++ DP+V +    Q+ +S  +  G ++T+ SYN F  N+++D  +I   +  TSF +G  VF++LG+MA      + KV TSG GL ++ Y +AI+ +P    W  +F  M I LGLDSQFA +E +   I D YP++R TK RK + +  +     + G+     GG + F ++D +V+   L +VA LEII +G IYG  +   D   M        + I   ++ P     I++ N+  +K +   G   P W E++ ++ +   +L I    IH + K
Sbjct:   25 SEDSPQIDVEEEQTRDKWSSKAEFMLSSLGYCVGFGNVWRFPYLCYKNGGATFLIPYFIMLIVNGIPLFFLELAIGQWFSSGVIGVWKSICPLLKGIGYAICMISYLCCIYYIVILAWTFYYLFMSFQAVVPWKTCDNPWNTKFCRAKRSGDLLLNCTELDLPQNCTAKPTSPSGEFWSNNVLEMTEDISDFGDMRWPLFGTFILSWIVVYFCLFKGIKSSGKVVYFTATFPFIVLFILMIRGATLEGSLDGVIYYLNPDWERLADPQVWIYAATQIYWSLGVGFGALITFGSYNKFNNNVHKDALVISIANCSTSFFAGFVVFSVLGFMALTLDTTVAKVATSGPGLAFVAYPEAISQMPVSTLWAVLFFFMLITLGLDSQFATIEAVITAIVDEYPWVRGTKWRKPVFVLILCISLCILGLPCVFQGGMWIFNLMDYQVAGLSLLIVALLEIITIGWIYGVDRFSDDVEYMTGRRPMRWFRICWKYVSPLCTLAIILANLIQWKGVKYNGKPYPGWAELIGWMLMLSSVLMIPAFAIHEIYK 568          
BLAST of slc6a-17 vs. Ensembl Nematostella
Match: EDO31545 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0])

HSP 1 Score: 271.166 bits (692), Expect = 1.974e-81
Identity = 192/538 (35.69%), Postives = 274/538 (50.93%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAF-KLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNC------------ISSGLSVRRMNLTSAYIT---------STE------------EYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGE 1689
            R  W  + +F+LSCIGFAVGLGNVWRFP  CY +GGGAFL  Y+I+ V+ G P+ F+EL  GQ+ S  P   +  + P+F GIG++ I IS +V VYY V+I+W   +L  SF   + W  C+  +N+ NC            + SG +   +N T A  T         +TE            E+W+ Y+        R    + E+ G  +W + + L+L W+     +  GVK S KV+YFT  FPY+V+  L V G +LPGA  GI FYL P+W ++ DPKV +    Q+ +S  I  G ++   SYN F  NI++D   I  I+  TS  +G  +F+ LG+M+     PI +V  SG GL ++ Y +AIA +P    W  +F  M + LGLDSQF  +E +  GI D YP  RK   RK L I     + FL GI   + GG Y   + D +     L  + F E + +  IYG  +   D   M+       W     F  PT++  I   +I  ++ +S      P W E
Sbjct:    6 RETWGKKADFLLSCIGFAVGLGNVWRFPYLCYANGGGAFLLPYLIMLVLCGMPMFFMELSAGQYFSLGPIGVWGAICPLFRGIGFASIVISFLVCVYYNVIIAWCLYFLAVSFRSEVLWKHCDNWWNTDNCYAGRIPESMSCSLGSGSNNSLVNSTLANATVLAANATNATTECLFPENQVSPSLEFWENYIL-------RLSDGIGEA-GEIRWQILVCLILAWVGVYFCMWKGVKSSGKVVYFTATFPYLVLFILFVRGVTLPGADKGIAFYLKPEWHRLKDPKVWVAAATQIFYSLGIGFGSLVAMGSYNKFHNNIFKDAISISLINCGTSVFAGFVIFSTLGFMSHVLNKPIEEVANSGPGLAFVVYPEAIAQMPISPLWAILFFFMILTLGLDSQFGMMEAVITGIIDEYPVCRK---RKELFIAVACFLCFLLGITNVTQGGAYVLNLFDYQSGGVSLLFLGFFETVCLAWIYGADRFSKDIEDMVGSRPAAWWRFTWKFCAPTVMAGIFFYSIIFWQGVSYGSYKYPQWAE 532          
BLAST of slc6a-17 vs. Ensembl Medaka
Match: slc6a7 (sodium-dependent proline transporter [Source:NCBI gene;Acc:101168229])

HSP 1 Score: 301.212 bits (770), Expect = 1.176e-91
Identity = 183/498 (36.75%), Postives = 282/498 (56.63%), Query Frame = 1
Query:   64 NGFSPALHLSKFGKSKLTP-EGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYI-TSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMM 1551
            NG +PA H +   +   +P  GP   + +          R +W  + EF+LSCIG+ VGLGNVWRFP  CY +GGG FL  Y I+  + G PL  +EL +GQ+ +  P T +K  P+  GIG  M+ +S++V +YY V+I+W F YL  SF   +PW+ C+ + N+  C ++       N +S    T TE +W+  V G         H     PG  +W + L L+  WI+  L ++ G++ S KV+Y T  FPY V+  LI+ G +L G+  GI FYL PDW ++   +V      Q+ +S  I +GG+L+ ASYN F  N+ +DT II   +  TSF +G ++F+ILG+MA + GV + +V  +G GL ++ Y +A+A LPG  FW+ MF LM   LG+D+ F  +E I+  + D +P +R+  L K+L + ++    +L G++L + GG YWF ++DS  +++GL ++     I +   YG  Q   D   M+
Sbjct:   31 NGHNPA-HTASHDQGFDSPGPGPIVANTTP---------REQWGGKYEFLLSCIGYCVGLGNVWRFPYLCYRNGGGVFLIPYFIMLFVAGVPLFLMELSLGQYGAAGPITVWKCCPLLKGIGIGMLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWS-CDAIANAAVCSNNTAG----NSSSGRARTPTEIFWNENVLGLVN--SEGLH----DPGPVRWPLALCLLAAWIIIFLCMLKGIRSSGKVVYVTATFPYFVLIVLIIRGATLEGSLQGIAFYLTPDWARLASAQVWSDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTIIITTGNCCTSFFAGFAIFSILGHMAWRKGVSVGEVADTGPGLAFVAYPEALALLPGSVFWSIMFFLMLFMLGVDTLFGNMEGITTAVLDEFPQLRQNNLHKSLFLGTLCFGFYLMGLLLVTEGGIYWFTLIDSFSTSFGLIIITLFMCIGISFFYGVNQFCQDILDMI 507          
BLAST of slc6a-17 vs. Ensembl Medaka
Match: slc6a5 (solute carrier family 6 member 5 [Source:NCBI gene;Acc:101158004])

HSP 1 Score: 286.96 bits (733), Expect = 4.051e-85
Identity = 195/607 (32.13%), Postives = 318/607 (52.39%), Query Frame = 1
Query:  178 RGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCIS--------------SGLSVRRM----------NLTS----------AYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYP-FMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKY---PQLRGKEFYKKLFTAPN-YWGPYHLRNWLYGKYYRD 1881
            RG W+++ +FILS +G+AVGLGNVWRFP   +++GGGAFL  Y+ +  I G P+  +E+ +GQF+S+ P + +K +P   G G +M+ IS ++ +YY +++ W   YLF S    +PW  C   +N+  C                + +SV+            NLT            Y++ +EEY        FKY         E PG  +W +   L L W++   SL  G+K S KV+YFT  FPYVV+  L++ G +LPGA  GI +++ P W+K+ D KV      Q+ FS + A GG++T +SYN F  N Y+DT I+   +  TS  +G  +F+++G+MA +  VPI KV   G G+ ++ Y +A+  LP   FW  +F LM + LGLD+ FA +E I   + D +P ++RK K    L+        F+ G  + +  G Y   ++D+  ++Y L ++A  E++ +  +YG ++   D  +M+    +  W +  AF+ PTI+  IL  +++ +K ++      P W  I+ +L        ++  +I   I + IK    P   G+    KL  +P   WGP+ +++   G  Y++
Sbjct:  169 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVSLGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWANCRNEWNTVECKDKDMLLLDSCILRDRNAISVKNSTFCLSANAVGNLTKLLNVSIDANKTYVSPSEEY--------FKYNVLHISKGIEYPGDIRWPLAGCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLIILLIRGVTLPGAGDGILYFITPKWEKLSDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIEKVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPVFTLI---CCASFFILGFPMITENGMYMLQLVDTFAASYSLVIIAIFELLGISYLYGLQRFCADIEMMIGFQPNRFWRLCWAFVTPTILTGILGLSLYQWKVMTYEDYTYPTWSMIMGWLM-------VICSVIWIPIMFLIKMYLAPGTIGERL--KLVCSPQPDWGPFLMKH--RGDRYKN 753          
BLAST of slc6a-17 vs. Ensembl Medaka
Match: slc6a11b (solute carrier family 6 member 11 [Source:NCBI gene;Acc:101156159])

HSP 1 Score: 282.722 bits (722), Expect = 4.694e-85
Identity = 184/507 (36.29%), Postives = 274/507 (54.04%), Query Frame = 1
Query:  118 PEGPHRT-DDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAF-KLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCIS----SGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMD--ESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDS-RVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMAL-PIDII---WMILIAFIC 1599
            PEG   + D+  Y+E      RG+W ++ EF LS  G  +GLGNVWRFP  CY++GGGAF   YVI  V  G P+ F+E  +GQF++    T + K+ P+F GIG++   I + + VYY V+++WA  YLF  F   +PW  C   +N++NCI     +  ++   N TS  I    E+W+           R     D  E  G  +W + + L L W +    +  G K + KV+Y T  FPY ++  L++ G +LPGA  GI FYL PD  ++ DP+V +    Q+ FS  I +G +    SYN++  N Y+D  ++  ++  TSF++G ++F++LG+MA +  VPI  V  SG GL +I Y  A+  +P    W  +F +M I LGLDSQF  +E +   + D+YP   +   R+ LLI  +  V F  G+++C  GG Y F + D+   S   L  VA  E I +G +YG  + + +   M+   PI  I   WMIL   IC
Sbjct:   20 PEGSSSSLDNREYNE------RGQWNNKIEFFLSVAGEIIGLGNVWRFPYLCYKNGGGAFFVPYVIFFVCCGIPVFFLETALGQFTTEGGITCWRKVCPLFEGIGYATQVIEAHLNVYYIVILAWAIFYLFNCFTTELPWAGCGHYWNTENCIDYYGENATNITNPNATSPVI----EFWE----------RRVLKISDGIEHMGGMRWELAMCLALAWFICYFCIWKGPKSTGKVVYVTATFPYFMLLILLIRGVTLPGAYDGIKFYLYPDISRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNSYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQNVPIEAVAESGPGLAFIAYPKAVTMMPLSPLWACLFFMMLIFLGLDSQFVCVESLVTAVVDMYPETFRRGYRRELLILGMSVVSFFIGLIMCMEGGMYVFQLFDAYAASGMCLLFVAIFESICIGWVYGSDRFYLNIEDMIGYKPIFFIKWCWMILTPGIC 506          
BLAST of slc6a-17 vs. Ensembl Medaka
Match: slc6a2 (solute carrier family 6 member 2 [Source:NCBI gene;Acc:101172721])

HSP 1 Score: 281.952 bits (720), Expect = 1.067e-84
Identity = 170/498 (34.14%), Postives = 262/498 (52.61%), Query Frame = 1
Query:  124 GPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESP-----GYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICP 1602
            GPH T             R  W  + +F+LS IGFAV L NVWRFP  CY++GGGAFL  Y++  VI G PL ++EL +GQ++     T +K+ P+F G+G+++I I+  V  YY V+I+W+  YL+ S    +PW  C   +NS NC          ++ +++      Y +   T   +Y ER    + ES      G P+  +TL L++   +   SL  GVK S KV+Y T   PYVV+  L++ G +LPGA  GI  YL     ++ + +V +    Q+ +S     G ++ ++SYN F  N Y+D  +   ++ ITSF+SG ++F++LGYMA+K  + I  V T G GL +I Y +AI+TLPG  FW  +F +M + LG+DS    +E +  G+ D + F+++   RK     +  G  FL  ++  + GG Y   +LD   +   +     +E I V   YG  +   D   MM     + W +   F+ P
Sbjct:   54 GPHGTSTD--------IERETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYILFLVIAGMPLFYMELALGQYNREGAATVWKICPVFKGVGYAVIVIALYVGFYYNVIIAWSLYYLYSSMTAELPWLKCGHSWNSINCTDP------QHINASFFDKNTSYANNKFTPASEYYERGVLHLHESKGIEDLGLPRLELTLCLVVVVFILYFSLWKGVKSSGKVVYITATMPYVVLFVLLIRGITLPGALNGIKAYLNFSLSELNNLQVWIDAATQIFYSLGAGFGVLIAFSSYNKFDNNCYRDAILTSAVNCITSFVSGFAIFSVLGYMAQKYNMDIKAVATDGPGLVFIIYPEAISTLPGSTFWAIVFFIMLLTLGIDSSMGGMEAVITGLSDDFKFLKRN--RKLFTFATAFGT-FLMALICVTNGGIYVLTLLDKYAAGTSILFAVLIEAIGVSWFYGVDRFSEDIEQMMGFKPGLYWRLCWKFVSP 534          
BLAST of slc6a-17 vs. Ensembl Medaka
Match: slc6a2 (solute carrier family 6 member 2 [Source:NCBI gene;Acc:101172721])

HSP 1 Score: 281.952 bits (720), Expect = 1.067e-84
Identity = 170/498 (34.14%), Postives = 262/498 (52.61%), Query Frame = 1
Query:  124 GPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESP-----GYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICP 1602
            GPH T             R  W  + +F+LS IGFAV L NVWRFP  CY++GGGAFL  Y++  VI G PL ++EL +GQ++     T +K+ P+F G+G+++I I+  V  YY V+I+W+  YL+ S    +PW  C   +NS NC          ++ +++      Y +   T   +Y ER    + ES      G P+  +TL L++   +   SL  GVK S KV+Y T   PYVV+  L++ G +LPGA  GI  YL     ++ + +V +    Q+ +S     G ++ ++SYN F  N Y+D  +   ++ ITSF+SG ++F++LGYMA+K  + I  V T G GL +I Y +AI+TLPG  FW  +F +M + LG+DS    +E +  G+ D + F+++   RK     +  G  FL  ++  + GG Y   +LD   +   +     +E I V   YG  +   D   MM     + W +   F+ P
Sbjct:   54 GPHGTSTD--------IERETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYILFLVIAGMPLFYMELALGQYNREGAATVWKICPVFKGVGYAVIVIALYVGFYYNVIIAWSLYYLYSSMTAELPWLKCGHSWNSINCTDP------QHINASFFDKNTSYANNKFTPASEYYERGVLHLHESKGIEDLGLPRLELTLCLVVVVFILYFSLWKGVKSSGKVVYITATMPYVVLFVLLIRGITLPGALNGIKAYLNFSLSELNNLQVWIDAATQIFYSLGAGFGVLIAFSSYNKFDNNCYRDAILTSAVNCITSFVSGFAIFSVLGYMAQKYNMDIKAVATDGPGLVFIIYPEAISTLPGSTFWAIVFFIMLLTLGIDSSMGGMEAVITGLSDDFKFLKRN--RKLFTFATAFGT-FLMALICVTNGGIYVLTLLDKYAAGTSILFAVLIEAIGVSWFYGVDRFSEDIEQMMGFKPGLYWRLCWKFVSP 534          
BLAST of slc6a-17 vs. Planmine SMEST
Match: SMESG000054904.1 (SMESG000054904.1)

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 327/632 (51.74%), Postives = 455/632 (71.99%), Query Frame = 1
Query:   82 LHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENINHYVEIIKKSH 1977
            L +SKF +  L      R+++      +   LRG+W +R EF+LSCIGFAVGLGNVWRFPI+ YE+GGGAFL  Y I+C+ILG PLL +ELG+GQF+ R PT AFK+VPI YGIGWSM+ IS I+E+YYA +I+ ++ YLFGS + +MPWTVCN  FNSK C+ S      +N+ S Y++S+ EYWDYYVTGF KYPERT +T++E PG PQWH+TL L+ TWI  G +LM G+KVS K++YF+V++PY  +  +  +  SLPGA  GI FYL P+WKK+ DP V+   IEQL FS +IAMGGM+TYASYN+FR+N Y+D  II+ ID+ TS L+G+++F +LGY+++++G  I KVI+SG  LF+IT T+A+AT+PG   W  + M+MAI+LGLDSQ A  E +S GI D  P ++  K  K +++W++  + FL G++L +PGGKYWF ILD RVS++GL ++A LE I +G+IYGF+QL YD+ +M    +   W I+IAF+ P  IF+I +T++     + V G+ IP+WGE++A  FL +VL PI  G+I+T++ Y  KYP+++GK F KKL   P YWGP++ + W+    YR KLL +KD+P+FLKY +  E+IN  V I++K +
Sbjct:   21 LMISKFNEKSLRSLSALRSEEDYIEIHDVTALRGRWNTRFEFLLSCIGFAVGLGNVWRFPIKVYENGGGAFLITYTIICIILGVPLLMLELGLGQFTGRGPTKAFKVVPIMYGIGWSMVMISLIIEIYYAPIIAISYFYLFGSLNKVMPWTVCNHEFNSKKCLGSFQENMDLNI-SDYVSSSSEYWDYYVTGFVKYPERTIYTLNEFPGPPQWHLTLCLLFTWITGGFALMNGIKVSGKIMYFSVLYPYFALISIFCVASSLPGAMNGIKFYLTPNWKKLYDPTVLRVAIEQLFFSCSIAMGGMITYASYNDFRDNFYRDAIIIIIIDYFTSVLAGLAIFPVLGYLSQRTGAKIEKVISSGSSLFFITLTEALATIPGSQLWTILLMVMAISLGLDSQIAMFETVSTGIMDAIPILQTKKEYKFMMVWALCSLFFLCGLLLITPGGKYWFDILDKRVSSFGLPILAILETICLGLIYGFKQLRYDYRMMTGFSLSWYWFIVIAFVGPLAIFVIFLTSLINVDYIYVNGIPIPMWGEVIALTFLFIVLFPIFYGIIYTIVTYFKKYPEIKGKAFLKKLIEPPIYWGPHYKKYWISSSKYRKKLLQYKDDPLFLKYVSEVEDINIIVSIVEKEN 651          
BLAST of slc6a-17 vs. Planmine SMEST
Match: SMESG000054935.1 (SMESG000054935.1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 300/595 (50.42%), Postives = 425/595 (71.43%), Query Frame = 1
Query:  175 LRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENINHYVE 1959
            +RG+W +R EF+L+CIG  +G GNVWRFPI+ YE GGG+FL  Y ILC+++G PLL +E+GIGQFS R P+  FKLVPI YG+GWSMI  S  + +YYA +ISW   Y F SF  +MPWTVC  VFNS NC+ +  +    N+T  Y++ST EYWDYYVTGF KYP R  + M+E PG P WH++L L++TW+LTG+++M GV+++ K++YFTV+FPY  +  LI LG SLPGA  G+ FYL P W K+ D  V+   I QL FSS +A GG++TYAS+N+FR+N Y+D+FII+  DF TS L+G +VF ILGYMAE+SGV I K+ITSG  LF++++T+A++TLPG  FW  +FMLMAI LG+D QFA  E ++ G+ DVYP ++ T++ KA+++W +   +FL G+ + +PGGKYWFVIL+ RV  + L  +  +E I++G +YGF++L YDF +MM   +   W ++I+F+CP IIF ILI  +   +++ V    IP+WGE +  + + ++++P + G+  T+  Y+ KY +L GK F KKLF  P YWGPY+   W+  ++YR+KLL +KD+P FL+Y +  E+I HY+ 
Sbjct:   69 IRGRWNNRAEFLLACIGSVIGYGNVWRFPIQVYECGGGSFLITYTILCLLMGVPLLVMEMGIGQFSGRGPSKVFKLVPIMYGLGWSMILTSMFIGIYYAPIISWCLYYFFASFKKVMPWTVCTHVFNSLNCLGTLDNKTNPNIT-IYVSSTVEYWDYYVTGFIKYPSRKPYLMNELPGTPMWHLSLCLLITWVLTGMAIMKGVRITGKIMYFTVLFPYFCIIVLIGLGFSLPGAMKGLLFYLTPHWYKIFDLNVLFVAIGQLFFSSGMATGGLMTYASFNDFRDNFYRDSFIIILSDFTTSVLAGFAVFPILGYMAERSGVKIEKLITSGSSLFFVSFTEALSTLPGAQFWTILFMLMAITLGMDCQFACFETVTTGLMDVYPLLQLTRVFKAVVVWIMCFFYFLIGLFIITPGGKYWFVILNGRVMAFTLPFILCVETIVIGHLYGFKKLRYDFRMMMGFYLGWYWFVMISFVCPFIIFCILIGGLLKSERVKVHKQLIPVWGEAIGIILIIILIMPTIFGIFETIFHYRKKYKKLHGKIFLKKLFDPPIYWGPYYKHEWMKSQFYRNKLLKYKDDPRFLRYVSAFEDI-HYLS 661          
BLAST of slc6a-17 vs. Planmine SMEST
Match: SMESG000054919.1 (SMESG000054919.1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 301/595 (50.59%), Postives = 429/595 (72.10%), Query Frame = 1
Query:  175 LRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENINHYVE 1959
            +RG+W +R EF+L+CIG  +G GNVWRFPI+ YE GGG+FL  Y ILC+++G PLL +E+GIGQFS R P+  FKLVPI YG+GWSMI  +  V +YYA +I+W   Y F SF  +MPWTVC  VFNS NC+ +  +    N+T  Y++ST EYWDYYVTGF KYP R  + M+E PG P WH++L L++ W++TGLS+M GVK+S K++YFTV+FPY  +  LI LG +LPGA  G+ FYL P W K+ D  V+   I QLLFS+ +A+GG++TYAS+N+FR+N Y+D+FII+  DF TS L+G ++F ILGYMAE+SGV I K+ITSG  LF++++T+A++TLPG  FW  +FMLMAI LG+D QFA  E ++ G+ DVYP ++ T++ KA+++W +   +FL G+ + +PGGKYWFVIL+ RV  + L  +  +E I++G +YGF++L YDF +MM   +   W ++I+F+CP IIF ILI  +   +++ V G+ IP+WGE +  + + ++++P + G+  T+I Y+ KY +L GK F KKLF  P YWGPY+   W+  ++YR+KLL +KD+P FL+Y +  E+I HY+ 
Sbjct:   71 IRGRWNNRAEFLLACIGSVIGFGNVWRFPIQVYECGGGSFLITYTILCLLMGVPLLVMEMGIGQFSGRGPSKVFKLVPIMYGLGWSMILTAMFVGMYYAAIIAWCLYYFFASFKKVMPWTVCTHVFNSPNCLGTLNNKTNPNIT-IYVSSTVEYWDYYVTGFIKYPSRKPYLMNEWPGTPMWHLSLCLLILWLITGLSIMNGVKISGKIMYFTVLFPYFGLILLISLGFTLPGAMKGLLFYLTPHWYKIFDFNVLYLAIGQLLFSTGMALGGLVTYASFNDFRDNFYRDSFIIILSDFTTSVLAGFAIFPILGYMAERSGVKIEKLITSGSSLFFVSFTEALSTLPGAQFWTILFMLMAITLGMDCQFALFETVTTGLMDVYPLLQLTRVFKAVVVWIMCFFYFLIGLFIITPGGKYWFVILNGRVMAFALPFILCVETIVIGHLYGFKKLRYDFRMMMGFYLGWYWFVMISFVCPFIIFCILIGGLLKSERVKVYGLLIPVWGEAIGIILIIILIMPTIFGIFETIIHYRKKYKKLHGKIFLKKLFDPPIYWGPYYKHEWMKSQFYRNKLLKYKDDPRFLRYVSAFEDI-HYIS 663          
BLAST of slc6a-17 vs. Planmine SMEST
Match: SMESG000054909.1 (SMESG000054909.1)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 286/641 (44.62%), Postives = 429/641 (66.93%), Query Frame = 1
Query:   34 NSEEMDIKNVNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLXXXXXXXXXXXXILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQXXXXXXXXXXXXXXLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPXXXXXXXXXXXXXYKKLSVAGVNIPLWGEIXXXXXXXXXXXPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENINHYV 1956
            N+E     N +     +  +KF      P G    D           +RG+W +R EF++SC+GF VG+GNVWRFP R YE+GGG FL +Y I+C+I GAPLL +ELG+GQFS  SP   FKLVP+  G+GWSMI +S  +++YYA ++S+ + Y FGSF  +MPWTVC+  FNS  C+ +       N+T  +++ST EYWDYYVTGF KYP R  + ++E PG P WH+T+ L++ W  TG  +M G++VS K++YFTVI+PY  +  +  LGC+LPGA  GI FY+VPD+K    P +    +EQ+ +S  IAMGG++ +ASYNNFR+N ++D+ +++ +D++TS  +G ++F ILGYM+++ GV I+K++TSG GLF+IT T+A+ATLP   FW  M MLM I+LGLDSQF   ECI+  I D+ P + +TK+ KA+++W +  + FL+G++  +PGG+YWF ILD RV+++GL ++A +E  ++G +YG++QL YDF V+    ++    I ++++CP  + +I+  + + ++++ V    IP+WGEI+A + L  V  PI+   I T+  Y  +Y  + G  F KKLF  P YWGPY+ ++W++ ++YR+KLLA KD+  FL Y +  E+IN  V
Sbjct:   28 NTESESDANCSTCCDIMLKNKFAD----PSGDTEWDMMLRERDLYSKIRGRWNNRIEFLMSCVGFVVGIGNVWRFPARVYENGGGTFLIVYTIMCIIFGAPLLIMELGLGQFSGFSPPKLFKLVPVMSGLGWSMIVMSMFIDIYYAAIVSYGYFYFFGSFRRVMPWTVCSHEFNSNRCLGTSDDKASFNITE-FVSSTSEYWDYYVTGFIKYPSRQPYKLNEFPGSPIWHLTICLVIAWFTTGFIVMRGIRVSGKIVYFTVIYPYFALAAIFFLGCTLPGAMDGISFYVVPDFKFFARPALYRNALEQIFYSIGIAMGGLICFASYNNFRDNFFRDSILLILVDYLTSIFAGFAIFPILGYMSQRVGVRIDKLLTSGVGLFFITLTEALATLPAAQFWTLMLMLMLISLGLDSQFGIFECIATSIMDINPVLHETKVFKAVIVWILCFIFFLSGLLFVTPGGRYWFEILDKRVTSFGLPILALIETTLIGFVYGYKQLRYDFKVITGTLLNWSPFIFLSYVCPIGMVMIIGASFYKFERVKVNNEPIPIWGEIIALIVLITVFTPIIISAIITIYNYNHRYKDIHGWSFVKKLFEPPVYWGPYYKKDWIHSRFYRNKLLANKDDKRFLLYLSPYEDINDIV 663          
BLAST of slc6a-17 vs. Planmine SMEST
Match: SMESG000054997.1 (SMESG000054997.1)

HSP 1 Score: 512.301 bits (1318), Expect = 7.555e-179
Identity = 248/248 (100.00%), Postives = 248/248 (100.00%), Query Frame = 1
Query:   46 MDIKNVNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKV 789
            MDIKNVNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKV
Sbjct:    1 MDIKNVNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKV 248          
The following BLAST results are available for this feature:
BLAST of slc6a-17 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC6A73.392e-9737.66solute carrier family 6 member 7 [Source:HGNC Symb... [more]
SLC6A74.415e-9735.73solute carrier family 6 member 7 [Source:HGNC Symb... [more]
SLC6A53.056e-9233.21solute carrier family 6 member 5 [Source:HGNC Symb... [more]
SLC6A27.239e-8935.36solute carrier family 6 member 2 [Source:HGNC Symb... [more]
SLC6A28.291e-8935.36solute carrier family 6 member 2 [Source:HGNC Symb... [more]
back to top
BLAST of slc6a-17 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dat-15.257e-8632.65Sodium-dependent dopamine transporter [Source:Uni... [more]
snf-119.010e-8032.13Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43][more]
snf-34.171e-7330.71Sodium- and chloride-dependent betaine transporter... [more]
mod-58.761e-6232.59Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7][more]
snf-23.762e-5728.74Transporter [Source:UniProtKB/TrEMBL;Acc:P90890][more]
back to top
BLAST of slc6a-17 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DAT1.358e-9433.74gene:FBgn0034136 transcript:FBtr0087125[more]
DAT1.824e-9433.74gene:FBgn0034136 transcript:FBtr0330002[more]
Gat9.159e-8535.94gene:FBgn0039915 transcript:FBtr0089972[more]
GlyT3.444e-8435.74gene:FBgn0034911 transcript:FBtr0301162[more]
Ntl2.739e-8135.62gene:FBgn0267326 transcript:FBtr0079478[more]
back to top
BLAST of slc6a-17 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a141.466e-9534.47solute carrier family 6 member 14 [Source:ZFIN;Acc... [more]
slc6a74.697e-9037.91solute carrier family 6 member 7 [Source:ZFIN;Acc:... [more]
slc6a51.046e-8831.60solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a51.269e-8831.60solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a51.309e-8831.60solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc6a-17 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4c6.624e-9536.52leucine rich repeat containing 4C [Source:Xenbase;... [more]
lrrc4c8.906e-9536.52leucine rich repeat containing 4C [Source:Xenbase;... [more]
lrrc4c9.465e-9536.52leucine rich repeat containing 4C [Source:Xenbase;... [more]
lrrc4c6.248e-9338.74leucine rich repeat containing 4C [Source:Xenbase;... [more]
lrrc4c1.525e-9237.30leucine rich repeat containing 4C [Source:Xenbase;... [more]
back to top
BLAST of slc6a-17 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc6a73.252e-9836.93solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a53.487e-9133.03solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a53.487e-9133.03solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a53.487e-9133.03solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a21.349e-8934.82solute carrier family 6 (neurotransmitter transpor... [more]
back to top
BLAST of slc6a-17 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PGE7|SC6A7_MOUSE2.275e-9736.93Sodium-dependent proline transporter OS=Mus muscul... [more]
sp|P28573|SC6A7_RAT8.361e-9737.66Sodium-dependent proline transporter OS=Rattus nor... [more]
sp|Q99884|SC6A7_HUMAN1.629e-9637.66Sodium-dependent proline transporter OS=Homo sapie... [more]
sp|Q7K4Y6|DAT_DROME1.361e-9333.74Sodium-dependent dopamine transporter OS=Drosophil... [more]
sp|Q9Y345|SC6A5_HUMAN1.468e-9133.21Sodium- and chloride-dependent glycine transporter... [more]
back to top
BLAST of slc6a-17 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF560.000e+0100.00Slc6a-17 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YEX60.000e+051.74Slc6a-10 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A0H3YK230.000e+050.56Slc6a-23 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YIU90.000e+049.52Slc6a-11 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A0H3YIZ38.802e-12438.64Slc6a-14 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
back to top
BLAST of slc6a-17 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a143.845e-9335.95solute carrier family 6 member 14 [Source:NCBI gen... [more]
slc6a72.489e-9237.17sodium-dependent proline transporter-like [Source:... [more]
slc6a11b4.094e-8636.22solute carrier family 6 member 11 [Source:NCBI gen... [more]
slc6a31.170e-8535.46solute carrier family 6 member 3 [Source:NCBI gene... [more]
ENSAMXT00000015774.23.912e-8335.64pep primary_assembly:Astyanax_mexicanus-2.0:8:2649... [more]
back to top
BLAST of slc6a-17 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a1a5.828e-8132.55solute carrier family 6 member 1a [Source:ZFIN;Acc... [more]
ENSPMAT00000001684.11.172e-6243.55pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 ge... [more]
slc6a4b3.103e-6032.22solute carrier family 6 member 4b [Source:ZFIN;Acc... [more]
ENSPMAT00000008631.12.142e-4031.80pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 ... [more]
ENSPMAT00000004857.12.691e-3333.05pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 ... [more]
back to top
BLAST of slc6a-17 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc6a-17 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401518.357e-8834.67Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6][more]
EDO492181.054e-8735.45Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4][more]
EDO323561.924e-8735.08Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2][more]
EDO397073.706e-8534.19Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977][more]
EDO315451.974e-8135.69Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0][more]
back to top
BLAST of slc6a-17 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a71.176e-9136.75sodium-dependent proline transporter [Source:NCBI ... [more]
slc6a54.051e-8532.13solute carrier family 6 member 5 [Source:NCBI gene... [more]
slc6a11b4.694e-8536.29solute carrier family 6 member 11 [Source:NCBI gen... [more]
slc6a21.067e-8434.14solute carrier family 6 member 2 [Source:NCBI gene... [more]
slc6a21.067e-8434.14solute carrier family 6 member 2 [Source:NCBI gene... [more]
back to top
BLAST of slc6a-17 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054904.10.000e+051.74SMESG000054904.1[more]
SMESG000054935.10.000e+050.42SMESG000054935.1[more]
SMESG000054919.10.000e+050.59SMESG000054919.1[more]
SMESG000054909.10.000e+044.62SMESG000054909.1[more]
SMESG000054997.17.555e-179100.00SMESG000054997.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007332
GenBankAKN21437.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007332 ID=SMED30007332|Name=slc6a-17|organism=Schmidtea mediterranea sexual|type=transcript|length=2294bp
TTACTATTATATTTATGAAAGAAATGAAAGTTAAATTCAGAAGAAATGGA
TATTAAAAATGTAAATGGGTTTTCTCCCGCACTTCATTTATCAAAATTTG
GTAAATCCAAACTGACTCCCGAAGGCCCTCATAGAACTGATGATAGCAGT
TATTCTGAAGGTGAGTCCGTTTTTTTAAGAGGCAAGTGGACAAGTAGAAA
GGAATTCATATTATCTTGTATTGGCTTCGCTGTTGGCTTGGGTAATGTTT
GGAGGTTCCCAATTCGTTGCTATGAAAGCGGTGGTGGAGCCTTTCTTTTC
CTCTATGTCATACTATGCGTAATACTGGGGGCACCTCTATTATTTGTGGA
ATTAGGTATTGGTCAGTTTAGTAGCCGAAGTCCAACGACAGCATTTAAAC
TTGTTCCTATATTTTATGGCATCGGGTGGTCCATGATTTTCATTTCTTCA
ATTGTAGAAGTTTACTATGCAGTCGTTATTTCATGGGCTTTTATTTATTT
ATTTGGTTCATTTCACTATATCATGCCATGGACAGTTTGCAATCAAGTAT
TCAACTCAAAAAATTGTATTTCGTCAGGATTGAGTGTTCGTAGAATGAAT
TTAACAAGCGCATATATTACTTCTACTGAAGAATATTGGGATTATTATGT
AACAGGATTTTTCAAGTACCCAGAACGAACATTTCATACAATGGATGAAA
GTCCCGGTTATCCACAGTGGCATGTAACATTGAGTCTGATGTTGACGTGG
ATTTTAACAGGTCTATCTTTAATGTTCGGAGTAAAGGTAAGCAGTAAAGT
TCTGTATTTTACAGTAATATTTCCTTATGTTGTGATGACCTGTTTGATAG
TTCTTGGATGTTCTCTTCCAGGTGCCTCCACCGGAATATATTTTTATTTA
GTCCCTGACTGGAAAAAAGTTGTTGATCCGAAGGTTATTTTAGGTGTTAT
AGAGCAGTTATTATTTTCATCGAATATAGCAATGGGGGGCATGTTGACCT
ATGCAAGCTATAATAATTTCAGGGAAAATATCTATCAAGATACATTCATA
ATTGTTTTCATTGACTTTATCACATCGTTTCTTTCAGGAATCTCAGTTTT
TGCCATACTAGGTTATATGGCTGAAAAGTCAGGAGTTCCAATAAACAAAG
TGATAACCTCGGGTGAAGGGTTATTTTACATAACTTATACAGATGCTATT
GCAACATTGCCGGGCTGTAACTTTTGGAATTTCATGTTTATGCTTATGGC
AATTGCTTTAGGATTGGATAGTCAGTTTGCTCCTTTAGAATGCATTTCAG
CGGGTATTGGTGATGTCTATCCGTTTATGCGAAAAACTAAATTAAGAAAA
GCTTTACTCATTTGGAGTATTATAGGAGTCCATTTTTTAGCCGGTATTAT
GTTATGCTCTCCTGGCGGGAAATATTGGTTTGTGATATTAGATTCAAGGG
TGTCCACATATGGTCTTACTGTTGTTGCGTTTCTGGAAATTATCATAGTA
GGCATCATATACGGCTTTCGCCAACTACATTATGATTTTTCCGTCATGAT
GGCGTTGCCAATCGACATTATATGGATGATTTTAATAGCCTTCATTTGTC
CAACCATCATATTTCTGATTTTGATCACCAATATCTTTACCTATAAAAAA
TTATCAGTTGCTGGAGTGAATATTCCGCTTTGGGGAGAAATAGTTGCTTT
TCTGTTCTTGGCTCTAGTTCTTTTGCCAATACTTACTGGAATGATTCACA
CTGTTATTAAATATAAAATCAAATATCCACAACTCCGCGGTAAAGAATTC
TATAAAAAGTTGTTTACCGCCCCAAATTACTGGGGTCCTTATCATTTGAG
AAATTGGCTGTATGGAAAGTATTATCGTGACAAATTGTTGGCCTTCAAAG
ACAATCCAGTGTTTTTAAAATATAGAGCGGGAAGTGAAAACATTAACCAC
TATGTTGAAATTATTAAAAAATCACACAAATGAACCGCAATGAAGATTAT
TATAAAGATGTGTTTGATTTATTTATATATGATATCCTAATCTTATCTTT
TCATATTCCTGAAGGTGCCAATTGTGTTCCAGACCTATCTCTATGCCCAG
TCATTTGATTAATGCTTATTGTCCATGGGGTAATTTTGAACCCAAATTTA
CAATTTTTATTATGATTGACTTTCTTGATTATTAATAGTGATCATTTCTC
CTAATCTCCTGAGTTTACTATTTGTGTATCATAGCTGTTAACCTCTGTCA
TTTTTGGTGTGAATTTTGATTATTTTATAGAATGCATTGTATCG
back to top

protein sequence of SMED30007332-orf-1

>SMED30007332-orf-1 ID=SMED30007332-orf-1|Name=SMED30007332-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=646bp
MDIKNVNGFSPALHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTS
RKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLF
VELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFI
YLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDY
YVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSS
KVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLVPDWKKVVDPKVILG
VIEQLLFSSNIAMGGMLTYASYNNFRENIYQDTFIIVFIDFITSFLSGIS
VFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFML
MAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAG
IMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSV
MMALPIDIIWMILIAFICPTIIFLILITNIFTYKKLSVAGVNIPLWGEIV
AFLFLALVLLPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYH
LRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENINHYVEIIKKSHK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015293symporter activity
GO:0005328neurotransmitter:sodium symporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006836neurotransmitter transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000087proximal tubule
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR037272SNS_sf
IPR000175Na/ntran_symport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000175Sodium:neurotransmitter symporterPRINTSPR00176NANEUSMPORTcoord: 334..354
score: 34.74
coord: 388..407
score: 40.57
coord: 471..491
score: 29.59
coord: 125..151
score: 37.7
coord: 53..74
score: 66.84
coord: 82..101
score: 38.93
coord: 252..269
score: 45.45
IPR000175Sodium:neurotransmitter symporterPFAMPF00209SNFcoord: 45..570
e-value: 4.6E-141
score: 471.1
IPR000175Sodium:neurotransmitter symporterPANTHERPTHR11616SODIUM/CHLORIDE DEPENDENT TRANSPORTERcoord: 33..578
IPR000175Sodium:neurotransmitter symporterPROSITEPS50267NA_NEUROTRAN_SYMP_3coord: 44..575
score: 76.753
NoneNo IPR availablePANTHERPTHR11616:SF231SODIUM-DEPENDENT PROLINE TRANSPORTERcoord: 33..578
NoneNo IPR availableTMHMMTMhelixcoord: 508..530
NoneNo IPR availableTMHMMTMhelixcoord: 126..148
NoneNo IPR availableTMHMMTMhelixcoord: 545..567
NoneNo IPR availableTMHMMTMhelixcoord: 334..356
NoneNo IPR availableTMHMMTMhelixcoord: 469..491
NoneNo IPR availableTMHMMTMhelixcoord: 437..454
NoneNo IPR availableTMHMMTMhelixcoord: 54..73
NoneNo IPR availableTMHMMTMhelixcoord: 83..105
NoneNo IPR availableTMHMMTMhelixcoord: 224..246
NoneNo IPR availableTMHMMTMhelixcoord: 385..407
NoneNo IPR availableTMHMMTMhelixcoord: 253..285
NoneNo IPR availableTMHMMTMhelixcoord: 300..322
IPR037272Sodium:neurotransmitter symporter superfamilySUPERFAMILYSSF161070SNF-likecoord: 45..570