Synaptic vesicle 2-related protein

Overview
NameSynaptic vesicle 2-related protein
Smed IDSMED30007322
Length (bp)1604
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptic vesicle 2-related protein (SMED30007322) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptic vesicle 2-related protein (SMED30007322) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptic vesicle 2-related protein (SMED30007322) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptic vesicle 2-related protein (SMED30007322) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007322

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30007322SMESG000000254.1 dd_Smed_v4_12102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30007322SMESG000000254.1 dd_Smed_v6_12102_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30007322SMESG000000254.1 dd_Smed_v6_12102_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30007322SMESG000000254.1 dd_Smed_v4_12102_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007322SMESG000000254.1 dd_Smed_v4_12102_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30007322SMESG000000254.1 dd_Smed_v4_12102_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Human
Match: SVOP (SV2 related protein [Source:HGNC Symbol;Acc:HGNC:25417])

HSP 1 Score: 198.364 bits (503), Expect = 4.775e-56
Identity = 133/440 (30.23%), Postives = 228/440 (51.82%), Query Frame = 3
Query:  249 CDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERR-----VSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNS-CCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
             DA EM+ILS L P L C W++  ++   L +VVF+G+   S ++G  SD YGRKT L  +    L++G +S   P   W++++R  +G  IGG   S+ +L +E+ P   R   ++L++ FW +G++F   +   ++P + WR+ L+++ +P+    +   W+PES RY +L   Q K +  + ++  +N +        +S  +D        RDL  P++  TT L+  +WF +  +YYGL+L+ T + +    C        GI   K  V    S  C  +   DY ++L +   E   V ++L  I+ +GRK T  +   I  F  L L  C+   +L++LLF  R  I       Y+YT EV+PT+ R+   G C+  +R+G +++PFI  +++    +L    ++     +A + S  LP ETK R L +++
Sbjct:   96 ADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQED----RGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC--------GISSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYL-TLAVYSGCCLLAALASCFLPIETKGRGLQESS 521          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 184.496 bits (467), Expect = 2.075e-51
Identity = 130/436 (29.82%), Postives = 221/436 (50.69%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLH---KQQAKCLELINQMTRKNTSERRVSDFKDAPMLS--SSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQ 1544
            +A E+++++ + P++ C WQ+  ++   + T+VF G    S +FG  +D YGR   LL +     +F  ++   P+  W + +R  +G  + G+S  +  + +E+ P+ +RG  + L Q FW  GS+ I  +   IIP I WR+ + VA+IP   ++++  +IPES R+ +     +     LE + +M R    E ++ +    P+L     F DL+   Y+ TT  + ++W      YYG+IL    + +    C         +       +     C     SDYR M++S  GEI   P++++ IN +GR+L+ +I         L LN C +   L   LF  R  + +  NT YIYT EV+PT++R+   G   S  RIG +++PFI  ++++  S LG   +F ++  +  I +F LP ETK R L Q
Sbjct:   61 EAMEIMLIAVVSPVIRCEWQLENWQVALVTTMVFFGYMVFSILFGLLADRYGRWKILLISFLWGAYFSLLTSFAPSYIWFVFLRTMVGCGVSGHSQGLI-IKTEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVE----PVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLMSA-SILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 490          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 166.007 bits (419), Expect = 5.037e-46
Identity = 104/334 (31.14%), Postives = 167/334 (50.00%), Query Frame = 3
Query:  558 SEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLH---KQQAKCLELINQMTRKNTSERRVSDFKDAPMLS--SSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQ 1544
            +E+ P+ +RG  + L Q FW  GS+ I  +   IIP I WR+ + VA+IP   ++++  +IPES R+ +     +     LE + +M R    E ++ +    P+L     F DL+   Y+ TT  + ++W      YYG+IL    + +    C         +       +     C     SDYR M++S  GEI   P++++ IN +GR+L+ +I         L LN C +   L   LF  R  + +  NT YIYT EV+PT++R+   G   S  RIG +++PFI  ++++  S LG   +F ++  +  I +F LP ETK R L Q
Sbjct:   10 TEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVE----PVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLMSA-SILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 338          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 166.007 bits (419), Expect = 5.037e-46
Identity = 104/334 (31.14%), Postives = 167/334 (50.00%), Query Frame = 3
Query:  558 SEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLH---KQQAKCLELINQMTRKNTSERRVSDFKDAPMLS--SSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQ 1544
            +E+ P+ +RG  + L Q FW  GS+ I  +   IIP I WR+ + VA+IP   ++++  +IPES R+ +     +     LE + +M R    E ++ +    P+L     F DL+   Y+ TT  + ++W      YYG+IL    + +    C         +       +     C     SDYR M++S  GEI   P++++ IN +GR+L+ +I         L LN C +   L   LF  R  + +  NT YIYT EV+PT++R+   G   S  RIG +++PFI  ++++  S LG   +F ++  +  I +F LP ETK R L Q
Sbjct:   10 TEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVE----PVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLMSA-SILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 338          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Human
Match: SVOPL (SVOP like [Source:HGNC Symbol;Acc:HGNC:27034])

HSP 1 Score: 152.91 bits (385), Expect = 6.217e-41
Identity = 98/316 (31.01%), Postives = 156/316 (49.37%), Query Frame = 3
Query:  612 FWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLH---KQQAKCLELINQMTRKNTSERRVSDFKDAPMLS--SSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQ 1544
            FW  GS+ I  +   IIP I WR+ + VA+IP   ++++  +IPES R+ +     +     LE + +M R    E ++ +    P+L     F DL+   Y+ TT  + ++W      YYG+IL    + +    C         +       +     C     SDYR M++S  GEI   P++++ IN +GR+L+ +I         L LN C +   L   LF  R  + +  NT YIYT EV+PT++R+   G   S  RIG +++PFI  ++++  S LG   +F ++  +  I +F LP ETK R L Q
Sbjct:   60 FWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVE----PVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLMSA-SILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 370          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Celegans
Match: svop-1 (Putative transporter svop-1 [Source:UniProtKB/Swiss-Prot;Acc:P30638])

HSP 1 Score: 178.718 bits (452), Expect = 1.458e-49
Identity = 121/437 (27.69%), Postives = 215/437 (49.20%), Query Frame = 3
Query:  249 CDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSE----RRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
             DA EM++LS + P L C W ++  +   + T VF G+   S  +GK  D +GR+  L  +       G +S ++P  Y ++  R   G  IGG   S+ +L +E+ P+  R   +VL++ FW +G++F   + + ++    WR  + ++++P+    ++  W+PES R+ +      + LE +    R N  +    R VS  K          +L+ P+   TT L+  +W I+  +YYG++L  TV+ +    C        G+  N   + +    C  +  SDY ++L +   E   + I+++ I   GRK T  +  ++       L FCL    +++L+F  R  I       Y+YT EV+PT++R+   G C++ +RIG I++PFI   + ++ S      I+ T   + +I S  LP ETK R++  +
Sbjct:   95 ADAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRGLTGFGIGGVPQSV-TLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALMFLSSLPLGIFAVASFWLPESARFDMASGHPERALETLQAAARMNRVQLPTGRLVSSTKAGSESRGDIANLLSPDLRKTTILLWCIWAITAFSYYGMVLFTTVLFQSHDECH------GGLFSNGTQMEV----CQPLTRSDYFDLLSTTLAEFPGLIITVLIIEWFGRKKTMALEYAVFAIFTFLLYFCLDRFTVTVLIFVARAFISGAFQCAYVYTPEVYPTTLRAVGLGTCSAMARIGAIVTPFIAQ-VASEKSLSLPIGIYGTAAILGLIASLSLPIETKGRQMMDS 519          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Celegans
Match: svop-1 (Putative transporter svop-1 [Source:UniProtKB/Swiss-Prot;Acc:P30638])

HSP 1 Score: 178.718 bits (452), Expect = 1.458e-49
Identity = 121/437 (27.69%), Postives = 215/437 (49.20%), Query Frame = 3
Query:  249 CDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSE----RRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
             DA EM++LS + P L C W ++  +   + T VF G+   S  +GK  D +GR+  L  +       G +S ++P  Y ++  R   G  IGG   S+ +L +E+ P+  R   +VL++ FW +G++F   + + ++    WR  + ++++P+    ++  W+PES R+ +      + LE +    R N  +    R VS  K          +L+ P+   TT L+  +W I+  +YYG++L  TV+ +    C        G+  N   + +    C  +  SDY ++L +   E   + I+++ I   GRK T  +  ++       L FCL    +++L+F  R  I       Y+YT EV+PT++R+   G C++ +RIG I++PFI   + ++ S      I+ T   + +I S  LP ETK R++  +
Sbjct:   95 ADAMEMMLLSLISPALACEWGISSVQQALVTTCVFSGMMLSSTFWGKICDRFGRRKGLTFSTLVACIMGVISGMSPHFYVLLFFRGLTGFGIGGVPQSV-TLYAEFLPTAQRAKCVVLIESFWAIGAVFEALLAYFVMESFGWRALMFLSSLPLGIFAVASFWLPESARFDMASGHPERALETLQAAARMNRVQLPTGRLVSSTKAGSESRGDIANLLSPDLRKTTILLWCIWAITAFSYYGMVLFTTVLFQSHDECH------GGLFSNGTQMEV----CQPLTRSDYFDLLSTTLAEFPGLIITVLIIEWFGRKKTMALEYAVFAIFTFLLYFCLDRFTVTVLIFVARAFISGAFQCAYVYTPEVYPTTLRAVGLGTCSAMARIGAIVTPFIAQ-VASEKSLSLPIGIYGTAAILGLIASLSLPIETKGRQMMDS 519          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Celegans
Match: B0252.3 (Putative transporter B0252.3 [Source:UniProtKB/Swiss-Prot;Acc:Q10917])

HSP 1 Score: 75.0998 bits (183), Expect = 1.186e-14
Identity = 86/322 (26.71%), Postives = 142/322 (44.10%), Query Frame = 3
Query:  615 WGVGSIFITSVGFAIIPRISWRFFLLVATIP-IYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDF-KDAPMLSSSFRDLV-----HPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFF-TRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAI---IISFVLPYETKNRKLYQT 1547
            W VG+ F+  + + I+P   WR+ +   ++P I+  LL  + +PES  +L+  +Q  K +E   +  R    +   SD  +D     SSF+ L      H  +IV   +M  +W +    Y+GL    T                                   +  + Y N +L +  E      S +F+N  GRK+  +  T II  G+ FL   L+     I  +   + AI     + Y++ +E+FPT  R+   GFC + SR GG++SP++ +  +T    L   I   TL+ IA+   +++ +LP ET N KL  T
Sbjct:    2 WVVGACFLGLLAY-ILP--DWRYLMFCISVPNIFVALLIYMTVPESLHFLVSSQQNEK-IEAWLEKIRGPKGDISASDIVEDRDENGSSFKTLCREMWKHKMFIVYVLVMTYIWIVDTFIYFGLAFYST----------------------------------NLAGNLYLNFVLMSLVEAPAYIFSPIFMNKYGRKVLIS-GTHIIA-GLSFLGIVLSSEAWHIHFWLLGKFAISCSFMSIYMFASEIFPTDGRNKCIGFCETLSRFGGMLSPYLSH--LTAVHALAPAI---TLSLIAVSGGLLTLILP-ETLNTKLPST 277          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Celegans
Match: B0252.3 (Putative transporter B0252.3 [Source:UniProtKB/Swiss-Prot;Acc:Q10917])

HSP 1 Score: 76.2554 bits (186), Expect = 1.658e-14
Identity = 104/396 (26.26%), Postives = 170/396 (42.93%), Query Frame = 3
Query:  393 SDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIP-IYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDF-KDAPMLSSSFRDLV-----HPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFF-TRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAI---IISFVLPYETKNRKLYQT 1547
            +D YGR    + T   +   G +S  + +I    I+R   G+F      + + L  E TP   R    V     W VG+ F+  + + I+P   WR+ +   ++P I+  LL  + +PES  +L+  +Q  K +E   +  R    +   SD  +D     SSF+ L      H  +IV   +M  +W +    Y+GL    T                                   +  + Y N +L +  E      S +F+N  GRK+  +  T II  G+ FL   L+     I  +   + AI     + Y++ +E+FPT  R+   GFC + SR GG++SP++ +  +T    L   I   TL+ IA+   +++ +LP ET N KL  T
Sbjct:   95 ADHYGRLPVFVATVLLMAVGGMISAFSTSIMMFCIMRMIHGIFYTAAGLAGWVLGYENTPLRLRFFTSVYFGVMWVVGACFLGLLAY-ILP--DWRYLMFCISVPNIFVALLIYMTVPESLHFLVSSQQNEK-IEAWLEKIRGPKGDISASDIVEDRDENGSSFKTLCREMWKHKMFIVYVLVMTYIWIVDTFIYFGLAFYST----------------------------------NLAGNLYLNFVLMSLVEAPAYIFSPIFMNKYGRKVLIS-GTHIIA-GLSFLGIVLSSEAWHIHFWLLGKFAISCSFMSIYMFASEIFPTDGRNKCIGFCETLSRFGGMLSPYLSH--LTAVHALAPAI---TLSLIAVSGGLLTLILP-ETLNTKLPST 444          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Celegans
Match: B0252.3 (Putative transporter B0252.3 [Source:UniProtKB/Swiss-Prot;Acc:Q10917])

HSP 1 Score: 76.2554 bits (186), Expect = 1.658e-14
Identity = 104/396 (26.26%), Postives = 170/396 (42.93%), Query Frame = 3
Query:  393 SDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIP-IYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDF-KDAPMLSSSFRDLV-----HPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFF-TRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAI---IISFVLPYETKNRKLYQT 1547
            +D YGR    + T   +   G +S  + +I    I+R   G+F      + + L  E TP   R    V     W VG+ F+  + + I+P   WR+ +   ++P I+  LL  + +PES  +L+  +Q  K +E   +  R    +   SD  +D     SSF+ L      H  +IV   +M  +W +    Y+GL    T                                   +  + Y N +L +  E      S +F+N  GRK+  +  T II  G+ FL   L+     I  +   + AI     + Y++ +E+FPT  R+   GFC + SR GG++SP++ +  +T    L   I   TL+ IA+   +++ +LP ET N KL  T
Sbjct:   95 ADHYGRLPVFVATVLLMAVGGMISAFSTSIMMFCIMRMIHGIFYTAAGLAGWVLGYENTPLRLRFFTSVYFGVMWVVGACFLGLLAY-ILP--DWRYLMFCISVPNIFVALLIYMTVPESLHFLVSSQQNEK-IEAWLEKIRGPKGDISASDIVEDRDENGSSFKTLCREMWKHKMFIVYVLVMTYIWIVDTFIYFGLAFYST----------------------------------NLAGNLYLNFVLMSLVEAPAYIFSPIFMNKYGRKVLIS-GTHIIA-GLSFLGIVLSSEAWHIHFWLLGKFAISCSFMSIYMFASEIFPTDGRNKCIGFCETLSRFGGMLSPYLSH--LTAVHALAPAI---TLSLIAVSGGLLTLILP-ETLNTKLPST 444          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Fly
Match: CG4324 (gene:FBgn0034956 transcript:FBtr0343347)

HSP 1 Score: 167.162 bits (422), Expect = 1.772e-45
Identity = 119/428 (27.80%), Postives = 206/428 (48.13%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSE----RRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYET 1523
            D+ EM ILS LGP L C W VT F+  ++ TVVF+G+   S  + + S+ YGRK+AL      L+ +  +S V P+  W++ +R  +G  IG    S+ +L +E+ P+ H+G  +VL+  FW +G+ F   +   + P   WR  L ++  P+    +   W+ ES RY   +    K ++++ Q+   N       R ++D  D P  + SFR L+ P+   TT L+  +W  S   YYGL+L+ T +                + +NK +     + C     SD+ ++L     E   + +++  +   G+K T  +    +    L L    +    S+ LF  RG I       Y+YT E++P ++RS     C+  +R+G +++PF+  +++   S +     +  +  +A I    LP ET
Sbjct:   69 DSMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSALTLFGVLLVLYSILSSVAPSYAWLLTLRGLVGFAIGCVPQSV-TLYAEFLPTKHKGKCVVLMDCFWALGACFEVVLALVVYPYYGWRGLLALSATPLLIFTILSPWLSESARYYSYNGHNDKAIKVLEQIAHNNKRHMLMGRLMAD--DEPSCAESFRSLLSPSLYRTTILLWFLWLASAFCYYGLVLVTTELL---------------VARNKES---HPNECVTFMTSDFMDLLWITLSEFPGILLTIKVVKLFGKKKTIVLQYLALVLCTLVLMSVESRFSTSVTLFIARGTISGIFQAIYVYTPEIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLMDS-SRIQAMSTYAIVGLLASIACVFLPRET 474          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Fly
Match: CG4324 (gene:FBgn0034956 transcript:FBtr0072197)

HSP 1 Score: 167.162 bits (422), Expect = 1.772e-45
Identity = 119/428 (27.80%), Postives = 206/428 (48.13%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSE----RRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYET 1523
            D+ EM ILS LGP L C W VT F+  ++ TVVF+G+   S  + + S+ YGRK+AL      L+ +  +S V P+  W++ +R  +G  IG    S+ +L +E+ P+ H+G  +VL+  FW +G+ F   +   + P   WR  L ++  P+    +   W+ ES RY   +    K ++++ Q+   N       R ++D  D P  + SFR L+ P+   TT L+  +W  S   YYGL+L+ T +                + +NK +     + C     SD+ ++L     E   + +++  +   G+K T  +    +    L L    +    S+ LF  RG I       Y+YT E++P ++RS     C+  +R+G +++PF+  +++   S +     +  +  +A I    LP ET
Sbjct:   69 DSMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSALTLFGVLLVLYSILSSVAPSYAWLLTLRGLVGFAIGCVPQSV-TLYAEFLPTKHKGKCVVLMDCFWALGACFEVVLALVVYPYYGWRGLLALSATPLLIFTILSPWLSESARYYSYNGHNDKAIKVLEQIAHNNKRHMLMGRLMAD--DEPSCAESFRSLLSPSLYRTTILLWFLWLASAFCYYGLVLVTTELL---------------VARNKES---HPNECVTFMTSDFMDLLWITLSEFPGILLTIKVVKLFGKKKTIVLQYLALVLCTLVLMSVESRFSTSVTLFIARGTISGIFQAIYVYTPEIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLMDS-SRIQAMSTYAIVGLLASIACVFLPRET 474          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Fly
Match: CG3168 (gene:FBgn0029896 transcript:FBtr0340268)

HSP 1 Score: 87.8113 bits (216), Expect = 6.094e-18
Identity = 107/441 (24.26%), Postives = 198/441 (44.90%), Query Frame = 3
Query:  246 SCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRI-----------SWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQM----TRKNTSERRVSDFK-DAPMLSSSF-----------------RDLVHPNYIVTTFLMCLMWFISGLTYYGLIL-ILTVINKIP--HRCLQDMSV-VSGILKNKMNVTIDNS----CCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRK--LTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQ 1439
            + +  +++ +SF+ P   C+  +       L +++FIG+  G+  +G  +D +GRK  L+  +    F    S  + T  + ++ RF  G  +GG+   I+S  +E+ P   RG+ +  +  FW  G++F+ S+ + IIPR            SWR FLLV ++P + V   + ++PESP++LL   ++ + L +   +    T++   E  V D + D  +L S+                  R L     +  T +   + F   + YYGL++    + N+     +   D S  V  +    +N+  + S    C   +  S +   L+S +  +    ++++ ++ +GRK  L     T+ IC  +++        L+   +F   GAI +         TEVFPT +R+         +R+GGI    I NI+I Q
Sbjct:  162 TSEEMDVISMSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRKKVLIVISFMNAFCIVASSFSQTYSFFMLFRFLNGAALGGSGPVIWSYFAEFQPKAKRGSMLSFMAAFWTFGNLFVASLAWLIIPRTIGFTTPYFTYNSWRIFLLVCSLPSFLVGFLLFYLPESPKFLLTRGKKDRALAIFRGIFVTNTKRRPDEYMVYDLEVDEKLLESNGNVKNKYSRMISGMVDHSRALFKSPILRFTIVSITINFTFHIGYYGLLMWFPELFNRFEEYEKAFPDQSAGVCAVTDYVVNLAKEQSNNGTCSSDIPQSVFMESLISLASALPANLLAILGMDMLGRKFFLIAGTMTAGICSALMYFVRSSVQNLVVSAIF--SGAISAANAALDCLITEVFPTKLRATGVAISMVAARLGGI----IGNIVIAQ 596          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Fly
Match: CG3168 (gene:FBgn0029896 transcript:FBtr0340266)

HSP 1 Score: 87.8113 bits (216), Expect = 6.094e-18
Identity = 107/441 (24.26%), Postives = 198/441 (44.90%), Query Frame = 3
Query:  246 SCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRI-----------SWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQM----TRKNTSERRVSDFK-DAPMLSSSF-----------------RDLVHPNYIVTTFLMCLMWFISGLTYYGLIL-ILTVINKIP--HRCLQDMSV-VSGILKNKMNVTIDNS----CCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRK--LTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQ 1439
            + +  +++ +SF+ P   C+  +       L +++FIG+  G+  +G  +D +GRK  L+  +    F    S  + T  + ++ RF  G  +GG+   I+S  +E+ P   RG+ +  +  FW  G++F+ S+ + IIPR            SWR FLLV ++P + V   + ++PESP++LL   ++ + L +   +    T++   E  V D + D  +L S+                  R L     +  T +   + F   + YYGL++    + N+     +   D S  V  +    +N+  + S    C   +  S +   L+S +  +    ++++ ++ +GRK  L     T+ IC  +++        L+   +F   GAI +         TEVFPT +R+         +R+GGI    I NI+I Q
Sbjct:  162 TSEEMDVISMSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRKKVLIVISFMNAFCIVASSFSQTYSFFMLFRFLNGAALGGSGPVIWSYFAEFQPKAKRGSMLSFMAAFWTFGNLFVASLAWLIIPRTIGFTTPYFTYNSWRIFLLVCSLPSFLVGFLLFYLPESPKFLLTRGKKDRALAIFRGIFVTNTKRRPDEYMVYDLEVDEKLLESNGNVKNKYSRMISGMVDHSRALFKSPILRFTIVSITINFTFHIGYYGLLMWFPELFNRFEEYEKAFPDQSAGVCAVTDYVVNLAKEQSNNGTCSSDIPQSVFMESLISLASALPANLLAILGMDMLGRKFFLIAGTMTAGICSALMYFVRSSVQNLVVSAIF--SGAISAANAALDCLITEVFPTKLRATGVAISMVAARLGGI----IGNIVIAQ 596          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Fly
Match: CG3168 (gene:FBgn0029896 transcript:FBtr0340267)

HSP 1 Score: 87.8113 bits (216), Expect = 6.094e-18
Identity = 107/441 (24.26%), Postives = 198/441 (44.90%), Query Frame = 3
Query:  246 SCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRI-----------SWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQM----TRKNTSERRVSDFK-DAPMLSSSF-----------------RDLVHPNYIVTTFLMCLMWFISGLTYYGLIL-ILTVINKIP--HRCLQDMSV-VSGILKNKMNVTIDNS----CCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRK--LTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQ 1439
            + +  +++ +SF+ P   C+  +       L +++FIG+  G+  +G  +D +GRK  L+  +    F    S  + T  + ++ RF  G  +GG+   I+S  +E+ P   RG+ +  +  FW  G++F+ S+ + IIPR            SWR FLLV ++P + V   + ++PESP++LL   ++ + L +   +    T++   E  V D + D  +L S+                  R L     +  T +   + F   + YYGL++    + N+     +   D S  V  +    +N+  + S    C   +  S +   L+S +  +    ++++ ++ +GRK  L     T+ IC  +++        L+   +F   GAI +         TEVFPT +R+         +R+GGI    I NI+I Q
Sbjct:  162 TSEEMDVISMSFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSFGRKKVLIVISFMNAFCIVASSFSQTYSFFMLFRFLNGAALGGSGPVIWSYFAEFQPKAKRGSMLSFMAAFWTFGNLFVASLAWLIIPRTIGFTTPYFTYNSWRIFLLVCSLPSFLVGFLLFYLPESPKFLLTRGKKDRALAIFRGIFVTNTKRRPDEYMVYDLEVDEKLLESNGNVKNKYSRMISGMVDHSRALFKSPILRFTIVSITINFTFHIGYYGLLMWFPELFNRFEEYEKAFPDQSAGVCAVTDYVVNLAKEQSNNGTCSSDIPQSVFMESLISLASALPANLLAILGMDMLGRKFFLIAGTMTAGICSALMYFVRSSVQNLVVSAIF--SGAISAANAALDCLITEVFPTKLRATGVAISMVAARLGGI----IGNIVIAQ 596          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Zebrafish
Match: svopa (SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-060526-336])

HSP 1 Score: 189.504 bits (480), Expect = 3.647e-53
Identity = 128/434 (29.49%), Postives = 225/434 (51.84%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLS-SSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
            DA EM+ILS L P L C W +  +E   L +VVFIG+   S ++G  SD YGRKT L  +    LF+G +S   P   W++ +R  +G  IGG   S+ +L +E+ P   R T ++L++ FW +G++F   +   ++P + WR+ L ++TIP++       W+PES RY +L   Q K L  + ++  +N     +     A        +DL  P++  TT L+  +WF +  +YYG++L+ T +        Q+  V  G   +KM       C + + + DY+++L +   E   + ++L  I+ +GR+ T  +   +    ++ L  C+  T L++ +F  R  I       Y+YT EV+PT+ R+   G  +  +R+G +++PF+  +++    +L  + ++     +A I S  LP ET  R L +++
Sbjct:   86 DAMEMMILSILAPQLHCEWALPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSAFAPIYGWILFLRALVGFGIGGAPQSV-TLYAEFLPMRSRATCILLIEIFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAFLCFWLPESARYDVLTGNQEKALNTLKRIAAENNVPMPLGKLIVARQEDRGKIQDLFSPHFRWTTVLLWFIWFSNAFSYYGVVLLTTEL-------FQEGGVCGGAKGSKMEPGCSLECKY-LNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFFVFSLCIVPLYSCVGRTSLTVFIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVMLESSVYLTLS-VYCCCCLLAAIASCALPIETTGRGLQESS 509          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Zebrafish
Match: svopa (SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-060526-336])

HSP 1 Score: 189.504 bits (480), Expect = 4.190e-53
Identity = 128/434 (29.49%), Postives = 225/434 (51.84%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLS-SSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
            DA EM+ILS L P L C W +  +E   L +VVFIG+   S ++G  SD YGRKT L  +    LF+G +S   P   W++ +R  +G  IGG   S+ +L +E+ P   R T ++L++ FW +G++F   +   ++P + WR+ L ++TIP++       W+PES RY +L   Q K L  + ++  +N     +     A        +DL  P++  TT L+  +WF +  +YYG++L+ T +        Q+  V  G   +KM       C + + + DY+++L +   E   + ++L  I+ +GR+ T  +   +    ++ L  C+  T L++ +F  R  I       Y+YT EV+PT+ R+   G  +  +R+G +++PF+  +++    +L  + ++     +A I S  LP ET  R L +++
Sbjct:   96 DAMEMMILSILAPQLHCEWALPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSAFAPIYGWILFLRALVGFGIGGAPQSV-TLYAEFLPMRSRATCILLIEIFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAFLCFWLPESARYDVLTGNQEKALNTLKRIAAENNVPMPLGKLIVARQEDRGKIQDLFSPHFRWTTVLLWFIWFSNAFSYYGVVLLTTEL-------FQEGGVCGGAKGSKMEPGCSLECKY-LNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMALCFFVFSLCIVPLYSCVGRTSLTVFIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVMLESSVYLTLS-VYCCCCLLAAIASCALPIETTGRGLQESS 519          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Zebrafish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 176.792 bits (447), Expect = 9.878e-49
Identity = 123/444 (27.70%), Postives = 224/444 (50.45%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTS--------ERRVSDFKDA-PMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCF--QMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
            +A E+++L+ + P + C W +  ++   + T+VF G      + G  +D YGR   +        +F  ++  + +  W I +R  +G  +   S   + L +E+ P+ +R   + L   FW +GSI I  +G  ++P + WR+ +  + IP   ++   ++IPES R+ +        +  + ++ + N          E  V++  +A  ++SS+FR         T+ L+   WF++  +YYG +L  + + +    C+ D       L++++    + + C+     + DY+ +L+S  GE+  +P++++ +N VGRK +  I   +  F  + +N C T    +ILLF  R  +    N  YIYT EV+PTS+RS   GFC S+SRIGG+++PFI  +++++   L  +  F T   I  I  F LP ET+ R L Q A
Sbjct:   78 EAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQG-FVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRR--------TSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTDPD-----LEHQIKHIQEETLCYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSKSVILALS-PFATACIICAIGVFFLPIETRGRALLQDA 506          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Zebrafish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 176.792 bits (447), Expect = 9.878e-49
Identity = 123/444 (27.70%), Postives = 224/444 (50.45%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTS--------ERRVSDFKDA-PMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCF--QMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
            +A E+++L+ + P + C W +  ++   + T+VF G      + G  +D YGR   +        +F  ++  + +  W I +R  +G  +   S   + L +E+ P+ +R   + L   FW +GSI I  +G  ++P + WR+ +  + IP   ++   ++IPES R+ +        +  + ++ + N          E  V++  +A  ++SS+FR         T+ L+   WF++  +YYG +L  + + +    C+ D       L++++    + + C+     + DY+ +L+S  GE+  +P++++ +N VGRK +  I   +  F  + +N C T    +ILLF  R  +    N  YIYT EV+PTS+RS   GFC S+SRIGG+++PFI  +++++   L  +  F T   I  I  F LP ET+ R L Q A
Sbjct:   78 EAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQG-FVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRR--------TSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTDPD-----LEHQIKHIQEETLCYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSKSVILALS-PFATACIICAIGVFFLPIETRGRALLQDA 506          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Zebrafish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 172.94 bits (437), Expect = 3.683e-47
Identity = 122/439 (27.79%), Postives = 220/439 (50.11%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTS--------ERRVSDFKDA-PMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSC-CFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKL 1538
            +A E+++L+ + P + C W +  ++   + T+VF G      + G  +D YGR   +        +F  ++  + +  W I +R  +G  +   S   + L +E+ P+ +R   + L   FW +GSI I  +G  ++P + WR+ +  + IP   ++   ++IPES R+ +        +  + ++ + N          E  V++  +A  ++SS+FR         T+ L+   WF++  +YYG +L  + + +    C+ D  +   I     ++  +  C C    + DY+ +L+S  GE+  +P++++ +N VGRK +  I   +  F  + +N C T    +ILLF  R  +    N  YIYT EV+PTS+RS   GFC S+SRIGG+++PFI  +++++   L  +  F T   I  I  F LP ET+ R L
Sbjct:   78 EAMEIMLLAVVSPEIRCEWHLEDWQVALVSTMVFFGFMVCGVLCGYIADKYGRWKVVFGGFVWASYFSFLTSFSTSYGWFIFLRCMVGCGVAATSQG-FVLKTEFIPAKYRAYLLPLASIFWMMGSILIIVLGMTVVPTMGWRWMIRFSVIPSLVLIGLFMFIPESARFQVSAGNIQGAMSTLKRIAKMNNGVLPEGELREPEVTERGNAVTLISSAFRR--------TSLLLWYSWFVASFSYYGSVLSSSELLEKNLLCVTDPDLEHQI----KHIQEEMLCYCIPFNSDDYQTLLISCLGEVALIPLNIILLNIVGRKYSMVILLLLSAFFFMLVNICTTMLGFTILLFLLRSVVSMNFNVVYIYTAEVYPTSVRSIGMGFCTSFSRIGGMIAPFIAQVLMSKSVILALS-PFATACIICAIGVFFLPIETRGRAL 502          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 197.208 bits (500), Expect = 1.002e-55
Identity = 136/439 (30.98%), Postives = 228/439 (51.94%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERR-----VSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNS-CCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
            DA EM+ILS L P L C W++  ++   L +VVFIG+   S ++G  SD YGR+T L  +    L++G +S   P   W++++R  +G  IGG   S+ +L +E+ P   R   ++L++ FW +G++F   +   ++P + WR+ L+++ +P++   +   W+PES RY +L   Q K L  + ++  +N +        VS  +D        RDL  P +  TT L+  +WF +  +YYGL+L+ T +        Q   V S  LK+K       S  C  +   DY ++L +   E   V I+L  I+ VGRK T  I   +     L L  C+   +L++ LF  R  I       Y+YT EV+PT+ R+   G C+  +R+G +++PFI  +++    +L   +++     +A + S  LP ETK R L +++
Sbjct:   97 DAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQED----RGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTEL-------FQAGDVCSSKLKSKTMCRPKCSLACEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSIYL-TVLVYSGCCVLAALASCFLPIETKGRGLQESS 522          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 196.052 bits (497), Expect = 2.586e-55
Identity = 133/439 (30.30%), Postives = 228/439 (51.94%), Query Frame = 3
Query:  249 CDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERR-----VSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
             DA EM+ILS L P L C W++  ++   L +VVFIG+   S ++G  SD YGR+T L  +    L++G +S   P   W++++R  +G  IGG   S+ +L +E+ P   R   ++L++ FW +G++F   +   ++P + WR+ L+++ +P++   +   W+PES RY +L   Q K L  + ++  +N +        VS  +D        RDL  P +  TT L+  +WF +  +YYGL+L+ T + +    C    +V     K K ++      C  +   DY ++L +   E   V I+L  I+ VGRK T  I   +     L L  C+   +L++ LF  R  I       Y+YT EV+PT+ R+   G C+  +R+G +++PFI  +++    +L   +++     +A + S  LP ETK R L +++
Sbjct:   90 ADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQED----RGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCSSKKAV-----KPKCSLA-----CEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSIYL-TVLVYSGCCVLAALASCFLPIETKGRGLQESS 512          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 195.282 bits (495), Expect = 6.041e-55
Identity = 133/439 (30.30%), Postives = 229/439 (52.16%), Query Frame = 3
Query:  249 CDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERR-----VSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
             DA EM+ILS L P L C W++  ++   L +VVFIG+   S ++G  SD YGR+T L  +    L++G +S   P   W++++R  +G  IGG   S+ +L +E+ P   R   ++L++ FW +G++F   +   ++P + WR+ L+++ +P++   +   W+PES RY +L   Q K L  + ++  +N +        VS  +D        RDL  P +  TT L+  +WF +  +YYGL+L+ T + +    C   +S     +K K ++      C  +   DY ++L +   E   V I+L  I+ VGRK T  I   +     L L  C+   +L++ LF  R  I       Y+YT EV+PT+ R+   G C+  +R+G +++PFI  +++    +L   +++     +A + S  LP ETK R L +++
Sbjct:   95 ADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQED----RGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC--SISNQRKAVKPKCSLA-----CEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSIYL-TVLVYSGCCVLAALASCFLPIETKGRGLQESS 520          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 191.43 bits (485), Expect = 2.681e-53
Identity = 131/438 (29.91%), Postives = 226/438 (51.60%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERR-----VSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
            DA EM+ILS L P L C W++  ++   L +VVFIG+   S ++G  SD YGR+T L  +    L++G +S   P   W++++R  +G  IGG   S+ +L +E+ P   R   ++L++ FW +G++F   +   ++P + WR+ L+++ +P++   +   W+PES RY +L   Q K L  + ++  +N +        VS  +D        RDL  P +  TT L+  +WF +  +YYGL+L+ T           ++      +K K ++      C  +   DY ++L +   E   V I+L  I+ VGRK T  I   +     L L  C+   +L++ LF  R  I       Y+YT EV+PT+ R+   G C+  +R+G +++PFI  +++    +L   +++     +A + S  LP ETK R L +++
Sbjct:  143 DAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQED----RGKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTT-----------ELFQAGDAVKPKCSLA-----CEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSIYL-TVLVYSGCCVLAALASCFLPIETKGRGLQESS 558          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Xenopus
Match: SVOP (SV2 related protein [Source:NCBI gene;Acc:100492312])

HSP 1 Score: 164.081 bits (414), Expect = 9.686e-44
Identity = 123/437 (28.15%), Postives = 217/437 (49.66%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIY-FVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTAGHN 1559
            DA EM+ILS L P L C W++  ++   L +VVFIG+   S ++G  SD YGR+T L  +    L++G +S   P   W++++R  +G  IGG   S+ +L +E+ P   R   ++L++ FW +G++F   +   ++P + WR+ L+++ +P++ F +L  + +     Y        + +  + +  R                     RDL  P +  TT L+  +WF +  +YYGL+L+ T + +    C   +S     +K K ++      C  +   DY ++L +   E   V I+L  I+ VGRK T  I   +     L L  C+   +L++ LF  R  I       Y+YT EV+PT+ R+   G C+  +R+G +++PFI  +++    +L   +++     +A + S  LP ETK R L +++   
Sbjct:   90 DAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVFWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKSRAKCILLIEVFWAIGTVFEVLLAIFVMPTLGWRWLLILSALPLFLFAILCFVSLFYLKLYFYFSFTMKRNILFVLKEDR------------------GKIRDLFSPQFRRTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC--SISNQRKAVKPKCSLA-----CEYLTVEDYTDLLWTTLSEFPGVLITLWIIDRVGRKKTMAICFIVFSLCALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSIYL-TVLVYSGCCVLAALASCFLPIETKGRGLQESSHRE 499          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Mouse
Match: Svopl (SV2 related protein homolog (rat)-like [Source:MGI Symbol;Acc:MGI:2444335])

HSP 1 Score: 183.726 bits (465), Expect = 2.628e-51
Identity = 133/438 (30.37%), Postives = 228/438 (52.05%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRY-LLLHKQQAK--CLELINQMTRKNTSERRVSDFKDAPMLS--SSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQ--MRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQ 1544
            +A E+++++ + P++ C WQ+  ++   + T+VF G    S +FG  +D YGR   LL +     +F  ++  +P+  W + +R  +G  + G++  +  + +E+ P+ +RG  + L Q FW  GS+ I S+   +IP I WR+ + +A+IP   ++++  +IPES R+ +     QA    LE I +M R    E ++ +    P+L     F DL+   Y+ TT  + ++W      YYG+IL    + +    C         +++   +     S C+      SDYR M++S  GEI   P++++ IN +GR+L+ +I         L LN C +   L   LF  R  + +  NT YIYT EV+PT +R+   G   S  RIG +++PFI  ++++  SFLG   +F ++  +  I +F LP ETK R L Q
Sbjct:   61 EAMEIMLIAVVSPVIRCEWQLENWQVAFVTTMVFFGYMVSSILFGLLADRYGRWKILLLSFLWGAYFSLLTSFSPSYIWFVFLRTMVGCGVSGHAQGLI-IKTEFLPTKYRGYMLPLSQVFWLAGSLLIISMASVVIPTIGWRWLIRIASIPGIILIMAFKFIPESARFNVSTGNTQAALNTLESIAKMNRSVMPEGQLVE----PILEKRGRFADLLDSKYLRTTLQIWIIWLGISFAYYGVILASAELLERDLVCGSKSESEPEVVETTGDSGEGLSPCYCHIFAPSDYRTMIISTLGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTIYIYTAEVYPTPMRAIGMGTSGSLCRIGAMVAPFISQVLMSA-SFLGALCLFSSVCVVCAISAFTLPIETKGRALQQ 492          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Mouse
Match: Svop (SV2 related protein [Source:MGI Symbol;Acc:MGI:1915916])

HSP 1 Score: 181.415 bits (459), Expect = 4.592e-50
Identity = 133/440 (30.23%), Postives = 225/440 (51.14%), Query Frame = 3
Query:  249 CDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERR-----VSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNS-CCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
             DA EM+ILS L P L C W++  ++   L +VVFIG+   S ++G  SD YGRKT L  +    L++G +S   P   W++++R  +G  IGG   S+ +L +E+ P   R   ++L++ FW +G++F   +   ++P + WR+ LL++  P+    +   W+PES RY +L   Q K +  + ++  +N +        +S  +D        RDL  P++  TT L+  +WF +  +YYGL+L+ T + +    C         I   K  V    S  C  +   DY ++L +   E   V ++L  I+ +GRK T  +   I     L L  C+   +L++LLF  R  I       Y+YT EV+PT+ R+   G C+  +R+G +++PFI  +++    +L    ++     +A + S  LP ETK R L +++
Sbjct:   96 ADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKARAKCILLIEVFWAIGTVFEVLLAVFVMPSLGWRWLLLLSAAPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQED----RGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC--------SISSRKKAVEAKCSLACEYLSKEDYMDLLWTTLSEFPGVLVTLWVIDRLGRKKTMALCFIIFSLCSLLLFICIGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYL-TLAVYSGCCLLAGVASCFLPIETKGRALQESS 521          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Mouse
Match: Slc22a7 (solute carrier family 22 (organic anion transporter), member 7 [Source:MGI Symbol;Acc:MGI:1859559])

HSP 1 Score: 90.1225 bits (222), Expect = 6.734e-19
Identity = 99/398 (24.87%), Postives = 172/398 (43.22%), Query Frame = 3
Query:  393 SDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLH---KQQAKCLELINQMTRKNTSERRVSDFKDAPMLS-------SSFRDLVHPNYIVTTFLMC-LMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFT--IFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
            SD +GR+  LL      L  G +S  +      +  R   G  + G +  +  L  EW    HR    V+   FW  G + +T VG+ I    SWR+ LL AT+P    ++S+ W+PES R+LL     ++  K L +  ++  +  SE  +S      +++        S+ DL   + +    L C +MWF    +YYGL L              D S         + +T+            Y+  LL  + E+         +  VGR+LT    +  + + FG+  L    T + ++ L+   +   ++   T Y++T+E++PT +R    GF     R+G  ++P +V  ++     L   + +  ++F+A     +LP ETK  +L +T
Sbjct:   40 SDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTTFWTGGVLLLTLVGYLIR---SWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNGRPISEDSLSQEALNKVITMERVSQRPSYLDLFRTSQLRHVSLCCMMMWFGVNFSYYGLTL--------------DAS--------GLGLTV------------YQTQLLFGAVEVPSKITVFFLVRLVGRRLTEAGMLLATALTFGISLLVSSDTKSWITALVVIGKAFSEAAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLAPLVV--LLDGVWLLLPKLAYGGISFLAACTVLLLP-ETKKAQLPET 397          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Mouse
Match: Slc22a1 (solute carrier family 22 (organic cation transporter), member 1 [Source:MGI Symbol;Acc:MGI:108111])

HSP 1 Score: 90.8929 bits (224), Expect = 8.030e-19
Identity = 106/398 (26.63%), Postives = 174/398 (43.72%), Query Frame = 3
Query:  393 SDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRV--SDFK------DA-PMLSSSFRDLVH-PNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFT---IFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
            +D +GRK  LL T       G ++ V P    M++ R   G+   G+  S Y+L++E+  S +R T  +L Q  + VG + +  V +AI     WR+  L  ++P +  LL   ++PESPR+LL  K+  + + ++ Q+ +KN   R+V  +D K      DA    S SF DL   P+    T ++  +WF   + Y GLI+                          +  T  N          Y +   S+  E     I LV I+ +GR        +     C  M+F+   L    +++      GA    Q    +   E++PT IR+     C++   +GGI +PF+V  ++  +  L   I+F  L   A  ++ +LP ETK   L +T
Sbjct:  171 ADRFGRKLCLLVTTLVTSLSGVLTAVAPDYTSMLLFRLLQGMVSKGSWVSGYTLITEFVGSGYRRTTAILYQVAFTVGLVGLAGVAYAIP---DWRWLQLAVSLPTFLFLLYYWFVPESPRWLLSQKRTTQAVRIMEQIAQKN---RKVPPADLKMMCLEEDASERRSPSFADLFRTPSLRKHTLILMYLWFSCAVLYQGLIM-------------------------HVGATGANL---------YLDFFYSSLVEFPAAFIILVTIDRIGRIYPIAASNLVAGAACLLMIFIPHELHWLNVTLACLGRMGATIVLQMVCLV-NAELYPTFIRNLGMMVCSALCDLGGIFTPFMVFRLMEVWQAL-PLILFGVLGLSAGAVTLLLP-ETKGVALPET 525          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Mouse
Match: Slc22a7 (solute carrier family 22 (organic anion transporter), member 7 [Source:MGI Symbol;Acc:MGI:1859559])

HSP 1 Score: 90.8929 bits (224), Expect = 8.065e-19
Identity = 99/398 (24.87%), Postives = 172/398 (43.22%), Query Frame = 3
Query:  393 SDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLH---KQQAKCLELINQMTRKNTSERRVSDFKDAPMLS-------SSFRDLVHPNYIVTTFLMC-LMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFT--IFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
            SD +GR+  LL      L  G +S  +      +  R   G  + G +  +  L  EW    HR    V+   FW  G + +T VG+ I    SWR+ LL AT+P    ++S+ W+PES R+LL     ++  K L +  ++  +  SE  +S      +++        S+ DL   + +    L C +MWF    +YYGL L              D S         + +T+            Y+  LL  + E+         +  VGR+LT    +  + + FG+  L    T + ++ L+   +   ++   T Y++T+E++PT +R    GF     R+G  ++P +V  ++     L   + +  ++F+A     +LP ETK  +L +T
Sbjct:  164 SDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTTFWTGGVLLLTLVGYLIR---SWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNGRPISEDSLSQEALNKVITMERVSQRPSYLDLFRTSQLRHVSLCCMMMWFGVNFSYYGLTL--------------DAS--------GLGLTV------------YQTQLLFGAVEVPSKITVFFLVRLVGRRLTEAGMLLATALTFGISLLVSSDTKSWITALVVIGKAFSEAAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLAPLVV--LLDGVWLLLPKLAYGGISFLAACTVLLLP-ETKKAQLPET 521          
BLAST of Synaptic vesicle 2-related protein vs. UniProt/SwissProt
Match: sp|Q5R5T8|SVOP_PONAB (Synaptic vesicle 2-related protein OS=Pongo abelii OX=9601 GN=SVOP PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.720e-55
Identity = 133/439 (30.30%), Postives = 228/439 (51.94%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERR-----VSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNS-CCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
            DA EM+ILS L P L C W++  ++   L +VVF+G+   S ++G  SD YGRKT L  +    L++G +S   P   W++++R  +G  IGG   S+ +L +E+ P   R   ++L++ FW +G++F   +   ++P + WR+ L+++ +P+    +   W+PES RY +L   Q K +  + ++  +N +        +S  +D        RDL  P++  TT L+  +WF +  +YYGL+L+ T + +    C        GI   K  V    S  C  +   DY ++L +   E   V ++L  I+ +GRK T  +   I  F  L L  C+   +L++LLF  R  I       Y+YT EV+PT+ R+   G C+  +R+G +++PFI  +++    +L    ++     +A + S  LP ETK R L +++
Sbjct:   97 DAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQED----RGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC--------GISSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYL-TLAVYSGCCLLAALASCFLPIETKGRGLQESS 521          
BLAST of Synaptic vesicle 2-related protein vs. UniProt/SwissProt
Match: sp|Q8N4V2|SVOP_HUMAN (Synaptic vesicle 2-related protein OS=Homo sapiens OX=9606 GN=SVOP PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.293e-55
Identity = 133/440 (30.23%), Postives = 228/440 (51.82%), Query Frame = 3
Query:  249 CDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERR-----VSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNS-CCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
             DA EM+ILS L P L C W++  ++   L +VVF+G+   S ++G  SD YGRKT L  +    L++G +S   P   W++++R  +G  IGG   S+ +L +E+ P   R   ++L++ FW +G++F   +   ++P + WR+ L+++ +P+    +   W+PES RY +L   Q K +  + ++  +N +        +S  +D        RDL  P++  TT L+  +WF +  +YYGL+L+ T + +    C        GI   K  V    S  C  +   DY ++L +   E   V ++L  I+ +GRK T  +   I  F  L L  C+   +L++LLF  R  I       Y+YT EV+PT+ R+   G C+  +R+G +++PFI  +++    +L    ++     +A + S  LP ETK R L +++
Sbjct:   96 ADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQED----RGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC--------GISSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYL-TLAVYSGCCLLAALASCFLPIETKGRGLQESS 521          
BLAST of Synaptic vesicle 2-related protein vs. UniProt/SwissProt
Match: sp|Q2XWK0|SVOP_XENLA (Synaptic vesicle 2-related protein OS=Xenopus laevis OX=8355 GN=svop PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.207e-54
Identity = 133/439 (30.30%), Postives = 229/439 (52.16%), Query Frame = 3
Query:  249 CDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERR-----VSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
             DA EM+ILS L P L C W++  ++   L +VVFIG+   S ++G  SD YGR+T L  +    L++G +S   P   W++++R  +G  IGG   S+ +L +E+ P   R   ++L++ FW +G++F   +   ++P + WR+ L+++ +P+    +   W+PES RY +L   Q K L  + ++  +N +        VS  +D        RDL  P +  TT L+  +WF +  +YYGL+L+ T + +    C   +S     +K K ++      C  +   DY ++L +   E   + ++L  I+ VGRK T  I   I  F  L L  C+   +L++ LF  R  I       Y+YT EV+PT+ R+   G C+  +R+G +++PFI  +++    +L   +++     +A + S  LP ETK R L +++
Sbjct:   96 ADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMASSSLWGNVSDQYGRRTGLKISVIWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKSRAKCILLIEIFWALGTVFEVLLAIFVMPTLGWRWLLILSALPLMLFAILCFWLPESARYEVLSGNQEKALATLKRIATENGAPMPLGKLIVSRQED----RGKIRDLFSPQFRCTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC--SISNQRKAVKPKCSLA-----CEYLTVEDYTDLLWTTLSEFPGLLVTLWIIDRVGRKKTMAICFIIFSFSALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSIYL-TVLVYSGCCVLAAVASCFLPIETKGRGLQESS 521          
BLAST of Synaptic vesicle 2-related protein vs. UniProt/SwissProt
Match: sp|Q1JP63|SVOP_BOVIN (Synaptic vesicle 2-related protein OS=Bos taurus OX=9913 GN=SVOP PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.913e-54
Identity = 131/440 (29.77%), Postives = 227/440 (51.59%), Query Frame = 3
Query:  249 CDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERR-----VSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNS-CCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
             DA EM+ILS L P L C W++  ++   L +VVF+G+   S ++G  SD YGRKT L  +    L++G +S   P   W++++R  +G  IGG   S+ +L +E+ P   R   ++L++ FW +G++F   +   ++P + WR+ L+++ +P+    +   W+PES RY +L   Q K +  + ++  +N +        +S  +D        RDL  P++  TT L+  +WF +  +YYGL+L+ T + +    C         I   K  V    S  C  +   DY ++L +   E   V ++L  I+ +GRK T  +   +  F  L L  C+   +L++LLF  R  I       Y+YT EV+PT+ R+   G C+  +R+G +++PFI  +++    +L    ++     +A + S  LP ETK R L +++
Sbjct:   96 ADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSV-TLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQED----RGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVC--------SISSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVVFSFCSLLLFICVGRNMLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYL-TLAVYSGCCLLAALASCFLPIETKGRGLQESS 521          
BLAST of Synaptic vesicle 2-related protein vs. UniProt/SwissProt
Match: sp|Q8N434|SVOPL_HUMAN (Putative transporter SVOPL OS=Homo sapiens OX=9606 GN=SVOPL PE=1 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 9.966e-51
Identity = 130/436 (29.82%), Postives = 221/436 (50.69%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLH---KQQAKCLELINQMTRKNTSERRVSDFKDAPMLS--SSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQ 1544
            +A E+++++ + P++ C WQ+  ++   + T+VF G    S +FG  +D YGR   LL +     +F  ++   P+  W + +R  +G  + G+S  +  + +E+ P+ +RG  + L Q FW  GS+ I  +   IIP I WR+ + VA+IP   ++++  +IPES R+ +     +     LE + +M R    E ++ +    P+L     F DL+   Y+ TT  + ++W      YYG+IL    + +    C         +       +     C     SDYR M++S  GEI   P++++ IN +GR+L+ +I         L LN C +   L   LF  R  + +  NT YIYT EV+PT++R+   G   S  RIG +++PFI  ++++  S LG   +F ++  +  I +F LP ETK R L Q
Sbjct:   61 EAMEIMLIAVVSPVIRCEWQLENWQVALVTTMVFFGYMVFSILFGLLADRYGRWKILLISFLWGAYFSLLTSFAPSYIWFVFLRTMVGCGVSGHSQGLI-IKTEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVE----PVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIISTIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLMSA-SILGALCLFSSVCVVCAISAFTLPIETKGRALQQ 490          
BLAST of Synaptic vesicle 2-related protein vs. TrEMBL
Match: A0A267E881 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029535g4 PE=4 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 2.730e-69
Identity = 146/443 (32.96%), Postives = 242/443 (54.63%), Query Frame = 3
Query:  246 SCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSS-------SFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTI---FTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQ 1544
            + DA EML+LS LGP L C+WQ++  +   + TVVF G+F G+P +G  SD +GR+     + S + +FG +   +P+ +W++ +R  +G  I G +SS ++LLSE+ P  +R   ++    FWG+GS F   + + ++P + WR+    + +P++  +L++ ++PES RYLL   Q  K   +I+Q+ R N    R       P+ +S       +   L HPNY  TT  +  MWF     YYG++LI T I +    C     V  G   N   +  D SCC  ++  DY+ ML+S+ GE + +P +L+ I+ +GR+ T  I    TS+  FG+ ++  C+   + +  LF  R       NT YIYT EV+PT +RS   G C+S +R+G + +PF+  +++   S L    ++ T+     +++ +LP ET+ R + Q
Sbjct:   99 AADAMEMLLLSVLGPALRCDWQLSSAQVAIITTVVFAGMFGGAPAWGAVSDKHGRRGVFGLSLSLIAYFGLLCSFSPSFFWLVSLRGMVGFCISGATSS-FTLLSEYLPQTYRAKVLIAYNVFWGLGSSFEVLLAYMVLPNLGWRYLTAFSALPLFIFMLALGFLPESARYLLASGQPKKAAAVIDQIARDN----RKPPMTGRPVAASVTEADRGTLLSLFHPNYRRTTLTLFFMWFGVAFLYYGIVLISTEIFQFHSDCYGSSEVTVG--HNTTEIVTDESCCRSLQPDDYKAMLISSFGEFVIIPFNLITIDALGRRWTMAINYGLTSVF-FGLTYI--CVPKAVTTAFLFMIRAHAAGIFNTIYIYTVEVYPTVVRSVGLGVCSSIARLGSMSTPFVAQVLMPDVSVLLAFCVYVTVAVACAVLALLLPIETRGRAMPQ 531          
BLAST of Synaptic vesicle 2-related protein vs. TrEMBL
Match: A0A267E6E2 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029535g7 PE=4 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 4.195e-69
Identity = 146/443 (32.96%), Postives = 241/443 (54.40%), Query Frame = 3
Query:  246 SCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSS-------SFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTI---FTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQ 1544
            + DA EML+LS LGP L C+WQ++  +   + TVVF G+F G+P +G  SD +GR+     + S + +FG +   +P+ +W++ +R  +G  I G +SS ++LLSE+ P  +R   ++    FWG+GS F   + + ++P + WR+    + +P++  +L++ ++PES RYLL   Q  K   +I+Q+ R N    R       P+ +S       +   L HPNY  TT  +  MWF     YYG++LI T I      C     V  G   N   +  D SCC  ++  DY+ ML+S+ GE + +P +L+ I+ +GR+ T  I    TS+  FG+ ++  C+   + +  LF  R       NT YIYT EV+PT +RS   G C+S +R+G + +PF+  +++   S L    ++ T+     +++ +LP ET+ R + Q
Sbjct:   99 AADAMEMLLLSVLGPALRCDWQLSSAQVAIITTVVFAGMFGGAPAWGAVSDKHGRRGVFGLSLSLIAYFGLLCSFSPSFFWLVSLRGMVGFCISGATSS-FTLLSEYLPQTYRAKVLIAYNVFWGLGSSFEVLLAYMVLPNLGWRYLTAFSALPLFIFMLALGFLPESARYLLASGQPKKAAAVIDQIARDN----RKPPMTGRPVAASVTEADRGTLLSLFHPNYRRTTLTLFFMWFGVAFLYYGIVLISTEIFHFHSDCYGSSEVTVG--HNTTEIVTDESCCRSLQPDDYKAMLISSFGEFVIIPFNLITIDALGRRWTMAINYGLTSVF-FGLTYI--CVPKAVTTAFLFMIRAHAAGIFNTIYIYTVEVYPTVVRSVGLGVCSSIARLGSMSTPFVAQVLMPDVSVLLAFCVYVTVAVACAVLALLLPIETRGRAMPQ 531          
BLAST of Synaptic vesicle 2-related protein vs. TrEMBL
Match: A0A267GPA2 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029535g2 PE=4 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 5.509e-69
Identity = 146/443 (32.96%), Postives = 241/443 (54.40%), Query Frame = 3
Query:  246 SCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSS-------SFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTI---FTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQ 1544
            + DA EML+LS LGP L C+WQ++  +   + TVVF G+F G+P +G  SD +GR+     + S + +FG +   +P+ +W++ +R  +G  I G +SS ++LLSE+ P  +R   ++    FWG+GS F   + + ++P + WR+    + +P++  +L++ ++PES RYLL   Q  K   +I+Q+ R N    R       P+ +S       +   L HPNY  TT  +  MWF     YYG++LI T I      C     V  G   N   +  D SCC  ++  DY+ ML+S+ GE + +P +L+ I+ +GR+ T  I    TS+  FG+ ++  C+   + +  LF  R       NT YIYT EV+PT +RS   G C+S +R+G + +PF+  +++   S L    ++ T+     +++ +LP ET+ R + Q
Sbjct:   99 AADAMEMLLLSVLGPALRCDWQLSSAQVAIITTVVFAGMFGGAPAWGAVSDKHGRRGVFGLSLSLIAYFGLLCSFSPSFFWLVSLRGMVGFCISGATSS-FTLLSEYLPQTYRAKVLIAYNVFWGLGSSFEVLLAYMVLPNLGWRYLTAFSALPLFIFMLALGFLPESARYLLASGQPKKAAAVIDQIARDN----RKPPMTGRPVAASVTEADRGTLLSLFHPNYRRTTLTLFFMWFGVAFLYYGIVLISTEIFHFHSDCYGSSEVTVG--HNTTEIVTDESCCRSLQPDDYKAMLISSFGEFVIIPFNLITIDALGRRWTMAINYGLTSVF-FGLTYI--CVPKAVTTAFLFMIRAHAAGIFNTIYIYTVEVYPTVVRSVGLGVCSSIARLGSMSTPFVAQVLMPDVSVLLAFCVYVTVAVACAVLALLLPIETRGRAMPQ 531          
BLAST of Synaptic vesicle 2-related protein vs. TrEMBL
Match: A0A1I8HJB3 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 7.749e-69
Identity = 142/443 (32.05%), Postives = 244/443 (55.08%), Query Frame = 3
Query:  246 SCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSS-------SFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTI--FTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
            + DA EML+LS LGP L C+W++T  E   + TVVF G+  G+P +G  SD  GR +    +   + +FG +    P  +W++ +R  +G  IGG +SS ++LLSE+ P  HR   ++L   FWG+GS F   + + ++P + WR+ +  +++P++  +L++  +PES R+LL   +  +   +I+Q+ R+N    R    +  P +++         + L HP Y  T+F++  +WF    +YYG++L+ T I +    C      V+ +  N     +DNSCC  +++ DY  ML+S+ GE + +P++++ I+ +GR+ T  I    + + FG+ +L  C+     +  LF  R       NT YIYTTEV+PT IRS   G C++ +R+G + +PF+  +I+   S L   II+  ++     +  +LP ET  R L  +
Sbjct:    1 AADAMEMLLLSVLGPALRCDWRLTSTEVAGITTVVFAGMLLGAPGWGAVSDKRGRWSVFALSLCLMAYFGLLCSFAPDYFWLVSLRGVVGFNIGGAASS-FTLLSEYLPQQHRAKVLILYNLFWGLGSTFEILLAYLVLPTLGWRYLVAFSSLPLFLFMLTLGHLPESARFLLASGRAEEAAAVIDQIAREN----RRPAMEGLPAVATVSESDRGQLKALFHPFYRRTSFILFSLWFGVAFSYYGIVLVSTEIFRFHQDCFSTAQSVT-VAHNTTESVVDNSCCRGLQSDDYTAMLISSLGEFVIIPVNMLTIDALGRRATLGINYLLTGVFFGLTYL--CVPKAATTAFLFLIRAHSAGIFNTIYIYTTEVYPTVIRSLGLGICSAMARLGSMTTPFVAQVIMPDVSVLLAFIIYLMVDLSCAGLCVLLPIETSGRALAHS 435          
BLAST of Synaptic vesicle 2-related protein vs. TrEMBL
Match: A0A1I8G7A7 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 1.425e-68
Identity = 142/439 (32.35%), Postives = 243/439 (55.35%), Query Frame = 3
Query:  246 SCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTS---ERRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTI--FTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
            + DA EML+LS LGP L C+W++T  E   + TVVF G+  G+P +G  SD  GR +    +   + +FG +   +P  +W++ +R  +G  IGG +SS ++LLSE+ P  HR   ++L   FWG+GS F   + + ++P + WR+ +  +++P++  +L++  +PES R+LL   +  +   +I+Q+ R+N     E R +    +       + L HP Y  T+F++  +WF    +YYG++L+ T I +    C      V+ +  N     +DNSCC  +++ DY  ML+S+ GE + +P++++ I+ +GR+ T  I    + + FG+ +L  C+     +  LF  R       NT YIYTTEV+PT IRS   G C++ +R+G + +PF+  +I+   S L   II+  ++     +  +LP ET  R L  +
Sbjct:  115 AADAMEMLLLSVLGPALRCDWRLTSTEVAGITTVVFAGMLLGAPGWGAVSDKRGRWSVFALSLCLMAYFGLLCSFSPDYFWLVSLRGVVGFNIGGAASS-FTLLSEYLPQQHRAKVLILYNLFWGLGSTFEILLAYLVLPTLGWRYLVAFSSLPLFLFMLTLGHLPESARFLLASGRAEEAAAVIDQIARENRRPAMEGRPAVATVSESDRGQLKALFHPFYRRTSFILFSLWFGVAFSYYGIVLVSTEIFRFHQDCFSTAQSVT-VAHNTTESVVDNSCCRGLQSDDYTAMLISSLGEFVIIPVNMLTIDALGRRATLGINYLLTGVFFGLTYL--CVPKAATTAFLFLIRAHSAGIFNTIYIYTTEVYPTVIRSLGLGICSAMARLGSMTTPFVAQVIMPDVSVLLAFIIYLMVDLSCAGLCVLLPIETSGRALAHS 549          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Cavefish
Match: svopa (SV2 related protein [Source:NCBI gene;Acc:103023877])

HSP 1 Score: 189.504 bits (480), Expect = 5.179e-53
Identity = 131/441 (29.71%), Postives = 230/441 (52.15%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLS-SSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTP-------TLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
            DA EM+ILS L P L C W++  +E   L +VVFIG+   S ++G  SD YGRKT L  +    LF+G +S   P   W++ +R  +G  IGG   S+ +L +E+ P   R T ++L++ FW +G++F   +   ++P + WR+ L ++TIP++   +   W+PES RY +L   Q K L  + ++  +N     +     A        +DL  P++  TT L+  +WF +  +YYGL+L+ T + +    C        G +K +    ++   C  + + DY+++L +   E   + ++L  I+ +GR+ T       +CF  LF + C+ P       T L++L+F  R  I       Y+YT EV+PT+ R+   G  +  +R+G +++PF+  +++    +L  + ++     +A + S  LP ET  R L +++
Sbjct:  100 DAMEMMILSILAPQLHCEWRLPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSSFAPIYGWILFLRALVGFGIGGAPQSV-TLYAEFLPMRSRATCILLIEVFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAILCFWLPESARYDVLSGNQEKALNTLKRIATENKVPMPLGKLIVARQEERGKIKDLFLPHFRWTTILLWFIWFSNAFSYYGLVLLTTELFQEGGAC--------GGIKAEPRCNLE---CKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMA-----LCF--LFFSLCIVPLYACVGRTSLTVLIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVMLESSVYLTLS-VYCCCCLLAAVASCALPIETTGRGLQESS 520          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Cavefish
Match: svopa (SV2 related protein [Source:NCBI gene;Acc:103023877])

HSP 1 Score: 188.734 bits (478), Expect = 9.328e-53
Identity = 132/441 (29.93%), Postives = 227/441 (51.47%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLS-SSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTP-------TLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
            DA EM+ILS L P L C W++  +E   L +VVFIG+   S ++G  SD YGRKT L  +    LF+G +S   P   W++ +R  +G  IGG   S+ +L +E+ P   R T ++L++ FW +G++F   +   ++P + WR+ L ++TIP++   +   W+PES RY +L   Q K L  + ++  +N     +     A        +DL  P++  TT L+  +WF +  +YYGL+L+ T + +    C        G  K        N  C  + + DY+++L +   E   + ++L  I+ +GR+ T       +CF  LF + C+ P       T L++L+F  R  I       Y+YT EV+PT+ R+   G  +  +R+G +++PF+  +++    +L  + ++     +A + S  LP ET  R L +++
Sbjct:   98 DAMEMMILSILAPQLHCEWRLPSWEVALLTSVVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTLFYGILSSFAPIYGWILFLRALVGFGIGGAPQSV-TLYAEFLPMRSRATCILLIEVFWALGTVFEVLLAILVMPTLGWRWLLALSTIPLFIFAILCFWLPESARYDVLSGNQEKALNTLKRIATENKVPMPLGKLIVARQEERGKIKDLFLPHFRWTTILLWFIWFSNAFSYYGLVLLTTELFQEGGAC--------GDTKGSKAEPRCNLECKYLNSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRKTMA-----LCF--LFFSLCIVPLYACVGRTSLTVLIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVMLESSVYLTLS-VYCCCCLLAAVASCALPIETTGRGLQESS 521          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Cavefish
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 147.517 bits (371), Expect = 2.992e-38
Identity = 114/429 (26.57%), Postives = 208/429 (48.48%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKL 1538
            +A E+++L+ + P + C W++  ++   + T+VF+G      + G  +D YGR   +        +F  ++   P+  W I +R  +G  +   S   + L +E+ P+ HR   + L   FW VGS+ I  +G  ++P + WR+ +  + IP   +L+ +  +   PR+ +L        E +N        E  +    +  ++ S +R           + + ++ F++  TYYG +L  + + +    C+ D     GI  N+         C     +DY+ +L+S  GE+  +P+++  +N VGRKL+  I   +     + +N C T    ++LLF  R  +    N  YIYT EV+PTS+RS   GFC S+SRIGG+++PFI  +++++   L  +         A+  + +LP ET+ R L
Sbjct:   61 EAMEIMLLAVVSPEIRCEWRLEDWQVALVSTMVFLGFMICGVLCGYVADKYGRWKVVFGGFVWAAYFSLLTSFAPSYGWFIFLRSMVGCGVAATSQG-FVLKTEFIPAKHRAFLLPLASIFWMVGSLLIIILGMTVVPTLGWRWMIRFSIIP-SLILIGLFQV--KPRWWIL--------EYLNLFI-----ELLLIIVLEVKIILSRYR-----------YSILVLKFVASFTYYGSVLSSSELLEKNLLCVVDADAEHGIKHNQEEALCY---CIPFNMADYQTLLISCLGEVALIPLNIGLLNVVGRKLSMIILLLLSAVFFMLVNVCTTMFGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTSVRSLGMGFCTSFSRIGGMIAPFIAQVLMSKSVLLALSPFSLACCLCAVGTA-LLPIETRGRAL 457          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Cavefish
Match: SLC22A2 (solute carrier family 22 member 2-like [Source:NCBI gene;Acc:103036098])

HSP 1 Score: 85.5001 bits (210), Expect = 3.400e-17
Identity = 103/394 (26.14%), Postives = 176/394 (44.67%), Query Frame = 3
Query:  393 SDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIW-IPESPRYLLLHKQQAKCLELINQMTRKN--TSERRVSDFKD--APMLSSSFRDLVH-PNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFT---IFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
            +D +GRK + L +N      G +  ++P    +++ R   G  + G   + Y L++E        T  VL Q F+  G + +  +   +IP  +WR+  +  T+P Y + LS  W +PESPR+LL   + ++ +E+   M ++N  T  + + + KD  A   + SF DL+  P     T ++   WF S + Y GLI+ L                  GIL+  +                Y + L+S   E     + L  I  +GR+L F    I +   C    F+   +     ++      G   +F+   ++  TE++PT IR+     C++   IGGI++PF++  +   +  L   IIF  L F+A  +  +LP ETK   L +T
Sbjct:  172 ADKFGRKMSFLLSNILNAVTGILVAISPNYISLVVFRALHGFGVKGGWMAAYVLMTE--------TVGVLFQMFFSFGLLLLALI-AYLIP--NWRWLQVAFTVP-YIIFLSYYWFVPESPRWLLSQNKSSRAVEVTQAMAKENKKTLSQNIKNLKDDNAETSTGSFMDLIRTPKIRKHTLILSFNWFTSAVVYQGLIMRL------------------GILRGNI----------------YIDFLISGIVEFPAAFLILFTIERIGRRLPFAAANIVSGAACLITAFIPESVLWLKTAVACIGRLGITMAFEMVVFV-NTELYPTFIRNLGVSVCSTLCDIGGIIAPFLLYRLAVIWLEL-PLIIFGVLAFVAGGLVLLLP-ETKGVPLPET 516          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Cavefish
Match: si:dkey-119m7.4 (solute carrier family 22 member 13-like [Source:NCBI gene;Acc:103028301])

HSP 1 Score: 84.3445 bits (207), Expect = 6.342e-17
Identity = 95/398 (23.87%), Postives = 176/398 (44.22%), Query Frame = 3
Query:  393 SDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWI-PESPRYLLLHKQQAKCLELINQMT-------RKNTSERRVSDFKDAPMLSSSFR--DLVH-PNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGR--KLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
            +D YGR+  +L   +    FG  +   P  +  +++RF +G  + G   + + L +EWT   HR    ++  +F+GVG I +  V + I     WR   L  + P  F+ +  IW+ P+S R+L+ + +Q + ++LI +         + N  E ++++ K    L       DLV  P     + ++  +WF++ L YYGL L ++                       MN+              Y   L+    E+    I+L  +N   R  +L+F     + C   +F+   L P + +IL    +  I +  +  Y+Y+ EVFPT +R    G  +  +R GG+++P I   ++ + S     ++F     +  +++ +LP ET ++ L  T
Sbjct:  139 ADRYGRRIIILVGLALQAMFGVGAAFAPNFFIYVLLRFVVGTTVSGIIMNAFVLGTEWTGPKHRMLAGIITDYFFGVGYILLAGVAYLI---RDWRKLQLAISAP-GFIFIFYIWVLPKSARWLMANGKQEEAMDLICKAALINKKPLKGNDMEFQLNNCKVEQKLQRKHTVVDLVRTPQMRKQSLILFYLWFVNVLVYYGLSLNVSDFG--------------------MNI--------------YLTQLIFGLVEMPARTITLFTLNRSRRISQLSFLAVGGLACLLTIFIPQNL-PVVRTILAMLGKFGITASLSIVYVYSAEVFPTVVRQNGIGMGSMCARAGGVIAPIIY--LLRRISPHAPMVVFGLCPLVGALLTILLP-ETAHKPLPDT 494          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Sea Lamprey
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 192.2 bits (487), Expect = 2.870e-55
Identity = 137/438 (31.28%), Postives = 238/438 (54.34%), Query Frame = 3
Query:  249 CDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPM-LSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSC-CFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLF--LNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTE--VFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQ 1544
             ++ E+++LS + P + C W++  ++   + T+VF G    S   G  +D YGR   LL       ++  +S  +PT  W + +RF +G  IGG S   + L+SE+ PS  RG  + + Q FW +GS+    + + I+P + W + + ++TIP + +L++  +IPES RY +   +  K L  + ++ + N +        + P     +  DL+   Y+ TT     +WF + LTYYGLIL+ + + +    C  D   V+ I ++      ++ C C Q ++ DY+ +LLS+ GE + +P + + I+T+GR+ +  +  S+I  G+L+  LN C T   L++LLFF R    +  N  YIYT E  V+PT+IRS   G C+S +RIG +++PF+  +I+   S      +F T+  I  +++F LP ET  R++ +
Sbjct:   60 AESMEIMLLSVISPTIQCEWRLQQWQVALVTTMVFFGFMLSSGPCGFLADRYGRWKVLLLVTIWSSYWSGISSFSPTYGWFVFLRFLMGCGIGGQSQG-FVLMSEFMPSTARGRVLPMSQVFWVLGSLLEVVLAYLILPTLGWAWLIRISTIPSFVLLIAFKFIPESARYQVSAAKPDKALLTLAKIAKMNKTTLPQGTLVEPPAERRGNIWDLLDRQYLRTTLQTWPIWFGTTLTYYGLILVSSELLERNQMCGDD--SVTAIEEHIAFSEQESPCFCKQFKSEDYKTLLLSSFGEFLAIPFTTLTIDTLGRRRSMAL--SMILCGLLYYLLNICTTRMGLTVLLFFLRAVASTNFNIIYIYTVEVKVYPTNIRSLGLGSCSSTARIGAMIAPFVAQVIL-DISIPLALCLFGTVCVICSVLAFTLPIETMGREMKE 491          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Sea Lamprey
Match: oct2 (organic cation transporter 2 [Source:ZFIN;Acc:ZDB-GENE-080204-92])

HSP 1 Score: 81.6481 bits (200), Expect = 1.085e-16
Identity = 97/402 (24.13%), Postives = 171/402 (42.54%), Query Frame = 3
Query:  393 SDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWI-PESPRYLLLHKQQAKCLELINQMT-----------RKNTSERRVSDFKDAPMLSSSFRDLVHPNYIVT-TFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLS----ILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
            SD YGR+ +L+ +      FG +    P     + +R   G+F  G+ ++++   +E+  S  R    ++LQ F+  G I ++ + + +    +WR+  L  T+P   VL S  W+ PESPR+L+   ++ +   ++ ++            RKN  E   +D K     + S  DL+    I   T ++ + WF+ G+ Y GL +                        +  N+  D    F          L+    EI    + +  I+ VGR+L   +   +   G+  L   L P  +      L+   R  +        +   E++PT +R+ A   C+S S IGGI++PF++  + T +  L   +IF TL  I   +  +LP ET    L +T
Sbjct:  178 SDRYGRRWSLMVSIVMQTIFGVLVAFAPNYAAFVCMRTLQGIFNMGSWTTVFVTATEFVGSGQRRVVHMVLQMFFSFGVIMLSGIAYYLR---TWRYLQLALTLP-NVVLFSYYWLLPESPRWLISQNRKEQAFGVLKKIASVNGRELSDNIRKNFEEVTRADEKAG---NPSIADLMRSAKIRKYTVVLMIYWFVVGVVYQGLAM------------------------STGNIGDDVYLAF----------LMGGLAEIPGALMVIALIDRVGRRLPMCVAPGL--SGLACLATALVPHDIGWLNITLVTLGRLGLTMAYEMVTLVNNELYPTHLRNMAMSTCSSLSGIGGIVAPFVLYRLYTIWRHL-PMVIFGTLAIIGGFVILLLP-ETNGLPLPET 534          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002617.1 (pep scaffold:Pmarinus_7.0:GL485729:386:8898:-1 gene:ENSPMAG00000002389.1 transcript:ENSPMAT00000002617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.938e-8
Identity = 47/164 (28.66%), Postives = 79/164 (48.17%), Query Frame = 3
Query: 1101 YRNMLLSASGEIIFVPISLVFINT--VGRKLTFTIFTSIICFGMLFLNFCLTPTLLS----------ILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAI---IISFVLPYETKNRKLYQT 1547
            +  + LS   E+   P+SL  IN    GR+   + F S  C G+  +      TL             L    +  I +  +  YIYT+E++PTSIR+ A G  ++ SR+GGI++PFI +  + + S++  ++ F  L    +    +  +LP ET  + L +T
Sbjct:   22 HMGLALSGLAELPSYPLSLFLINASWCGRRRGLSGFLS--CGGIACIAVAALVTLSGEHEGCAVARQYLALAGKLCISAAFSIVYIYTSELYPTSIRNVALGLSSTSSRLGGILAPFIPS--LREQSWVMPSLPFMVLGLAGVSAGCLCLLLP-ETLRQPLMET 180          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Sea Lamprey
Match: slc22a6l (solute carrier family 22 member 6, like [Source:NCBI gene;Acc:404609])

HSP 1 Score: 53.5286 bits (127), Expect = 4.525e-8
Identity = 74/361 (20.50%), Postives = 130/361 (36.01%), Query Frame = 3
Query:  561 EWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPM--LSSSFRDLVHPNYIVT-------------TFLMCLMWFISGLTYY-GLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCL------TPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIV-------NIIITQY---SFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
            EW     R  + +L    +  G + + ++ + I     WR      +   Y   L     PES R+L++     + L  + ++   N  +R  +    +P+  L     +   P    T             T +M L+W      +Y G ++I+T      H  L  + V+ G +     V          R +     L  AS                                    +FCL      + T  + L    +GA+    N  Y+YT E+FPT IR    G C++ +R+GG+++P ++        + ++ Y   S + G++++F            LP ET NR L +T
Sbjct:    2 EWIAMKDRTLYGMLSGVAYTTGQLVLVALAYYIR---DWRHLQHSISAAFYVFFLCSWCTPESARWLVMRGHYERALHGLKRVAVINGRKREAAQLT-SPLQYLRKELEEDTGPRRFYTMFNLLTIPALRRRTLVMSLVWCDDVFCWYAGFVVIVT--RTCAHTFL--LQVIYGAIDYPAKVVGLVVLSLLGRRATQAGSLAVAS----------------------------------IASFCLLAIPAESGTARTCLAVLGKGALSCSFNCAYLYTGEIFPTVIRQSGLGLCSTMARVGGMLAPLVIMAGESLPALPLSMYGSASLVAGSLVYF------------LP-ETLNRPLPET 307          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007303.1 (pep scaffold:Pmarinus_7.0:GL479716:670:30774:1 gene:ENSPMAG00000006591.1 transcript:ENSPMAT00000007303.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 1.170e-7
Identity = 28/110 (25.45%), Postives = 53/110 (48.18%), Query Frame = 3
Query:  543 IYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRI-------------SWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSER 833
            ++S   E+     RG  +  L  F  +G I+ +++ +AIIP               SWR F++V  +P    ++++ ++PESPR+LL   +  +   ++ Q+   N   R
Sbjct:   26 VFSYFGEFLSREKRGEHLSWLCMFGMIGGIYASAMAWAIIPHYGWSFSMGSAYQFHSWRVFVIVCALPAVSAVVALTFMPESPRFLLQMGKHDEAWMVLKQVHDTNMRAR 135          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Nematostella
Match: EDO41352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4N1])

HSP 1 Score: 162.925 bits (411), Expect = 1.792e-44
Identity = 126/433 (29.10%), Postives = 219/433 (50.58%), Query Frame = 3
Query:  246 SCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFR--DLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTE-VFPTSIRSFATGFCNSWSRIGGIMSPFIVNIII-TQYSFLGGTIIFFTLNFIAIIISFVLPYETKNR 1532
            + DA EM++LS L P + C ++++ +++  + TVVFIG+  GS  +G  +D +GRK  ++  +  + +FG +S  +P  YW+I++R  +G+ IGG   S  +L+SE+ PS +R   M +   +W +GS+F   V   ++P   WR+ L + ++P++  LL   ++PES R+ L    + K L  +++M R N +       KDA   +   R  DL+ P    TT ++  +WF    TYYG++L+ + +        Q  S   G    K  V   +  C  +   DY +M+ +   EI  V +++V +  +GR+ T  +   +     + L  C     +   +F  RG I       YIYT E V P    +   G C++ +RIG +++PFI  +++     F  G  ++       ++I+  LP ETK R
Sbjct:   46 AADALEMMLLSILAPTIRCIFRISAWKEAWITTVVFIGMMVGSSTWGWIADNFGRKFVIVLVSIWIAYFGLLSAFSPHYYWIIVLRMVVGLGIGGAPQSA-TLMSEFLPSKYRAMCMCIQSPWWTLGSLFTICVAMLVMPVYGWRYLLALLSLPMFLFLLLSPFLPESCRFQLASGDRDKALATLHRMARANKATLPTGFLKDANQNAKRGRILDLLKPELRRTTLMLWFLWFNVAFTYYGVVLMTSEL-------FQSDSAGGG----KCEVKDPHCGCKLLTTKDYTDMMWTTLAEIPIVLVNIVLLERLGRRRTLALLYGLTATFYMLLFICTKREWMVAFIFGARGCISGVFTAIYIYTPEVVLPYRGATLGLGTCSAVARIGAMITPFICQVLLRASVDFALG--VYAATGLSCVVIALCLPIETKGR 464          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Nematostella
Match: EDO39287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ0])

HSP 1 Score: 151.369 bits (381), Expect = 1.528e-40
Identity = 121/438 (27.63%), Postives = 215/438 (49.09%), Query Frame = 3
Query:  249 CDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFR--DLVHPNYIVTTFLMCLMWFISGLT----YYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCL-TPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIII-TQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKL 1538
             DA E+ +LS L P + C W +++ +   + TVVFI    GSP  G   D +GRK  L+ ++  + + G +S  +P+  W++ +R  +G  +GG   +  +LL E++P  HRG  ++ L   W +GS   + VG   +P + WR F++  T P+   L+   WIPE   +L+   ++ +  +++ +M R   +E  + + +      +  R  DL+ P Y +TT L+   ++   L+    YYGL+L+ T I      C   +       K K+   +       +  +D+  +L + S E+  + ++L   + VGRK   T +  I      FL  C  +   L+  LF  RG + +       YT+EV+PT+ R+   G  N   RIGG+++P I  ++  +  +   G ++ FT   +  +  + LP ET+ R+L
Sbjct:    2 ADAMEITMLSILVPYVKCEWDLSIVQVAMITTVVFIMFLVGSPTLGWMGDNFGRKPMLIVSSVAVAYAGLLSAFSPSYPWLLFLRGIVGFGLGGKCLNA-ALLVEYSPIKHRGATVMSLGVAWAIGSFMTSLVGMVFVPWLGWRSFVVAITFPLVVFLILSKWIPEFSHFLITSGEKDEARKVLQEMARIQKAELPIGELQGLSHEVALGRVGDLLTPEYRLTTLLLIYFYYFYLLSYRGIYYGLVLLTTQIMTSGSHCPGSVK-----FKTKLYTIL-------LSTNDFTTLLWTTSAELPAMILTLAMADKVGRKTLLTTYFVIASICYCFLFICAGSRVFLAFNLFIIRGLLLAGNEVLICYTSEVYPTAFRATGLGLMNGIGRIGGVIAPLISQVLADSSMNAAIGVLLLFTA--LCTVTCYFLPIETRQREL 424          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Nematostella
Match: EDO39285 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAI8])

HSP 1 Score: 143.665 bits (361), Expect = 2.128e-37
Identity = 92/320 (28.75%), Postives = 156/320 (48.75%), Query Frame = 3
Query:  585 GTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFR--DLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKL 1538
            GT  V L  FW VGS F  +V  A++P + WR+ L +  +P+   L    W+PES R+LL   ++   ++++  M   N  +    + KDA   +   R  DL   +   TT L+ ++WF     YYG++L  T +        Q +S       +  + +  +  C  +   DY +M+ +   E   V I++  I+ +GRK T  +   I       L  C     ++I +F  RGAI     T Y+YT EV+PT  R+   G C+  +R+G +++PF+  +++ +   L    ++  ++ I II S +LP ETK R++
Sbjct:  173 GTRKVSLYIFWAVGSTFTVAVAMAVMPTLGWRWLLAILCLPLLLFLAMSKWLPESCRFLLAAGEREGAIQVLRDMCEMNKKQMPQGELKDASQNAKRGRVADLFLKDQWKTTILLWIIWFNLAFAYYGIVLTTTEL-------FQTISTEGKCASSGKHSSKADCGCQLLGVEDYVDMMWTTLAEFPGVIITMFIIDKLGRKYTAALEFVITAVFFFLLIICTDRLTMTIFIFIVRGAISGAFQTFYVYTPEVYPTVTRALGLGCCSGIARVGAMITPFVAQVLLKESVAL-SMGVYGGMSVICIIASLMLPIETKGREM 484          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Nematostella
Match: EDO46087 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR13])

HSP 1 Score: 100.138 bits (248), Expect = 1.612e-22
Identity = 109/396 (27.53%), Postives = 176/396 (44.44%), Query Frame = 3
Query:  393 SDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFK-DAPMLSSS---FRDLVHPNYIVT-TFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLT---FTIFTSIICFGMLFLNFCLTP---TLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
            +D YGR+    TT +GL+ FG  S   PT      +RF  G  IGG   S + L +E    ++RG   ++ Q F+ +G + +  V + I     WR   +V ++P    +L   ++PES R+L++  + ++   ++  +  KN      S  + + P    S   F DL     IV  TF++  +WF++ L YYGL L                        N  ++  D           Y N  L +  E       L F+N  GR+ T   + +   + C   +F+    +P   TL ++     +  I +     YIY+ E+FPT +R+   G C+  SRIGGI +PF+V   +  Y      +IF    F+A ++S +LP ET  R L +T
Sbjct:  113 ADKYGRRRVWHTTLTGLVVFGFASSFAPTFKIYATLRFLTGFCIGGEILSAFVLATELVGPSYRGFAGIMAQCFFTLGLLILPMVAYLIQ---DWRTLSVVLSLPASVFILFFRYVPESARWLMIRGRVSEAENILLDIALKNGIAVPKSLLQVNHPFFVGSRYGFFDLFCTRKIVKQTFVLIFIWFVNTLVYYGLSL------------------------NTKHLAGD----------IYMNFFLCSLMEFPAYLTCLFFVNWAGRRKTLFNYMVLAGLACMACMFVQPESSPADRTLATVFAMIGKFGITASFALIYIYSAEIFPTVVRNVGLGVCSMSSRIGGICAPFVV--FLGTYMRPLPMVIFGMCAFMAGLLSLMLP-ETHKRPLPET 468          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Nematostella
Match: EDO47881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL69])

HSP 1 Score: 96.6709 bits (239), Expect = 1.098e-21
Identity = 91/353 (25.78%), Postives = 156/353 (44.19%), Query Frame = 3
Query:  546 YSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELI--------NQMTRKNTSERRVSDFKDAPMLSSSFRDLVH--------PNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSI---ICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQT 1547
            Y+L+ E    +HR    ++ + FW  G + I  V + I     WR F+L+   P   +LL   WI ESPR+LL   +  +  E++         Q   KN+  + +   +++ +         H        P     T +M + W    L+ YG  L               MS ++G L                    Y N++ SA    + +P+    I   GR+L   IF ++   +C G+L +     P L++ L    RG I +   T Y+ T+E++PT+IR+ A G C +++RIGG+++P+++ +++ + S     I+F  L  +A I  F +P ET    L Q+
Sbjct:   97 YTLIIEMIGPDHRTIAGIINELFWKAGWLLIILVAYFIR---DWRIFMLIGAAPGLAILLFWKWIFESPRWLLTKGRLDEAHEILVNFGGKSKEQPLDKNSLRQLIERIRESQVKREGEVTKRHTQLDMVRTPKMRKFTLVMAINWCTVALSSYGFTLF--------------MSSLAGDL--------------------YLNLVYSAILPTLLLPVVGCLIAKFGRRLIHIIFMALSGALCIGILGVP-SGYPLLMTGLALTARGVIGALWTTIYLITSELYPTTIRNTAIGTCATFARIGGLVAPYVI-MLVMRVSLYLPVILFGCLCILAAIAFFFIP-ETLKVPLAQS 409          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Medaka
Match: svopa (SV2 related protein [Source:NCBI gene;Acc:101156331])

HSP 1 Score: 187.193 bits (474), Expect = 2.713e-52
Identity = 127/437 (29.06%), Postives = 224/437 (51.26%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLS-SSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTAGHN 1559
            DA EM+ILS L P L C W++   E   L + VFIG+   S ++G  SD YGRKT L  +    +F+G +S   P   W++++R  +G  IGG   S+ +L +E+ P   R T ++L++ FW +G++F   +   ++P + WR+ L ++TIP++   +   W+PES RY +L   Q K L  + ++  +N     +     A        +DL   ++  TT L+  +WF +  +YYGL+L+ T + +    C           +NK  +  +  C + + + DY+++L +   E   + ++L  I+ +GR+ T  +   I    ++ L  C+    + +L+F  R  I       Y+YT EV+PT+ R+   G  +  +R+G +++PF+  +++ +YS      ++     +A + S  LP ET  R L Q A H 
Sbjct:   95 DAMEMMILSILAPQLHCEWRLPSLEVALLTSAVFIGMMISSSLWGNISDKYGRKTGLKMSVLWTMFYGILSAFAPIYGWILVLRALVGFGIGGAPQSV-TLYAEFLPMRSRATCILLIEIFWALGTVFEVLLAILVMPTLGWRWLLGLSTIPLFIFAILCFWLPESARYDVLTGNQDKALATLKRIATENGVPMPLGKLIAARQEDRGKIKDLFSSHFRCTTVLLWFIWFANAFSYYGLVLLTTELFQEGGAC----------GRNKQELRCNLECKY-LTSDDYKDLLWTTLSEFPGLLVTLWAIDRLGRRRTMALCFLIFSLALIPLYGCVGRVSMMVLIFIARAFIAGGFQAAYVYTPEVYPTATRALGLGTSSGMARVGALITPFVAQVML-EYSVYLALSVYCCCCLLAAVASCALPIETTGRGL-QEASHR 517          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Medaka
Match: svopb (synaptic vesicle 2-related protein [Source:NCBI gene;Acc:101161175])

HSP 1 Score: 183.341 bits (464), Expect = 7.972e-51
Identity = 129/441 (29.25%), Postives = 232/441 (52.61%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTS---ERRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSC---CFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQ--YSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
            DA EM+ILS LGP L C+W +  ++   + +VVFIG+ FGSP++G  SD YGRK  L       L++G +S   P   W++++R F+G  IGG   S+ +L +E+ P   RG  +VL+  FW +G++F   +   ++P + WR+ L ++ +P+   +    W+PESPR+ +L  ++ K +  + ++ + N     +  ++ +K         +DL  P Y  TT L+  +WF +  +YYG++L+ T + +    C +                I+  C   C  + + DY+++L +   E   + + L+ I+ +GRK +  +   +    +L L  C+    L+I +F  R  I       ++YT EV+PT  R+ A G  ++ +RIG +++PF+  +++ +  Y  LG   ++     +A I S +LP ET  R L +++
Sbjct:  100 DAMEMMILSILGPELHCDWSLPSYQVALITSVVFIGMGFGSPVWGNVSDKYGRKVGLTVCMCWTLYYGILSAFAPIYGWLLVLRGFVGFGIGGAPQSV-TLYTEFLPVKARGICIVLIGAFWAIGAVFEVLLALWVMPTLGWRWLLGLSALPMAVFVCFCFWLPESPRFDVLAGRREKAMATLVRIAKDNGKAMPQGTLTIYKQTN--RGQLKDLFSPQYWKTTLLLWFLWFANAFSYYGIVLLTTELFQAGDLCAE-----------TQGAKIEPRCSLECKYLSSDDYKDLLWTTLAEFPGLLVILLAIDYMGRKKSMALCFFMFSLCILPLFACIGRIALTIFIFICRAFISGGYQVVFVYTPEVYPTETRALAMGTSSAIARIGALITPFVAQVLLRRSVYVTLG---VYCACGLVAGIASLLLPIETLGRGLQESS 523          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Medaka
Match: svopl (SVOP like [Source:NCBI gene;Acc:101157836])

HSP 1 Score: 173.326 bits (438), Expect = 1.883e-47
Identity = 121/437 (27.69%), Postives = 220/437 (50.34%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLH---KQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSC-CFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
            +A E+++L+ + P + C W++  ++   + T+VF+G      + G  +D +GR   +        +F  ++   P+  W I +R  +G  + G S   + L +E+ P+ +R   + L   FW +GS+ I  +G  ++P + WR+ + ++  P   ++    +IPES RY +         K L+ I +M R    E R+ +   A     S+R L+ P++  T+ L+   WF++   YYG +L  + + +    C+ +      + K++    +   C C      DY+ +L+S  GE+  VP+++  +N  GRK + ++   +     + LN C T    ++LLF  R  +    N  YIYT EV+PT  RS   GFC S+SRIGG+++PFI  +++++   L  +  F     I  + +F+LP ET+ R L Q +
Sbjct:   79 EAMEIMLLAVVSPEIRCEWKLDDWQVALVSTIVFLGFMVCGVLSGYMADRFGRWKVVFGGFVWSAYFSLLTSFAPSYGWFIFLRSMVGCGVAGVSQG-FVLKTEFIPAKYRAVLLPLATIFWMMGSMLIIVLGMLVVPTLGWRWMIRISVTPSIVLIFLFKFIPESARYNVSAGNVDAALKTLQRIARMNRAGLPEGRLVE--PAVRNRGSWRILLSPSFRRTSLLLWYSWFVASFAYYGSVLSSSELLEKNLLCVTNAEREHQV-KHRHQGGV---CYCIPFGYGDYQTLLISCLGEVALVPLNIALLNVFGRKTSLSVLQLLAALVFMMLNICSTMLGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTVARSLGMGFCTSFSRIGGMIAPFIAQVLMSKSVVLALS-PFAVACVICALGNFLLPIETRGRALLQNS 507          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Medaka
Match: svopl (SVOP like [Source:NCBI gene;Acc:101157836])

HSP 1 Score: 167.162 bits (422), Expect = 3.015e-45
Identity = 118/431 (27.38%), Postives = 216/431 (50.12%), Query Frame = 3
Query:  252 DATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLH---KQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSC-CFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNR 1532
            +A E+++L+ + P + C W++  ++   + T+VF+G      + G  +D +GR   +        +F  ++   P+  W I +R  +G  + G S   + L +E+ P+ +R   + L   FW +GS+ I  +G  ++P + WR+ + ++  P   ++    +IPES RY +         K L+ I +M R    E R+ +   A     S+R L+ P++  T+ L+   WF++   YYG +L  + + +    C+ +      + K++    +   C C      DY+ +L+S  GE+  VP+++  +N  GRK + ++   +     + LN C T    ++LLF  R  +    N  YIYT EV+PT  RS   GFC S+SRIGG+++PFI  +++++   L  +  F     I  + +F+LP ET+  
Sbjct:   82 EAMEIMLLAVVSPEIRCEWKLDDWQVALVSTIVFLGFMVCGVLSGYMADRFGRWKVVFGGFVWSAYFSLLTSFAPSYGWFIFLRSMVGCGVAGVSQG-FVLKTEFIPAKYRAVLLPLATIFWMMGSMLIIVLGMLVVPTLGWRWMIRISVTPSIVLIFLFKFIPESARYNVSAGNVDAALKTLQRIARMNRAGLPEGRLVE--PAVRNRGSWRILLSPSFRRTSLLLWYSWFVASFAYYGSVLSSSELLEKNLLCVTNAEREHQV-KHRHQGGV---CYCIPFGYGDYQTLLISCLGEVALVPLNIALLNVFGRKTSLSVLQLLAALVFMMLNICSTMLGFTVLLFLLRSLVSMNFNVVYIYTAEVYPTVARSLGMGFCTSFSRIGGMIAPFIAQVLMSKSVVLALS-PFAVACVICALGNFLLPIETRGH 504          
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Medaka
Match: slc22a15 (solute carrier family 22 member 15 [Source:NCBI gene;Acc:101163995])

HSP 1 Score: 85.1149 bits (209), Expect = 3.775e-17
Identity = 96/361 (26.59%), Postives = 153/361 (42.38%), Query Frame = 3
Query:  393 SDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVA-TIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSE------RRVSDFKDA---PMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINT--VGRKLTFTIFTSIICF-GMLFLNFCLTPTLLSILLFFTRGA------IKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFI 1418
            SD  GRK   LT     + FG V+ + P+       R  +G+  GG     + L  E+   ++      L    + VG     ++G+ I P   WR   + A +  + F LLS++ +PESPR+L    Q  +  E++  M +KN+++      +RVS  K        S   + +VHP   + T ++  +W+   L YYGL L              DMS                        S Y N+ +    E+   P+ + FIN    GR+ +   F   +C  G+  L   L P    + L  T  A      + +  N  Y+YT+E++PT IR+   G C    R+GGI++PF+
Sbjct:  111 SDKIGRKPVYLTGLFLEVVFGYVTALAPSYEVFAASRLLVGLMNGGIGLVCFVLTQEYVGKSYWAMTGTLASMSFAVGIALFAALGYFIRP---WRTLAMAANSSGVLFFLLSVM-LPESPRWLYSQGQTERAEEVLRYMAQKNSNKANNLVLQRVSAGKAGYHDNRRSGVLQLIVHPVLRLRTVVLMYVWYACSLVYYGLTL-----------GAGDMS-----------------------GSRYLNVAMYGVVELPAYPLCIYFINKHWAGRRKSMAAF---LCLAGVACLCTTLVPDSSGLFLSVTSLALLGKLMVSAAFNIAYVYTSELYPTVIRNAGLGVCAMSCRVGGILAPFV 430          
BLAST of Synaptic vesicle 2-related protein vs. Planmine SMEST
Match: SMESG000000254.1 (SMESG000000254.1)

HSP 1 Score: 834.713 bits (2155), Expect = 0.000e+0
Identity = 467/469 (99.57%), Postives = 468/469 (99.79%), Query Frame = 3
Query:  153 MEGKISFDEALNEXXXXXXXXXXXXXXXXXXSCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTAGHN 1559
            MEGKISFDEALNEIKIGKFHFILLLILGIIHSCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVFIGIFFGSPIFGKFSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMIIIRFFIGVFIGGNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWR FLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERR+SDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTAGHN
Sbjct:    1 MEGKISFDEALNEIKIGKFHFILLLILGIIHSCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVFIGIFFGSPIFGKFSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMIIIRFFIGVFIGGNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRIFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRISDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTAGHN 469          
BLAST of Synaptic vesicle 2-related protein vs. Planmine SMEST
Match: SMESG000000088.1 (SMESG000000088.1)

HSP 1 Score: 422.935 bits (1086), Expect = 9.184e-144
Identity = 226/438 (51.60%), Postives = 313/438 (71.46%), Query Frame = 3
Query:  246 SCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGI-LKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTAGH 1556
            SCD+ EMLIL+FLGPIL+C+W+++V E   L T VF+GI  G+ + GKFSD +GRK  L+ TNS LL+FG     +PT+YW+II+R  IGV IGGN+ +IYSLLSE +P  +RGT  VLLQFFW  GS+ IT + F I+ +  WR FL ++TIP+  VL+S+ WI ESPRYLLL  Q++K LE+IN++   N SE  ++D  + P+L+SSF+DL+H NY++TTF    +W  +GL+YY  ILI+ +I  IPH+CLQ+    S + ++  +N T+D+SCCF+M    Y+NM +S +GEI+ +PIS++ IN VGRK T +I+  +I  G   LNFC++   LS +LF  RGA+KS  N  +IY  EV+PTS+RS + G  +S+SRIG I+SPF VNI+  QYSF GGT++    N I ++ISF LPYETK+R+L+QTA H
Sbjct:   32 SCDSMEMLILAFLGPILSCHWRISVIEASFLTTAVFLGIIVGNSLLGKFSDRFGRKMTLILTNSCLLYFGLFCAASPTVYWIIILRCLIGVCIGGNNCNIYSLLSEMSPVQYRGTLQVLLQFFWACGSLIITLLCFLIVHKYGWRLFLSLSTIPVIIVLVSLFWIYESPRYLLLRNQKSKALEIINKIAVINHSEI-ITDLCNQPVLTSSFKDLIHSNYLLTTFYTSFIWLNTGLSYYSTILIVPIIMGIPHQCLQNWKTFSQLSIQINVNKTVDDSCCFEMNWDSYKNMFISTAGEIVVIPISIILINYVGRKRTLSIYMLVISIGTFCLNFCMSSLALSAVLFIIRGAVKSLYNVIFIYCAEVYPTSVRSLSLGMGSSFSRIGAIISPFFVNILFAQYSFFGGTMLLALTNAIGLVISFFLPYETKDRELFQTADH 468          
BLAST of Synaptic vesicle 2-related protein vs. Planmine SMEST
Match: SMESG000047712.1 (SMESG000047712.1)

HSP 1 Score: 388.267 bits (996), Expect = 3.427e-130
Identity = 242/464 (52.16%), Postives = 328/464 (70.69%), Query Frame = 3
Query:  168 SFDEALNEXXXXXXXXXXXXXXXXXXSCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTAGHN 1559
            S ++A+NEI IGKFHFILL+I+GIIHSCDA EM+IL FLGP L+C W++T  E   L   V  GI  G+  FGKFSD YGRK  L+ +N GL+ FG +SV++PTI W+ IIRF IG  IGGNS+S Y+L+SE TP N RGT +   QFFW +GS  IT V F I P   WRF L+ A IP + +LLS++W+PESPRYLLL  ++   L+++N++ + N +   +++ K+     SSFRDL+HPNY+ +  ++C M F+ GLTY  ++LI+ + + IPHRCLQDM   S  LK+  N  ID+SCCFQM  + Y+N+L+S +GE++ +PI+L+ IN +GRK+T  I + +I FG+L LN CL+   L+ILLFF RG++ SF +   IY TE+FPTSIRS   G C   +RIG I+S F+VNI I Q SF+GGT+I   LN I +++S++LPYETKNRKL+QTA   
Sbjct:    6 SIEDAINEIGIGKFHFILLIIMGIIHSCDAMEMMILVFLGPFLSCTWRITAIESTFLTAAVIFGIMIGAVNFGKFSDEYGRKKTLIISNIGLIIFGFLSVISPTIIWLTIIRFLIGFSIGGNSASQYALMSELTPINFRGTLLTCFQFFWALGSYLITIVSFLIFPLYGWRFVLVFALIPAFVILLSLLWVPESPRYLLLKNKKFASLDVLNKIAKMNNAHL-ITNIKEMTFKKSSFRDLIHPNYLPSIIIICFMLFVVGLTYCSVLLIIPIFDSIPHRCLQDMKRFSEPLKDSKNNIIDDSCCFQMTWNTYKNLLISTTGELLILPIALILINLIGRKMTLAINSIVISFGILSLNLCLSSLSLNILLFFIRGSLMSFSSVGIIYATELFPTSIRSLGIGLCGFCARIGAILSAFLVNIFIAQTSFIGGTVILCILNAIVLVLSYLLPYETKNRKLFQTADEE 468          
BLAST of Synaptic vesicle 2-related protein vs. Planmine SMEST
Match: SMESG000012985.1 (SMESG000012985.1)

HSP 1 Score: 387.497 bits (994), Expect = 9.581e-130
Identity = 241/464 (51.94%), Postives = 328/464 (70.69%), Query Frame = 3
Query:  168 SFDEALNEXXXXXXXXXXXXXXXXXXSCDATEMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTAGHN 1559
            S ++A+NEI IGKFHFILL+I+GIIHSCDA EM+IL FLGP L+C W++   E   L   V  GI  G+  FGKFSD YGRK  L+ +N GL+ FG +SV++PTI W+ IIRF IG  IGGNS+S Y+L+SE TP N RGT +   QFFW +GS  IT V F I P   WRF L+ A IP + +LLS++W+PESPRYLLL  ++   L+++N++ + N +   +++ K+     SSFRDL+HPNY+ +  ++C M F+ GLTY  ++LI+ +++ IPHRCLQDM   S  LK+  N  ID+SCCFQM  + Y+N+L+S +GE++ +PI+L+ IN +GRK+T  I + +I FG+L LN CL+   L+ILLFF RG++ SF +   IY TE+FPTSIRS   G C   +RIG I+S F+VNI I Q SF+GGT+I   LN I +++S++LPYETKNRKL+QTA   
Sbjct:    6 SIEDAINEIGIGKFHFILLIIMGIIHSCDAMEMMILVFLGPFLSCTWRIMAIESTFLTAAVIFGIMIGAVNFGKFSDEYGRKKTLIISNIGLIIFGFLSVISPTIIWLTIIRFLIGFSIGGNSASQYALMSELTPINFRGTLLTCFQFFWALGSYLITIVSFLIFPLYGWRFVLVFALIPAFVILLSLLWVPESPRYLLLKNKKFASLDVLNKIAKMNNAHL-ITNIKEMTFKKSSFRDLIHPNYLPSIIIICFMLFVVGLTYCSVLLIIPILDSIPHRCLQDMKRFSEPLKDSKNNIIDDSCCFQMTWNTYKNLLISTTGELLILPIALILINLIGRKMTLAINSIVISFGILSLNLCLSSLSLNILLFFIRGSLMSFSSVGIIYATELFPTSIRSLGIGLCGFCARIGAILSAFLVNIFIAQTSFIGGTVILCILNAIVLVLSYLLPYETKNRKLFQTADEE 468          
BLAST of Synaptic vesicle 2-related protein vs. Planmine SMEST
Match: SMESG000011499.1 (SMESG000011499.1)

HSP 1 Score: 322.783 bits (826), Expect = 6.797e-105
Identity = 182/439 (41.46%), Postives = 283/439 (64.46%), Query Frame = 3
Query:  246 SCDAT----EMLILSFLGPILTCNWQVTVFEDVTLKTVVXXXXXXXXXXXXXXSDLYGRKTALLTTNSGLLFFGTVSVVTPTIYWMXXXXXXXXXXXXXNSSSIYSLLSEWTPSNHRGTFMVLLQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESPRYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFRDLVHPNYIVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKMNVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIFTSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSIRSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIISFVLPYETKNRKLYQTA 1550
            SC+A     +++I+SFLGP+L+C W++         T++FI  F  S + G+FSD YGR TAL+  N  L++   +S V+P IYW+ + +FF+G+ IG    +I+ L  EW+P+ +R  F+ +       G    T +G+ IIPR  WR  ++++ +    + + +I IPESPRYL+L+K ++ CL ++N + + N +E  + D ++ P+   + +DL+HPNY+ TT L+  +  ++ LTYY ++LI+ +I  IPHRCLQ+ +  S +  ++ N T+D+SCC +M  ++Y +ML+S SGEIIF+P  ++ I+ +GRK T  IF  II  G++ LNFCL    L+ILLF  RG   +  N   IYTTE+FPTS+RSF  G C +  R+GG ++P + N+II +YS L GT+I F LN I   +SF+LPYETK++ L+QTA
Sbjct:   25 SCNAGIFGLQIIIMSFLGPVLSCFWKLNAINIFIFNTIIFISYFTWSLLIGRFSDKYGRNTALIFCNCLLIYSNFMSAVSPNIYWLTLFQFFVGISIGI-LLTIFPLFFEWSPAKYRIFFIGIAALTLSFGCFLGTLLGYVIIPRFGWRILMVISAVLTVILTVFLIPIPESPRYLILNKGKSDCLRVMNIVAKWNRAET-IKDIQEPPVTKPNIKDLIHPNYLSTTILVSFISLVNYLTYYTIVLIIPIIANIPHRCLQNWNRFSTVQIHQKNNTVDDSCCMKMNINNYNSMLISTSGEIIFIPFYIILISFIGRKKTIPIFLFIIMIGIISLNFCLNFLQLNILLFVIRGISNASINLIIIYTTEIFPTSVRSFGMGICGAVGRVGGALAPLLANVIIFKYSLLAGTMIIFVLNLICFCVSFLLPYETKDQNLHQTA 461          
The following BLAST results are available for this feature:
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SVOP4.775e-5630.23SV2 related protein [Source:HGNC Symbol;Acc:HGNC:2... [more]
SVOPL2.075e-5129.82SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
SVOPL5.037e-4631.14SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
SVOPL5.037e-4631.14SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
SVOPL6.217e-4131.01SVOP like [Source:HGNC Symbol;Acc:HGNC:27034][more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svop-11.458e-4927.69Putative transporter svop-1 [Source:UniProtKB/Swi... [more]
svop-11.458e-4927.69Putative transporter svop-1 [Source:UniProtKB/Swi... [more]
B0252.31.186e-1426.71Putative transporter B0252.3 [Source:UniProtKB/Sw... [more]
B0252.31.658e-1426.26Putative transporter B0252.3 [Source:UniProtKB/Sw... [more]
B0252.31.658e-1426.26Putative transporter B0252.3 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG43241.772e-4527.80gene:FBgn0034956 transcript:FBtr0343347[more]
CG43241.772e-4527.80gene:FBgn0034956 transcript:FBtr0072197[more]
CG31686.094e-1824.26gene:FBgn0029896 transcript:FBtr0340268[more]
CG31686.094e-1824.26gene:FBgn0029896 transcript:FBtr0340266[more]
CG31686.094e-1824.26gene:FBgn0029896 transcript:FBtr0340267[more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopa3.647e-5329.49SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-06... [more]
svopa4.190e-5329.49SV2 related protein a [Source:ZFIN;Acc:ZDB-GENE-06... [more]
svopl9.878e-4927.70SVOP-like [Source:NCBI gene;Acc:492766][more]
svopl9.878e-4927.70SVOP-like [Source:NCBI gene;Acc:492766][more]
svopl3.683e-4727.79SVOP-like [Source:NCBI gene;Acc:492766][more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SVOP1.002e-5530.98SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP2.586e-5530.30SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP6.041e-5530.30SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP2.681e-5329.91SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
SVOP9.686e-4428.15SV2 related protein [Source:NCBI gene;Acc:10049231... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Svopl2.628e-5130.37SV2 related protein homolog (rat)-like [Source:MGI... [more]
Svop4.592e-5030.23SV2 related protein [Source:MGI Symbol;Acc:MGI:191... [more]
Slc22a76.734e-1924.87solute carrier family 22 (organic anion transporte... [more]
Slc22a18.030e-1926.63solute carrier family 22 (organic cation transport... [more]
Slc22a78.065e-1924.87solute carrier family 22 (organic anion transporte... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R5T8|SVOP_PONAB1.720e-5530.30Synaptic vesicle 2-related protein OS=Pongo abelii... [more]
sp|Q8N4V2|SVOP_HUMAN2.293e-5530.23Synaptic vesicle 2-related protein OS=Homo sapiens... [more]
sp|Q2XWK0|SVOP_XENLA1.207e-5430.30Synaptic vesicle 2-related protein OS=Xenopus laev... [more]
sp|Q1JP63|SVOP_BOVIN2.913e-5429.77Synaptic vesicle 2-related protein OS=Bos taurus O... [more]
sp|Q8N434|SVOPL_HUMAN9.966e-5129.82Putative transporter SVOPL OS=Homo sapiens OX=9606... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E8812.730e-6932.96MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A267E6E24.195e-6932.96MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A267GPA25.509e-6932.96MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HJB37.749e-6932.05MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8G7A71.425e-6832.35MFS domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopa5.179e-5329.71SV2 related protein [Source:NCBI gene;Acc:10302387... [more]
svopa9.328e-5329.93SV2 related protein [Source:NCBI gene;Acc:10302387... [more]
svopl2.992e-3826.57SVOP-like [Source:NCBI gene;Acc:492766][more]
SLC22A23.400e-1726.14solute carrier family 22 member 2-like [Source:NCB... [more]
si:dkey-119m7.46.342e-1723.87solute carrier family 22 member 13-like [Source:NC... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopl2.870e-5531.28SVOP-like [Source:NCBI gene;Acc:492766][more]
oct21.085e-1624.13organic cation transporter 2 [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000002617.11.938e-828.66pep scaffold:Pmarinus_7.0:GL485729:386:8898:-1 gen... [more]
slc22a6l4.525e-820.50solute carrier family 22 member 6, like [Source:NC... [more]
ENSPMAT00000007303.11.170e-725.45pep scaffold:Pmarinus_7.0:GL479716:670:30774:1 gen... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO413521.792e-4429.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392871.528e-4027.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392852.128e-3728.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460871.612e-2227.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478811.098e-2125.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svopa2.713e-5229.06SV2 related protein [Source:NCBI gene;Acc:10115633... [more]
svopb7.972e-5129.25synaptic vesicle 2-related protein [Source:NCBI ge... [more]
svopl1.883e-4727.69SVOP like [Source:NCBI gene;Acc:101157836][more]
svopl3.015e-4527.38SVOP like [Source:NCBI gene;Acc:101157836][more]
slc22a153.775e-1726.59solute carrier family 22 member 15 [Source:NCBI ge... [more]
back to top
BLAST of Synaptic vesicle 2-related protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000254.10.000e+099.57SMESG000000254.1[more]
SMESG000000088.19.184e-14451.60SMESG000000088.1[more]
SMESG000047712.13.427e-13052.16SMESG000047712.1[more]
SMESG000012985.19.581e-13051.94SMESG000012985.1[more]
SMESG000011499.16.797e-10541.46SMESG000011499.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007322 ID=SMED30007322|Name=Synaptic vesicle 2-related protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1604bp
CTTCTATTCTTATTAGTAAAAAAAGGTTACATACAATCCATGTATTGAAT
TATAACAATTAAACCTTTAAAACATATGAATGAATTTATACGTATTCATT
GCGAGTCAGCGCTGCACCGTGACAGTATTCACATTAAACTAAAAATCATT
GAATGGAAGGCAAAATATCGTTTGATGAAGCCCTGAATGAAATAAAAATT
GGTAAATTTCACTTCATTTTGCTTTTAATTTTGGGAATCATTCATTCATG
CGACGCTACGGAAATGTTGATCCTCTCTTTCCTCGGTCCTATTCTCACCT
GCAACTGGCAAGTGACGGTTTTTGAGGATGTCACGCTCAAAACTGTAGTT
TTCATTGGAATATTTTTCGGCAGTCCGATATTTGGAAAATTTAGTGATCT
ATATGGAAGAAAAACGGCTCTATTGACAACAAATTCTGGACTTTTGTTCT
TTGGAACTGTAAGTGTGGTTACTCCGACAATTTATTGGATGATCATCATA
CGATTTTTCATTGGTGTTTTCATTGGTGGAAATTCCTCATCAATTTATTC
ACTTCTTTCTGAGTGGACCCCTTCCAACCATCGAGGCACATTTATGGTGT
TACTGCAATTCTTTTGGGGAGTTGGTTCAATTTTTATAACTTCTGTTGGG
TTTGCAATTATTCCCAGAATTAGTTGGAGATTTTTTCTATTAGTAGCAAC
AATTCCGATTTATTTCGTTTTATTGTCCATGATCTGGATTCCAGAGTCTC
CAAGATATCTATTGTTACATAAACAACAAGCAAAATGTTTAGAATTAATA
AATCAAATGACAAGAAAGAACACTTCGGAGAGACGTGTATCTGATTTTAA
AGATGCCCCGATGCTTTCATCGTCGTTTAGAGATCTAGTTCATCCCAATT
ATATCGTAACCACATTTCTCATGTGCCTCATGTGGTTTATTTCCGGTCTC
ACTTATTACGGATTAATATTAATTCTTACGGTTATAAATAAAATCCCTCA
CAGATGTTTACAAGACATGTCAGTCGTTTCAGGAATCCTCAAGAATAAAA
TGAATGTAACGATAGACAATTCGTGCTGTTTTCAAATGAGAAATAGCGAC
TATAGGAATATGTTATTATCAGCAAGCGGGGAAATCATATTTGTCCCTAT
ATCTCTGGTTTTCATCAATACGGTTGGGAGAAAGCTCACATTTACTATTT
TTACGTCAATTATTTGTTTTGGAATGTTGTTTTTGAATTTTTGCTTAACT
CCGACCTTACTTAGTATTTTGCTGTTTTTTACCCGAGGCGCTATAAAAAG
TTTTCAAAATACAAATTATATCTATACAACAGAGGTATTTCCCACATCAA
TCAGAAGTTTTGCAACAGGATTCTGTAATAGTTGGTCACGAATTGGAGGA
ATTATGTCACCTTTCATTGTGAATATCATCATCACTCAATATTCTTTTTT
AGGTGGAACGATCATATTTTTCACCTTAAATTTTATTGCTATTATAATCA
GTTTTGTCCTACCCTATGAAACGAAAAATAGAAAGCTTTATCAAACTGCA
GGTCATAATTAATCACTTTTACTTTTGAGGATGAAATAATATCTGTAGAA
AAAA
back to top

protein sequence of SMED30007322-orf-1

>SMED30007322-orf-1 ID=SMED30007322-orf-1|Name=SMED30007322-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=470bp
MEGKISFDEALNEIKIGKFHFILLLILGIIHSCDATEMLILSFLGPILTC
NWQVTVFEDVTLKTVVFIGIFFGSPIFGKFSDLYGRKTALLTTNSGLLFF
GTVSVVTPTIYWMIIIRFFIGVFIGGNSSSIYSLLSEWTPSNHRGTFMVL
LQFFWGVGSIFITSVGFAIIPRISWRFFLLVATIPIYFVLLSMIWIPESP
RYLLLHKQQAKCLELINQMTRKNTSERRVSDFKDAPMLSSSFRDLVHPNY
IVTTFLMCLMWFISGLTYYGLILILTVINKIPHRCLQDMSVVSGILKNKM
NVTIDNSCCFQMRNSDYRNMLLSASGEIIFVPISLVFINTVGRKLTFTIF
TSIICFGMLFLNFCLTPTLLSILLFFTRGAIKSFQNTNYIYTTEVFPTSI
RSFATGFCNSWSRIGGIMSPFIVNIIITQYSFLGGTIIFFTLNFIAIIIS
FVLPYETKNRKLYQTAGHN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR005828MFS_sugar_transport-like
IPR005829Sugar_transporter_CS
IPR020846MFS_dom
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005828Major facilitator, sugar transporter-likePFAMPF00083Sugar_trcoord: 328..464
e-value: 3.1E-5
score: 23.0
coord: 65..272
e-value: 4.0E-26
score: 91.9
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 14..466
e-value: 1.6E-69
score: 236.9
NoneNo IPR availablePANTHERPTHR24064FAMILY NOT NAMEDcoord: 7..463
NoneNo IPR availablePANTHERPTHR24064:SF457TRANSPORTER SVOPL-RELATEDcoord: 7..463
NoneNo IPR availableCDDcd17372MFS_SVOP_likecoord: 34..453
e-value: 4.83289E-60
score: 198.913
NoneNo IPR availableTMHMMTMhelixcoord: 250..272
NoneNo IPR availableTMHMMTMhelixcoord: 177..196
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 56..78
NoneNo IPR availableTMHMMTMhelixcoord: 19..41
NoneNo IPR availableTMHMMTMhelixcoord: 353..375
NoneNo IPR availableTMHMMTMhelixcoord: 148..170
NoneNo IPR availableTMHMMTMhelixcoord: 321..343
NoneNo IPR availableTMHMMTMhelixcoord: 432..454
NoneNo IPR availableTMHMMTMhelixcoord: 411..428
IPR005829Sugar transporter, conserved sitePROSITEPS00217SUGAR_TRANSPORT_2coord: 119..144
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 20..458
score: 35.347
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 8..462