otxA

Overview
NameotxA (AFC87778.1)
Smed IDSMED30007326
Length (bp)2138
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of otxA (SMED30007326) t-SNE clustered cells

Violin plots show distribution of expression levels for otxA (SMED30007326) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007326

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
photoreceptor neuronSMED30007326SMESG000031965.1 otxAsmed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
trail cellSMED30007326SMESG000031965.1 otxAsmed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
gutSMED30007326SMESG000006246.1 Contig3291newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30007326SMESG000006246.1 Contig3291newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30007326SMESG000006246.1 Contig3291newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30007326SMESG000006246.1 Contig3291newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30007326SMESG000031965.1 dd_Smed_v4_14633_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007326SMESG000031965.1 dd_Smed_v4_14633_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30007326SMESG000031965.1 dd_Smed_v4_14633_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30007326SMESG000031965.1 dd_Smed_v4_14633_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007326SMESG000031965.1 Contig8078newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007326SMESG000031965.1 Contig8078uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
prepharyngeal regionSMED30007326SMESG000031965.1 dd_Smed_v6_14633_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30007326SMESG000031965.1 Smed-otxAsmed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30007326SMESG000031965.1 otxAsmed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30007326SMESG000031965.1 OX_Smed_1.0.22860ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30007326SMESG000031965.1 otxAsmed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
trail cellSMED30007326SMESG000031965.1 otxAsmed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
eyeSMED30007326SMESG000031965.1 JN983826.1smed_ncbi_20200123PMID:21852957
Lapan et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of otxA vs. Ensembl Human
Match: OTX2 (orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8522])

HSP 1 Score: 84.7297 bits (208), Expect = 1.763e-18
Identity = 51/84 (60.71%), Postives = 61/84 (72.62%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            NG S   S    L  HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   13 NGLSLTTSGMDLL--HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Human
Match: OTX1 (orthodenticle homeobox 1 [Source:HGNC Symbol;Acc:HGNC:8521])

HSP 1 Score: 88.5817 bits (218), Expect = 2.670e-18
Identity = 51/88 (57.95%), Postives = 63/88 (71.59%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG    G     L  HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLAGPAMDLL--HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98          
BLAST of otxA vs. Ensembl Human
Match: OTX1 (orthodenticle homeobox 1 [Source:HGNC Symbol;Acc:HGNC:8521])

HSP 1 Score: 88.5817 bits (218), Expect = 2.670e-18
Identity = 51/88 (57.95%), Postives = 63/88 (71.59%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG    G     L  HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLAGPAMDLL--HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98          
BLAST of otxA vs. Ensembl Human
Match: OTX2 (orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8522])

HSP 1 Score: 83.5741 bits (205), Expect = 5.093e-18
Identity = 51/84 (60.71%), Postives = 61/84 (72.62%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            NG S   S    L  HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   13 NGLSLTTSGMDLL--HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Human
Match: OTX2 (orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8522])

HSP 1 Score: 85.8853 bits (211), Expect = 9.993e-18
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Celegans
Match: ttx-1 (pep chromosome:WBcel235:V:20053733:20059754:-1 gene:WBGene00006652.1 transcript:Y113G7A.6c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ttx-1)

HSP 1 Score: 86.6557 bits (213), Expect = 4.192e-18
Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  799 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            QLEILE +F K RYPDIF+R++++ KI LPESRVQVWFKNRRAK RQ+ K
Sbjct:  173 QLEILESYFVKTRYPDIFMREDMAHKIQLPESRVQVWFKNRRAKARQQKK 222          
BLAST of otxA vs. Ensembl Celegans
Match: ttx-1 (pep chromosome:WBcel235:V:20053741:20064174:-1 gene:WBGene00006652.1 transcript:Y113G7A.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ttx-1)

HSP 1 Score: 86.2705 bits (212), Expect = 4.648e-18
Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  799 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            QLEILE +F K RYPDIF+R++++ KI LPESRVQVWFKNRRAK RQ+ K
Sbjct:  157 QLEILESYFVKTRYPDIFMREDMAHKIQLPESRVQVWFKNRRAKARQQKK 206          
BLAST of otxA vs. Ensembl Celegans
Match: ttx-1 (pep chromosome:WBcel235:V:20053733:20064174:-1 gene:WBGene00006652.1 transcript:Y113G7A.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ttx-1)

HSP 1 Score: 87.0409 bits (214), Expect = 5.407e-18
Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  799 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            QLEILE +F K RYPDIF+R++++ KI LPESRVQVWFKNRRAK RQ+ K
Sbjct:  210 QLEILESYFVKTRYPDIFMREDMAHKIQLPESRVQVWFKNRRAKARQQKK 259          
BLAST of otxA vs. Ensembl Celegans
Match: ttx-1 (pep chromosome:WBcel235:V:20053733:20061420:-1 gene:WBGene00006652.1 transcript:Y113G7A.6d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ttx-1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.335e-18
Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  799 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            QLEILE +F K RYPDIF+R++++ KI LPESRVQVWFKNRRAK RQ+ K
Sbjct:  198 QLEILESYFVKTRYPDIFMREDMAHKIQLPESRVQVWFKNRRAKARQQKK 247          
BLAST of otxA vs. Ensembl Celegans
Match: vab-3 (MAB-18 [Source:UniProtKB/TrEMBL;Acc:G5EE71])

HSP 1 Score: 73.559 bits (179), Expect = 3.844e-14
Identity = 31/66 (46.97%), Postives = 48/66 (72.73%), Query Frame = 1
Query:  799 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK---QRTIGSVSGNINN 987
            Q+E LE  FE+  YPD+F R+ ++ KI LPE+R+QVWF NRRAK R++ K   +R+ G++  +++N
Sbjct:   42 QIESLEKEFERTHYPDVFARERLAQKIQLPEARIQVWFSNRRAKWRREEKMRNKRSSGTMDSSLSN 107          
BLAST of otxA vs. Ensembl Fly
Match: oc (gene:FBgn0004102 transcript:FBtr0331306)

HSP 1 Score: 84.3445 bits (207), Expect = 1.088e-16
Identity = 45/64 (70.31%), Postives = 53/64 (82.81%), Query Frame = 1
Query:  745 QGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            QG   +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   57 QGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 120          
BLAST of otxA vs. Ensembl Fly
Match: oc (gene:FBgn0004102 transcript:FBtr0331737)

HSP 1 Score: 84.3445 bits (207), Expect = 1.222e-16
Identity = 45/65 (69.23%), Postives = 53/65 (81.54%), Query Frame = 1
Query:  742 YQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            Y G   +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   65 YPGVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 129          
BLAST of otxA vs. Ensembl Fly
Match: oc (gene:FBgn0004102 transcript:FBtr0331305)

HSP 1 Score: 82.4185 bits (202), Expect = 4.790e-16
Identity = 44/63 (69.84%), Postives = 52/63 (82.54%), Query Frame = 1
Query:  748 GAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            G   +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   61 GVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 123          
BLAST of otxA vs. Ensembl Fly
Match: oc (gene:FBgn0004102 transcript:FBtr0331738)

HSP 1 Score: 82.4185 bits (202), Expect = 4.790e-16
Identity = 44/63 (69.84%), Postives = 52/63 (82.54%), Query Frame = 1
Query:  748 GAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            G   +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   61 GVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 123          
BLAST of otxA vs. Ensembl Fly
Match: oc (gene:FBgn0004102 transcript:FBtr0300106)

HSP 1 Score: 82.4185 bits (202), Expect = 4.790e-16
Identity = 44/63 (69.84%), Postives = 52/63 (82.54%), Query Frame = 1
Query:  748 GAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            G   +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   61 GVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 123          
BLAST of otxA vs. Ensembl Zebrafish
Match: otx1 (orthodenticle homeobox 1 [Source:NCBI gene;Acc:30500])

HSP 1 Score: 90.1225 bits (222), Expect = 3.557e-19
Identity = 52/88 (59.09%), Postives = 64/88 (72.73%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG    G+    L  HP++   A  +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLSGAAMDLL--HPSVGYPATPRKQRRERTTFTRSQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98          
BLAST of otxA vs. Ensembl Zebrafish
Match: otx1 (orthodenticle homeobox 1 [Source:NCBI gene;Acc:30500])

HSP 1 Score: 90.1225 bits (222), Expect = 3.557e-19
Identity = 52/88 (59.09%), Postives = 64/88 (72.73%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG    G+    L  HP++   A  +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLSGAAMDLL--HPSVGYPATPRKQRRERTTFTRSQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98          
BLAST of otxA vs. Ensembl Zebrafish
Match: otx2b (orthodenticle homeobox 2b [Source:NCBI gene;Acc:30501])

HSP 1 Score: 85.8853 bits (211), Expect = 1.252e-18
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Zebrafish
Match: otx2b (orthodenticle homeobox 2b [Source:NCBI gene;Acc:30501])

HSP 1 Score: 85.8853 bits (211), Expect = 6.239e-18
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Zebrafish
Match: otx2b (orthodenticle homeobox 2b [Source:NCBI gene;Acc:30501])

HSP 1 Score: 85.8853 bits (211), Expect = 6.239e-18
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Xenopus
Match: otx2 (orthodenticle homeobox 2 [Source:NCBI gene;Acc:548931])

HSP 1 Score: 85.8853 bits (211), Expect = 9.493e-18
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Xenopus
Match: tnnt1 (troponin T1, slow skeletal type [Source:Xenbase;Acc:XB-GENE-481588])

HSP 1 Score: 84.7297 bits (208), Expect = 2.435e-17
Identity = 50/84 (59.52%), Postives = 60/84 (71.43%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            NG +  G+    L  H A+      +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   13 NGLTLAGTGMDLL--HSAVGYPTTPRKQRRERTTFTRAQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Xenopus
Match: ENSXETT00000045443.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:38234864:38239775:1 gene:ENSXETG00000019174.1 transcript:ENSXETT00000045443.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 7.976e-16
Identity = 31/64 (48.44%), Postives = 48/64 (75.00%), Query Frame = 1
Query:  799 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNH 990
            QLE LE+ F K+ YPD+F R++++ +++L E+RVQVWF+NRRAK R++ K   +G +SG   +H
Sbjct:   27 QLEELEMAFRKSHYPDVFTREDLAMRLDLTEARVQVWFQNRRAKWRKREKTEMLGGISGFPMSH 90          
BLAST of otxA vs. Ensembl Xenopus
Match: ENSXETT00000045492.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:38234894:38239775:1 gene:ENSXETG00000019174.1 transcript:ENSXETT00000045492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 1.276e-15
Identity = 31/64 (48.44%), Postives = 48/64 (75.00%), Query Frame = 1
Query:  799 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNH 990
            QLE LE+ F K+ YPD+F R++++ +++L E+RVQVWF+NRRAK R++ K   +G +SG   +H
Sbjct:   42 QLEELEMAFRKSHYPDVFTREDLAMRLDLTEARVQVWFQNRRAKWRKREKTEMLGGISGFPMSH 105          
BLAST of otxA vs. Ensembl Xenopus
Match: ENSXETT00000045475.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:38234894:38239775:1 gene:ENSXETG00000019174.1 transcript:ENSXETT00000045475.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 2.839e-15
Identity = 31/64 (48.44%), Postives = 48/64 (75.00%), Query Frame = 1
Query:  799 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNH 990
            QLE LE+ F K+ YPD+F R++++ +++L E+RVQVWF+NRRAK R++ K   +G +SG   +H
Sbjct:   63 QLEELEMAFRKSHYPDVFTREDLAMRLDLTEARVQVWFQNRRAKWRKREKTEMLGGISGFPMSH 126          
BLAST of otxA vs. Ensembl Mouse
Match: Otx2 (orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MGI:97451])

HSP 1 Score: 85.8853 bits (211), Expect = 1.426e-18
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Mouse
Match: Otx1 (orthodenticle homeobox 1 [Source:MGI Symbol;Acc:MGI:97450])

HSP 1 Score: 88.1965 bits (217), Expect = 2.422e-18
Identity = 51/88 (57.95%), Postives = 63/88 (71.59%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG    G     L  HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLAGPAMDLL--HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98          
BLAST of otxA vs. Ensembl Mouse
Match: Otx2 (orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MGI:97451])

HSP 1 Score: 85.8853 bits (211), Expect = 6.990e-18
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Mouse
Match: Otx2 (orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MGI:97451])

HSP 1 Score: 85.8853 bits (211), Expect = 6.990e-18
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Mouse
Match: Otx2 (orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MGI:97451])

HSP 1 Score: 85.8853 bits (211), Expect = 6.990e-18
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. UniProt/SwissProt
Match: sp|Q91994|OTX1B_DANRE (Homeobox protein OTX1 B OS=Danio rerio OX=7955 GN=otx1b PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.685e-18
Identity = 52/88 (59.09%), Postives = 64/88 (72.73%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG    G+    L  HP++   A  +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLSGAAMDLL--HPSVGYPATPRKQRRERTTFTRSQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98          
BLAST of otxA vs. UniProt/SwissProt
Match: sp|P32242|OTX1_HUMAN (Homeobox protein OTX1 OS=Homo sapiens OX=9606 GN=OTX1 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.282e-17
Identity = 51/88 (57.95%), Postives = 63/88 (71.59%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG    G     L  HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLAGPAMDLL--HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98          
BLAST of otxA vs. UniProt/SwissProt
Match: sp|P80205|OTX1_MOUSE (Homeobox protein OTX1 OS=Mus musculus OX=10090 GN=Otx1 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.694e-17
Identity = 51/88 (57.95%), Postives = 63/88 (71.59%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG    G     L  HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLAGPAMDLL--HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98          
BLAST of otxA vs. UniProt/SwissProt
Match: sp|Q63410|OTX1_RAT (Homeobox protein OTX1 OS=Rattus norvegicus OX=10116 GN=Otx1 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.132e-17
Identity = 51/88 (57.95%), Postives = 63/88 (71.59%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG    G     L  HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLAGPAMDLL--HPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98          
BLAST of otxA vs. UniProt/SwissProt
Match: sp|Q6DKN2|OTX2B_XENLA (Homeobox protein OTX2-B OS=Xenopus laevis OX=8355 GN=otx2-b PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.179e-17
Identity = 47/69 (68.12%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP++   A  +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. TrEMBL
Match: H9B8J3 (OtxA OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 917.531 bits (2370), Expect = 0.000e+0
Identity = 593/596 (99.50%), Postives = 594/596 (99.66%), Query Frame = 1
Query:  307 MFLPPSPNAAYLVSKSLTPQIPLYGSQDINSSLMHQSPYYPSLNSTTIPYSSYESTSTIGLPNLNVGSCYVAGINTLERYGSGMNTAYQHNPYWSNSYHNMMGSPVGGFGXXXXXXXXXXXXXXXXNGSSFGGSPQSYLNQHPALYQ-GAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHXXXXXXXXXXXXXLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPEXXXXXXXXXXXXXXDESRTKNNSTESDSNHLSYSEQQLDXXXXXXXXXXXXXRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLXXXXXXXXXXXXXXXXXXXEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSXXXXXXYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK 2091
            MFLPPSPNAAYLVSKSLTPQIPLYGSQDINSSLMHQSPYYPSLNS TIPYSSYESTSTIGLPNLNVGSCYVAGINTLERYGSGMNTAYQHNPYWSNSYHNMMGSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQ GAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHNSSNVRSTSVSTRLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPELSHSSKSSLIKTSIDESRTKNNSTESDSNHLSYSEQQLDSLIKSPIKSSLKSRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLSRSSFSFINKNFNNEPNSNEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSAAAAAAYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYTNPNPNTTTSNNNINNNNNTNNNNSNGQNPINDVDPDKLEPNKYYTNLSEQFVRST+DEYNNQNPNEESHKIYGDYKK
Sbjct:    1 MFLPPSPNAAYLVSKSLTPQIPLYGSQDINSSLMHQSPYYPSLNSMTIPYSSYESTSTIGLPNLNVGSCYVAGINTLERYGSGMNTAYQHNPYWSNSYHNMMGSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQVGAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHNSSNVRSTSVSTRLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPELSHSSKSSLIKTSIDESRTKNNSTESDSNHLSYSEQQLDSLIKSPIKSSLKSRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLSRSSFSFINKNFNNEPNSNEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSAAAAAAYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYTNPNPNTTTSNNNINNNNNTNNNNSNGQNPINDVDPDKLEPNKYYTNLSEQFVRSTIDEYNNQNPNEESHKIYGDYKK 596          
BLAST of otxA vs. TrEMBL
Match: Q9NLA2 (DjotxA protein OS=Dugesia japonica OX=6161 GN=DjotxA PE=2 SV=1)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 475/599 (79.30%), Postives = 533/599 (88.98%), Query Frame = 1
Query:  307 MFLPPSPNAAYLVSKSLTPQIPLYGSQDINSSLMHQSPYYPSLNSTTIPYSSYESTSTIGLPNLNVGSCYVAGINTLERYGSGMNTAYQHNPYWSNSYHNMMGSPVGGFGXXXXXXXXXXXXXXXXNGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHXXXXXXXXXXXXXLPGSTSRNNTASKPPTTISSSTNVSS--CLKMEPEXXXXXXXXXXXXXXDESRTKNNSTESDSNHLSYSEQQLDXXXXXXXXXXXXXRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLXXXXXXXXXXXXXXXXXXX--EGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSXXXXXXYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK 2091
            MFLPPSPNAAYLVSKSLTPQIPLYG+Q+INSSLMHQSPYYPSLNSTTIPYSSYE+T +IGLPNLNVGSCYVAGINTLERYGSGM+TAYQH PYWSNSYHNM+GSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQG QVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRT+ SV  NINNHN++NVRSTS STR+ GSTSR+NT SK  TT ++S++ +   CLK+EPEL+HS+KSSL+KT+++ESR K  S+ESDSN  S+S+Q LDS+IK+P+KS+LK+R+RLN YSD+ CNHSN S+NINH STEDESD+GLSRSSFSFINKNF +E NS+  EGFYNSEMLRNMWQRRSEKYNSLF N+DR+ NNSCYRP+YLDFIPKTI  NQLQNYSTLG+DNMSSLSRMG AY+N+C GLDQE+ELSAAAAAAYYGLNN  +MRNFDSDN  SNV+ NKLYYSNLFS  NMEIPSE+         S+N   N N  +NNN+NG N +++ D DKLE  KYYTNLSEQFVRSTLDEYN+Q+ N+++ KIYGDYKK
Sbjct:    1 MFLPPSPNAAYLVSKSLTPQIPLYGAQEINSSLMHQSPYYPSLNSTTIPYSSYETTPSIGLPNLNVGSCYVAGINTLERYGSGMSTAYQHTPYWSNSYHNMIGSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQGTQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTVASVGANINNHNTTNVRSTSASTRILGSTSRSNTTSKTSTTTTTSSSTNMSTCLKLEPELTHSNKSSLLKTAVEESRNKTMSSESDSNQFSFSDQHLDSVIKNPLKSNLKNRHRLNAYSDSHCNHSNNSENINHQSTEDESDLGLSRSSFSFINKNFGSENNSSGPEGFYNSEMLRNMWQRRSEKYNSLFSNADRNANNSCYRPAYLDFIPKTIGTNQLQNYSTLGSDNMSSLSRMGQAYSNNCIGLDQESELSAAAAAAYYGLNNTNTMRNFDSDNSSSNVSSNKLYYSNLFSFPNMEIPSEF--------NSSNTNTNTNTNSNNNNNGVNALHESDNDKLEQTKYYTNLSEQFVRSTLDEYNSQSNNDDNQKIYGDYKK 591          
BLAST of otxA vs. TrEMBL
Match: H6V050 (OTX-A (Fragment) OS=Schmidtea polychroa OX=50054 GN=otxA PE=2 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 1.250e-173
Identity = 334/354 (94.35%), Postives = 346/354 (97.74%), Query Frame = 1
Query:  796 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHXXXXXXXXXXXXXLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPEXXXXXXXXXXXXXXDESRTKNNSTESDSNHLSYSEQQLDXXXXXXXXXXXXXRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLXXXXXXXXXXXXXXXXXXXEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSXXXXXXYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEY 1857
            QQLEILELHFEK+RYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHN+SN+RST VSTRLPGSTSRNNT+SK  TTISS+TNVSSCLKMEPELSHSSKSSLIKTSIDESR KNNSTESDSNHLSY+EQQLDSLIK+PIKSSLKSRNR+N YSDTQCNHSNTSDNINHPSTEDESDIGLSRSSFSFINKNFNNE NSNEGFYNSEMLRNMWQRRSEKYNSLFL+SDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDN+SSLSRMGHAY NSC GLDQETELSAAAAAAYYGLNNPTSMRNFDSDN+PSNVNCNKLYYSNLFSLSNMEIP+EY
Sbjct:   13 QQLEILELHFEKDRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHNTSNIRSTPVSTRLPGSTSRNNTSSKTSTTISSTTNVSSCLKMEPELSHSSKSSLIKTSIDESRPKNNSTESDSNHLSYNEQQLDSLIKNPIKSSLKSRNRMNLYSDTQCNHSNTSDNINHPSTEDESDIGLSRSSFSFINKNFNNETNSNEGFYNSEMLRNMWQRRSEKYNSLFLDSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNISSLSRMGHAYNNSCVGLDQETELSAAAAAAYYGLNNPTSMRNFDSDNVPSNVNCNKLYYSNLFSLSNMEIPTEY 366          
BLAST of otxA vs. TrEMBL
Match: Q9U084 (Homeobox protein (Fragment) OS=Girardia tigrina OX=6162 GN=Otx PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.126e-30
Identity = 78/92 (84.78%), Postives = 80/92 (86.96%), Query Frame = 1
Query:  688 GSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIG 963
            GSSF  SP  Y  QHPALYQ    KKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK+KQ+  G
Sbjct:    9 GSSFPSSP--YFPQHPALYQVPN-KKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNG 97          
BLAST of otxA vs. TrEMBL
Match: A8C1Q2 (DjotxB protein OS=Dugesia japonica OX=6161 GN=DjotxB PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 2.793e-28
Identity = 78/92 (84.78%), Postives = 80/92 (86.96%), Query Frame = 1
Query:  688 GSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIG 963
            GSSF  SP  Y  QHPALYQ    KKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK+KQ+  G
Sbjct:  119 GSSFPSSP--YFPQHPALYQVPN-KKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKSKQKPNG 207          
BLAST of otxA vs. Ensembl Cavefish
Match: otx2a (orthodenticle homeobox 1 [Source:NCBI gene;Acc:103037567])

HSP 1 Score: 96.6709 bits (239), Expect = 3.550e-21
Identity = 55/88 (62.50%), Postives = 66/88 (75.00%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG   GG+P   L  HPA+   A  +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLGGAPMDLL--HPAVGYPANPRKQRRERTTFTRTQLDILESLFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98          
BLAST of otxA vs. Ensembl Cavefish
Match: otx1 (homeobox protein OTX1 B [Source:NCBI gene;Acc:103033915])

HSP 1 Score: 90.8929 bits (224), Expect = 1.898e-19
Identity = 53/89 (59.55%), Postives = 65/89 (73.03%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPAL-YQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG    G+    L  HP++ Y  A  +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLSGAAMDLL--HPSVGYPAATPRKQRRERTTFTRSQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 99          
BLAST of otxA vs. Ensembl Cavefish
Match: OTX2 (orthodenticle homeobox 2 [Source:NCBI gene;Acc:103046890])

HSP 1 Score: 85.8853 bits (211), Expect = 4.193e-18
Identity = 46/69 (66.67%), Postives = 55/69 (79.71%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP +   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPTVGYPAVPRKQRRERTTFTRAQLDVLEAMFAKTRYPDIFMREEVAMKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Cavefish
Match: OTX2 (homeobox protein OTX2 [Source:NCBI gene;Acc:103027403])

HSP 1 Score: 85.1149 bits (209), Expect = 1.169e-17
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Cavefish
Match: crx (homeobox protein otx5 [Source:NCBI gene;Acc:103028515])

HSP 1 Score: 83.5741 bits (205), Expect = 2.635e-17
Identity = 47/69 (68.12%), Postives = 55/69 (79.71%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            H A+   A  +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   28 HTAVAYPATPRKQRRERTTFTRTQLDILEALFTKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 96          
BLAST of otxA vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010761.1 (pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-1 gene:ENSPMAG00000009746.1 transcript:ENSPMAT00000010761.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 2.666e-17
Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = 1
Query:  799 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   17 QLDVLEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 62          
BLAST of otxA vs. Ensembl Sea Lamprey
Match: dmbx1b (diencephalon/mesencephalon homeobox 1b [Source:NCBI gene;Acc:550288])

HSP 1 Score: 72.4034 bits (176), Expect = 6.892e-14
Identity = 30/51 (58.82%), Postives = 39/51 (76.47%), Query Frame = 1
Query:  796 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            QQLE LE  F+K  YPD+ +R+ ++   NLPE+RVQVWFKNRRAK R+K +
Sbjct:   53 QQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQR 103          
BLAST of otxA vs. Ensembl Sea Lamprey
Match: otx5 (orthodenticle homolog 5 [Source:ZFIN;Acc:ZDB-GENE-030508-1])

HSP 1 Score: 63.1586 bits (152), Expect = 4.159e-11
Identity = 41/67 (61.19%), Postives = 49/67 (73.13%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAK 930
            HPAL   A  +K RR+RTTFTR QL+ LE  F K RYPDIF+R+E++ KINLPESRVQ+ F   R K
Sbjct:   26 HPALGYPAAPRKQRRERTTFTRAQLD-LESLFSKTRYPDIFMREEVALKINLPESRVQINFPESRVK 91          
BLAST of otxA vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000987.1 (pep scaffold:Pmarinus_7.0:GL477479:61561:69115:-1 gene:ENSPMAG00000000895.1 transcript:ENSPMAT00000000987.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 1.208e-6
Identity = 23/53 (43.40%), Postives = 34/53 (64.15%), Query Frame = 1
Query:  796 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQR 954
            Q+ E LE  F  NRY +I  + EI++ + L E +V++WF+NRRAKE  +   R
Sbjct:   20 QRFE-LEKEFHFNRYINIRRKAEIAASLGLTERQVKIWFQNRRAKETTRRFAR 71          
BLAST of otxA vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000988.1 (pep scaffold:Pmarinus_7.0:GL477479:64107:69103:-1 gene:ENSPMAG00000000895.1 transcript:ENSPMAT00000000988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.4394 bits (106), Expect = 3.959e-6
Identity = 22/46 (47.83%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  796 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKE 933
            Q+ E LE  F  NRY +I  + EI++ + L E +V++WF+NRRAKE
Sbjct:   16 QRFE-LEKEFHFNRYINIRRKAEIAASLGLTERQVKIWFQNRRAKE 60          
BLAST of otxA vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 51.9878 bits (123), Expect = 2.322e-7
Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = 1
Query:  796 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK 942
            + L++L+  FE N  P +  R +IS  I +PE  V++WF+NRRAK R+K
Sbjct:   87 EALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKK 135          
BLAST of otxA vs. Ensembl Nematostella
Match: OTX (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM3])

HSP 1 Score: 80.4925 bits (197), Expect = 7.847e-19
Identity = 45/61 (73.77%), Postives = 53/61 (86.89%), Query Frame = 1
Query:  760 KKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK 942
            +K RR+RTTFT+ QLEILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+
Sbjct:    2 RKQRRERTTFTKNQLEILEELFAKTRYPDIFMREEVAIKINLPESRVQVWFKNRRAKARQQ 62          
BLAST of otxA vs. Ensembl Nematostella
Match: OTXC (OtxC; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM4])

HSP 1 Score: 84.7297 bits (208), Expect = 1.498e-18
Identity = 38/50 (76.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  799 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            QLEILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ +K
Sbjct:   52 QLEILEELFAKTRYPDIFMREEVAIKINLPESRVQVWFKNRRAKLRQLSK 101          
BLAST of otxA vs. Ensembl Nematostella
Match: EDO35749 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM2])

HSP 1 Score: 79.337 bits (194), Expect = 2.014e-18
Identity = 48/78 (61.54%), Postives = 58/78 (74.36%), Query Frame = 1
Query:  715 SYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            S ++ HP        +K RR+RTTFT+ QLE+LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ  K
Sbjct:    2 SRVSAHPT-------RKQRRERTTFTKNQLEVLEELFAKTRYPDIFMREEVAIKINLPESRVQVWFKNRRAKTRQLEK 72          
BLAST of otxA vs. Ensembl Nematostella
Match: EDO38664 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCD3])

HSP 1 Score: 70.0922 bits (170), Expect = 2.666e-15
Identity = 30/51 (58.82%), Postives = 42/51 (82.35%), Query Frame = 1
Query:  796 QQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            QQL+ILE  F K  YPD+ +R+++++ IN+PESR+QVWFKNRRAK R++ K
Sbjct:    4 QQLQILESTFSKTHYPDVVMREQLAAYINIPESRIQVWFKNRRAKYRKQVK 54          
BLAST of otxA vs. Ensembl Nematostella
Match: GSC (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S024])

HSP 1 Score: 73.559 bits (179), Expect = 7.191e-15
Identity = 45/93 (48.39%), Postives = 60/93 (64.52%), Query Frame = 1
Query:  706 SPQSYLNQHP--ALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGN 978
            +P  YL   P  A    +Q K+ RR RT FT +QLE+LE  F+K  YPD+ LR+E++ K++L E RV+VWFKNRRAK R K K+  + S   N
Sbjct:   52 APPGYLVGFPRYADVLRSQPKRKRRHRTIFTEEQLELLETTFQKTHYPDVLLREELAMKVDLKEERVEVWFKNRRAKWR-KQKREAVDSKKAN 143          
BLAST of otxA vs. Ensembl Medaka
Match: otx2a (homeobox protein OTX1 B [Source:NCBI gene;Acc:101169019])

HSP 1 Score: 88.1965 bits (217), Expect = 1.666e-18
Identity = 52/88 (59.09%), Postives = 64/88 (72.73%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG    G+    L  HP++   A  +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLSGAAMDLL--HPSVGYPANPRKQRRERTTFTRTQLDILESLFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98          
BLAST of otxA vs. Ensembl Medaka
Match: otx2a (homeobox protein OTX1 B [Source:NCBI gene;Acc:101169019])

HSP 1 Score: 88.1965 bits (217), Expect = 1.666e-18
Identity = 52/88 (59.09%), Postives = 64/88 (72.73%), Query Frame = 1
Query:  685 NGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            NG    G+    L  HP++   A  +K RR+RTTFTR QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:   13 NGLGLSGAAMDLL--HPSVGYPANPRKQRRERTTFTRTQLDILESLFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98          
BLAST of otxA vs. Ensembl Medaka
Match: otx2b (orthodenticle homeobox 2 [Source:NCBI gene;Acc:100049357])

HSP 1 Score: 85.5001 bits (210), Expect = 6.318e-18
Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1
Query:  730 HPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            HP++   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   26 HPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Ensembl Medaka
Match: otx1 (homeobox protein OTX1 B-like [Source:NCBI gene;Acc:101163925])

HSP 1 Score: 86.2705 bits (212), Expect = 1.573e-17
Identity = 47/71 (66.20%), Postives = 57/71 (80.28%), Query Frame = 1
Query:  736 ALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNK 948
            AL   A  +K RR+RTTFTR QL++LE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK RQ+ +
Sbjct:  109 ALCPSATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 179          
BLAST of otxA vs. Ensembl Medaka
Match: ENSORLT00000000395.2 (homeobox protein otx5-like [Source:NCBI gene;Acc:101164666])

HSP 1 Score: 84.3445 bits (207), Expect = 1.735e-17
Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = 1
Query:  799 QLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKER 936
            QL+ILE  F K RYPDIF+R+E++ KINLPESRVQVWFKNRRAK R
Sbjct:   49 QLDILEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94          
BLAST of otxA vs. Planmine SMEST
Match: SMESG000031965.1 (SMESG000031965.1)

HSP 1 Score: 860.136 bits (2221), Expect = 0.000e+0
Identity = 562/562 (100.00%), Postives = 562/562 (100.00%), Query Frame = 1
Query:  406 MHQSPYYPSLNSTTIPYSSYESTSTIGLPNLNVGSCYVAGINTLERYGSGMNTAYQHNPYWSNSYHNMMGSPVGGFGXXXXXXXXXXXXXXXXNGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHXXXXXXXXXXXXXLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPEXXXXXXXXXXXXXXDESRTKNNSTESDSNHLSYSEQQLDXXXXXXXXXXXXXRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLXXXXXXXXXXXXXXXXXXXEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSXXXXXXYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK 2091
            MHQSPYYPSLNSTTIPYSSYESTSTIGLPNLNVGSCYVAGINTLERYGSGMNTAYQHNPYWSNSYHNMMGSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQGAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHNSSNVRSTSVSTRLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPELSHSSKSSLIKTSIDESRTKNNSTESDSNHLSYSEQQLDSLIKSPIKSSLKSRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLSRSSFSFINKNFNNEPNSNEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSAAAAAAYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYTNPNPNTTTSNNNINNNNNTNNNNSNGQNPINDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK
Sbjct:    1 MHQSPYYPSLNSTTIPYSSYESTSTIGLPNLNVGSCYVAGINTLERYGSGMNTAYQHNPYWSNSYHNMMGSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQGAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHNSSNVRSTSVSTRLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPELSHSSKSSLIKTSIDESRTKNNSTESDSNHLSYSEQQLDSLIKSPIKSSLKSRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLSRSSFSFINKNFNNEPNSNEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSAAAAAAYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYTNPNPNTTTSNNNINNNNNTNNNNSNGQNPINDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK 562          
BLAST of otxA vs. Planmine SMEST
Match: SMESG000031965.1 (SMESG000031965.1)

HSP 1 Score: 855.514 bits (2209), Expect = 0.000e+0
Identity = 562/563 (99.82%), Postives = 562/563 (99.82%), Query Frame = 1
Query:  406 MHQSPYYPSLNSTTIPYSSYESTSTIGLPNLNVGSCYVAGINTLERYGSGMNTAYQHNPYWSNSYHNMMGSPVGGFGXXXXXXXXXXXXXXXXNGSSFGGSPQSYLNQHPALYQ-GAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHXXXXXXXXXXXXXLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPEXXXXXXXXXXXXXXDESRTKNNSTESDSNHLSYSEQQLDXXXXXXXXXXXXXRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLXXXXXXXXXXXXXXXXXXXEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSXXXXXXYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK 2091
            MHQSPYYPSLNSTTIPYSSYESTSTIGLPNLNVGSCYVAGINTLERYGSGMNTAYQHNPYWSNSYHNMMGSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQ GAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHNSSNVRSTSVSTRLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPELSHSSKSSLIKTSIDESRTKNNSTESDSNHLSYSEQQLDSLIKSPIKSSLKSRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLSRSSFSFINKNFNNEPNSNEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSAAAAAAYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYTNPNPNTTTSNNNINNNNNTNNNNSNGQNPINDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK
Sbjct:    1 MHQSPYYPSLNSTTIPYSSYESTSTIGLPNLNVGSCYVAGINTLERYGSGMNTAYQHNPYWSNSYHNMMGSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQVGAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHNSSNVRSTSVSTRLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPELSHSSKSSLIKTSIDESRTKNNSTESDSNHLSYSEQQLDSLIKSPIKSSLKSRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLSRSSFSFINKNFNNEPNSNEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSAAAAAAYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYTNPNPNTTTSNNNINNNNNTNNNNSNGQNPINDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK 563          
BLAST of otxA vs. Planmine SMEST
Match: SMESG000031965.1 (SMESG000031965.1)

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 512/512 (100.00%), Postives = 512/512 (100.00%), Query Frame = 1
Query:  556 MNTAYQHNPYWSNSYHNMMGSPVGGFGXXXXXXXXXXXXXXXXNGSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHXXXXXXXXXXXXXLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPEXXXXXXXXXXXXXXDESRTKNNSTESDSNHLSYSEQQLDXXXXXXXXXXXXXRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLXXXXXXXXXXXXXXXXXXXEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSXXXXXXYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK 2091
            MNTAYQHNPYWSNSYHNMMGSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQGAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHNSSNVRSTSVSTRLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPELSHSSKSSLIKTSIDESRTKNNSTESDSNHLSYSEQQLDSLIKSPIKSSLKSRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLSRSSFSFINKNFNNEPNSNEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSAAAAAAYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYTNPNPNTTTSNNNINNNNNTNNNNSNGQNPINDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK
Sbjct:    1 MNTAYQHNPYWSNSYHNMMGSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQGAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHNSSNVRSTSVSTRLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPELSHSSKSSLIKTSIDESRTKNNSTESDSNHLSYSEQQLDSLIKSPIKSSLKSRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLSRSSFSFINKNFNNEPNSNEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSAAAAAAYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYTNPNPNTTTSNNNINNNNNTNNNNSNGQNPINDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK 512          
BLAST of otxA vs. Planmine SMEST
Match: SMESG000031965.1 (SMESG000031965.1)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 512/513 (99.81%), Postives = 512/513 (99.81%), Query Frame = 1
Query:  556 MNTAYQHNPYWSNSYHNMMGSPVGGFGXXXXXXXXXXXXXXXXNGSSFGGSPQSYLNQHPALYQ-GAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHXXXXXXXXXXXXXLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPEXXXXXXXXXXXXXXDESRTKNNSTESDSNHLSYSEQQLDXXXXXXXXXXXXXRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLXXXXXXXXXXXXXXXXXXXEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSXXXXXXYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK 2091
            MNTAYQHNPYWSNSYHNMMGSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQ GAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHNSSNVRSTSVSTRLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPELSHSSKSSLIKTSIDESRTKNNSTESDSNHLSYSEQQLDSLIKSPIKSSLKSRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLSRSSFSFINKNFNNEPNSNEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSAAAAAAYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYTNPNPNTTTSNNNINNNNNTNNNNSNGQNPINDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK
Sbjct:    1 MNTAYQHNPYWSNSYHNMMGSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQVGAQVKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQRTIGSVSGNINNHNSSNVRSTSVSTRLPGSTSRNNTASKPPTTISSSTNVSSCLKMEPELSHSSKSSLIKTSIDESRTKNNSTESDSNHLSYSEQQLDSLIKSPIKSSLKSRNRLNPYSDTQCNHSNTSDNINHPSTEDESDIGLSRSSFSFINKNFNNEPNSNEGFYNSEMLRNMWQRRSEKYNSLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMGHAYTNSCAGLDQETELSAAAAAAYYGLNNPTSMRNFDSDNIPSNVNCNKLYYSNLFSLSNMEIPSEYTNPNPNTTTSNNNINNNNNTNNNNSNGQNPINDVDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKK 513          
BLAST of otxA vs. Planmine SMEST
Match: SMESG000023717.1 (SMESG000023717.1)

HSP 1 Score: 129.028 bits (323), Expect = 2.079e-31
Identity = 77/89 (86.52%), Postives = 78/89 (87.64%), Query Frame = 1
Query:  688 GSSFGGSPQSYLNQHPALYQGAQVKKXXXXXXXXXXQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKNKQR 954
            GSSF  SP  Y  QHPALYQ    KKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQK KQ+
Sbjct:  113 GSSFPSSP--YFPQHPALYQVPN-KKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQVWFKNRRAKERQKCKQK 198          
The following BLAST results are available for this feature:
BLAST of otxA vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OTX21.763e-1860.71orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:H... [more]
OTX12.670e-1857.95orthodenticle homeobox 1 [Source:HGNC Symbol;Acc:H... [more]
OTX12.670e-1857.95orthodenticle homeobox 1 [Source:HGNC Symbol;Acc:H... [more]
OTX25.093e-1860.71orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:H... [more]
OTX29.993e-1866.67orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of otxA vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttx-14.192e-1872.00pep chromosome:WBcel235:V:20053733:20059754:-1 gen... [more]
ttx-14.648e-1872.00pep chromosome:WBcel235:V:20053741:20064174:-1 gen... [more]
ttx-15.407e-1872.00pep chromosome:WBcel235:V:20053733:20064174:-1 gen... [more]
ttx-16.335e-1872.00pep chromosome:WBcel235:V:20053733:20061420:-1 gen... [more]
vab-33.844e-1446.97MAB-18 [Source:UniProtKB/TrEMBL;Acc:G5EE71][more]
back to top
BLAST of otxA vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oc1.088e-1670.31gene:FBgn0004102 transcript:FBtr0331306[more]
oc1.222e-1669.23gene:FBgn0004102 transcript:FBtr0331737[more]
oc4.790e-1669.84gene:FBgn0004102 transcript:FBtr0331305[more]
oc4.790e-1669.84gene:FBgn0004102 transcript:FBtr0331738[more]
oc4.790e-1669.84gene:FBgn0004102 transcript:FBtr0300106[more]
back to top
BLAST of otxA vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otx13.557e-1959.09orthodenticle homeobox 1 [Source:NCBI gene;Acc:305... [more]
otx13.557e-1959.09orthodenticle homeobox 1 [Source:NCBI gene;Acc:305... [more]
otx2b1.252e-1866.67orthodenticle homeobox 2b [Source:NCBI gene;Acc:30... [more]
otx2b6.239e-1866.67orthodenticle homeobox 2b [Source:NCBI gene;Acc:30... [more]
otx2b6.239e-1866.67orthodenticle homeobox 2b [Source:NCBI gene;Acc:30... [more]
back to top
BLAST of otxA vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otx29.493e-1866.67orthodenticle homeobox 2 [Source:NCBI gene;Acc:548... [more]
tnnt12.435e-1759.52troponin T1, slow skeletal type [Source:Xenbase;Ac... [more]
ENSXETT00000045443.17.976e-1648.44pep primary_assembly:Xenopus_tropicalis_v9.1:8:382... [more]
ENSXETT00000045492.11.276e-1548.44pep primary_assembly:Xenopus_tropicalis_v9.1:8:382... [more]
ENSXETT00000045475.12.839e-1548.44pep primary_assembly:Xenopus_tropicalis_v9.1:8:382... [more]
back to top
BLAST of otxA vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Otx21.426e-1866.67orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MG... [more]
Otx12.422e-1857.95orthodenticle homeobox 1 [Source:MGI Symbol;Acc:MG... [more]
Otx26.990e-1866.67orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MG... [more]
Otx26.990e-1866.67orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MG... [more]
Otx26.990e-1866.67orthodenticle homeobox 2 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of otxA vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91994|OTX1B_DANRE2.685e-1859.09Homeobox protein OTX1 B OS=Danio rerio OX=7955 GN=... [more]
sp|P32242|OTX1_HUMAN1.282e-1757.95Homeobox protein OTX1 OS=Homo sapiens OX=9606 GN=O... [more]
sp|P80205|OTX1_MOUSE1.694e-1757.95Homeobox protein OTX1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q63410|OTX1_RAT2.132e-1757.95Homeobox protein OTX1 OS=Rattus norvegicus OX=1011... [more]
sp|Q6DKN2|OTX2B_XENLA3.179e-1768.12Homeobox protein OTX2-B OS=Xenopus laevis OX=8355 ... [more]
back to top
BLAST of otxA vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9B8J30.000e+099.50OtxA OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
Q9NLA20.000e+079.30DjotxA protein OS=Dugesia japonica OX=6161 GN=Djot... [more]
H6V0501.250e-17394.35OTX-A (Fragment) OS=Schmidtea polychroa OX=50054 G... [more]
Q9U0843.126e-3084.78Homeobox protein (Fragment) OS=Girardia tigrina OX... [more]
A8C1Q22.793e-2884.78DjotxB protein OS=Dugesia japonica OX=6161 GN=Djot... [more]
back to top
BLAST of otxA vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otx2a3.550e-2162.50orthodenticle homeobox 1 [Source:NCBI gene;Acc:103... [more]
otx11.898e-1959.55homeobox protein OTX1 B [Source:NCBI gene;Acc:1030... [more]
OTX24.193e-1866.67orthodenticle homeobox 2 [Source:NCBI gene;Acc:103... [more]
OTX21.169e-1766.67homeobox protein OTX2 [Source:NCBI gene;Acc:103027... [more]
crx2.635e-1768.12homeobox protein otx5 [Source:NCBI gene;Acc:103028... [more]
back to top
BLAST of otxA vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010761.12.666e-1773.91pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-... [more]
dmbx1b6.892e-1458.82diencephalon/mesencephalon homeobox 1b [Source:NCB... [more]
otx54.159e-1161.19orthodenticle homolog 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000000987.11.208e-643.40pep scaffold:Pmarinus_7.0:GL477479:61561:69115:-1 ... [more]
ENSPMAT00000000988.13.959e-647.83pep scaffold:Pmarinus_7.0:GL477479:64107:69103:-1 ... [more]
back to top
BLAST of otxA vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO22.322e-744.90Homeobox transcription factor; regulatory targets ... [more]
back to top
BLAST of otxA vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
OTX7.847e-1973.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
OTXC1.498e-1876.00OtxC; Predicted protein [Source:UniProtKB/TrEMBL;... [more]
EDO357492.014e-1861.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386642.666e-1558.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
GSC7.191e-1548.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of otxA vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otx2a1.666e-1859.09homeobox protein OTX1 B [Source:NCBI gene;Acc:1011... [more]
otx2a1.666e-1859.09homeobox protein OTX1 B [Source:NCBI gene;Acc:1011... [more]
otx2b6.318e-1866.67orthodenticle homeobox 2 [Source:NCBI gene;Acc:100... [more]
otx11.573e-1766.20homeobox protein OTX1 B-like [Source:NCBI gene;Acc... [more]
ENSORLT00000000395.21.735e-1776.09homeobox protein otx5-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of otxA vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031965.10.000e+0100.00SMESG000031965.1[more]
SMESG000031965.10.000e+099.82SMESG000031965.1[more]
SMESG000031965.10.000e+0100.00SMESG000031965.1[more]
SMESG000031965.10.000e+099.81SMESG000031965.1[more]
SMESG000023717.12.079e-3186.52SMESG000023717.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007326
GenBankAFC87778.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007326 ID=SMED30007326|Name=otxA|organism=Schmidtea mediterranea sexual|type=transcript|length=2138bp
CAGCTCCAACATTTTAATCCACCAAAAGTAGCTTAGTCAGAAGAACCTCA
ACATCCGAGATTTGATCTGATATATTACGAGATTAGTGCTGTATTAACCA
AACCTTATCCAGCAACTCCTACTCCATTGAAGACTACCAGATAATCCTTC
TGAAATACGAGACATATATACAGAGCCAATTGTTTTTAATCGACATCCAA
ACTGGCAGAAAACAATCATTCTTCAGATTCTATTCATTTTCCGTATTATT
CTTGTGAATCTGTTCAGGTTATCTCCACTTCTCCACAGAGATTTAGAGAA
GGAGAAATGTTTCTACCACCATCACCAAATGCAGCATATCTTGTGTCGAA
ATCATTAACTCCACAAATCCCTCTCTACGGCTCCCAAGATATTAATTCGA
GTTTAATGCACCAGTCTCCATATTATCCCAGCTTGAATTCAACGACTATT
CCATATTCGTCGTATGAGTCAACTTCAACTATTGGGTTGCCAAATTTAAA
CGTCGGCAGTTGTTACGTAGCTGGGATCAACACATTGGAACGGTACGGAT
CCGGAATGAATACTGCATATCAGCATAATCCATATTGGTCAAACAGTTAT
CACAACATGATGGGATCACCAGTTGGAGGATTTGGTGCTAGTGCAATGGC
AGCTGCTGCAAATACCATGGCGATGGTTGCCGCTAATGGTTCCAGTTTTG
GAGGCTCTCCACAGAGTTATTTGAATCAACATCCAGCTCTTTATCAAGGT
GCCCAAGTGAAGAAAACTCGTCGCGACCGAACAACATTCACTCGACAACA
GTTGGAAATTCTTGAACTCCATTTTGAAAAGAATCGATATCCAGACATAT
TTTTGAGAGATGAAATTTCTTCAAAAATCAACTTGCCAGAGTCCCGAGTT
CAAGTTTGGTTCAAAAATCGCAGAGCAAAAGAAAGACAAAAAAACAAACA
GCGAACTATCGGATCTGTATCGGGAAATATAAACAATCACAATTCCTCGA
ATGTACGCTCAACGTCAGTCTCCACAAGACTTCCGGGTTCTACGTCTCGC
AATAACACAGCATCAAAACCCCCAACTACGATTTCATCATCAACAAATGT
TTCATCTTGCTTGAAAATGGAACCGGAATTGTCTCATTCCAGCAAAAGTT
CTTTAATTAAAACCTCAATAGATGAATCAAGAACAAAAAACAATTCAACT
GAGTCTGATTCCAATCACCTCTCTTACAGTGAGCAGCAATTAGATTCTCT
AATTAAAAGCCCTATCAAATCATCTTTAAAAAGTCGAAACAGGTTGAATC
CTTACTCGGACACCCAATGCAACCATTCCAACACTAGTGACAACATCAAC
CATCCGTCAACTGAAGACGAATCCGATATAGGTCTCAGTCGATCAAGTTT
TTCTTTTATCAACAAAAACTTCAACAATGAACCCAACTCAAATGAAGGAT
TCTACAACTCAGAAATGCTCAGAAACATGTGGCAAAGACGCTCAGAAAAA
TACAACTCACTATTTTTGAACTCTGATAGAAGCGGAAATAATTCCTGTTA
TCGGCCATCGTATTTGGATTTTATACCCAAAACTATTGCAGCAAATCAAC
TGCAAAACTATTCGACATTGGGAAATGATAACATGTCGTCGTTAAGTCGA
ATGGGTCATGCCTATACAAACAGTTGCGCGGGATTAGATCAAGAAACTGA
ATTATCTGCAGCCGCCGCAGCCGCATATTACGGATTGAATAATCCCACCT
CTATGCGAAATTTCGACAGTGATAATATACCGTCGAATGTCAACTGCAAC
AAGCTATATTACTCAAATTTGTTCTCATTGTCTAATATGGAAATTCCATC
AGAATATACAAATCCGAACCCAAATACTACGACAAGTAACAATAATATTA
ACAACAACAACAATACCAATAACAACAACAGCAATGGACAGAATCCCATA
AATGATGTTGATCCTGATAAATTAGAGCCAAATAAATATTATACAAACTT
GTCGGAACAATTTGTCAGGTCCACCCTAGATGAATATAATAATCAAAATC
CAAATGAGGAAAGTCATAAAATATATGGCGACTATAAAAAGATTGAAACC
ATTACATAAACCTTTATTATATTCGAAATATTGTATTT
back to top

protein sequence of SMED30007326-orf-1

>SMED30007326-orf-1 ID=SMED30007326-orf-1|Name=SMED30007326-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=601bp
MFLPPSPNAAYLVSKSLTPQIPLYGSQDINSSLMHQSPYYPSLNSTTIPY
SSYESTSTIGLPNLNVGSCYVAGINTLERYGSGMNTAYQHNPYWSNSYHN
MMGSPVGGFGASAMAAAANTMAMVAANGSSFGGSPQSYLNQHPALYQGAQ
VKKTRRDRTTFTRQQLEILELHFEKNRYPDIFLRDEISSKINLPESRVQV
WFKNRRAKERQKNKQRTIGSVSGNINNHNSSNVRSTSVSTRLPGSTSRNN
TASKPPTTISSSTNVSSCLKMEPELSHSSKSSLIKTSIDESRTKNNSTES
DSNHLSYSEQQLDSLIKSPIKSSLKSRNRLNPYSDTQCNHSNTSDNINHP
STEDESDIGLSRSSFSFINKNFNNEPNSNEGFYNSEMLRNMWQRRSEKYN
SLFLNSDRSGNNSCYRPSYLDFIPKTIAANQLQNYSTLGNDNMSSLSRMG
HAYTNSCAGLDQETELSAAAAAAYYGLNNPTSMRNFDSDNIPSNVNCNKL
YYSNLFSLSNMEIPSEYTNPNPNTTTSNNNINNNNNTNNNNSNGQNPIND
VDPDKLEPNKYYTNLSEQFVRSTLDEYNNQNPNEESHKIYGDYKKIETIT
*
back to top
Aliases
The feature 'otxA' has the following synonyms
Synonym
otxA
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000036eye
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000044cephalic ganglia
PLANA:0000070intestinal phagocyte
PLANA:0000095trail cell
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0000419prepharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 595..600
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 148..218
e-value: 1.0E-24
score: 87.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 204..358
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 216..291
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 298..349
NoneNo IPR availablePANTHERPTHR45793:SF5HOMEOTIC PROTEIN OCELLILESScoord: 101..393
NoneNo IPR availablePANTHERPTHR45793FAMILY NOT NAMEDcoord: 101..393
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 154..216
e-value: 1.1E-22
score: 91.4
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 155..211
e-value: 3.5E-21
score: 74.8
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 152..212
score: 19.84
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 164..213
e-value: 4.58902E-18
score: 76.128
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 187..210
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 134..214