Stimulated by retinoic acid gene 6-like protein

Overview
NameStimulated by retinoic acid gene 6-like protein
Smed IDSMED30007314
Length (bp)2040
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Stimulated by retinoic acid gene 6-like protein (SMED30007314) t-SNE clustered cells

Violin plots show distribution of expression levels for Stimulated by retinoic acid gene 6-like protein (SMED30007314) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Stimulated by retinoic acid gene 6-like protein (SMED30007314) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Stimulated by retinoic acid gene 6-like protein (SMED30007314) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007314

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30007314h1SMcG0015473 dd_Smed_v4_10051_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30007314h1SMcG0015474 dd_Smed_v4_10051_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30007314h1SMcG0015473 dd_Smed_v6_10051_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30007314h1SMcG0015474 dd_Smed_v6_10051_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Human
Match: STRA6 (stimulated by retinoic acid 6 [Source:HGNC Symbol;Acc:HGNC:30650])

HSP 1 Score: 54.299 bits (129), Expect = 7.066e-7
Identity = 42/188 (22.34%), Postives = 76/188 (40.43%), Query Frame = 3
Query: 1467 SLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLI--------------------ENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKV 1970
            S P  +   + V++Q++   +VF++      ++ NRR         F LNV++G   +  R+++  L       ++D + LP     LD GY +Y  FL       +P M  F  +L+                    E  +  + +     M+   +    R  + +W +A TL++N  LQ  RK  
Sbjct:  464 SWPFWLTLALAVILQNMAAHWVFLETHDGHPQLTNRRVLYAATFLLFPLNVLVGAMVATWRVLLSALYNAIHLGQMDLSLLPPRAATLDPGYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRG-RARWGLAYTLLHNPTLQVFRKTA 650          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Human
Match: STRA6 (stimulated by retinoic acid 6 [Source:HGNC Symbol;Acc:HGNC:30650])

HSP 1 Score: 54.299 bits (129), Expect = 7.066e-7
Identity = 42/188 (22.34%), Postives = 76/188 (40.43%), Query Frame = 3
Query: 1467 SLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLI--------------------ENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKV 1970
            S P  +   + V++Q++   +VF++      ++ NRR         F LNV++G   +  R+++  L       ++D + LP     LD GY +Y  FL       +P M  F  +L+                    E  +  + +     M+   +    R  + +W +A TL++N  LQ  RK  
Sbjct:  464 SWPFWLTLALAVILQNMAAHWVFLETHDGHPQLTNRRVLYAATFLLFPLNVLVGAMVATWRVLLSALYNAIHLGQMDLSLLPPRAATLDPGYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRG-RARWGLAYTLLHNPTLQVFRKTA 650          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Human
Match: STRA6 (stimulated by retinoic acid 6 [Source:HGNC Symbol;Acc:HGNC:30650])

HSP 1 Score: 54.299 bits (129), Expect = 7.658e-7
Identity = 41/187 (21.93%), Postives = 72/187 (38.50%), Query Frame = 3
Query: 1467 SLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCF------------------TDMLIENHKKKK-SIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKV 1970
            S P  +   + V++Q++   +VF++      ++ NRR         F LNV++G   +  R+++  L       ++D + LP     LD GY +Y  FL       +P M  F                   D L    + +   +    D           + + +W +A TL++N  LQ  RK  
Sbjct:  509 SWPFWLTLALAVILQNMAAHWVFLETHDGHPQLTNRRVLYAATFLLFPLNVLVGAMVATWRVLLSALYNAIHLGQMDLSLLPPRAATLDPGYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTA 695          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Human
Match: STRA6 (stimulated by retinoic acid 6 [Source:HGNC Symbol;Acc:HGNC:30650])

HSP 1 Score: 54.299 bits (129), Expect = 7.658e-7
Identity = 41/187 (21.93%), Postives = 72/187 (38.50%), Query Frame = 3
Query: 1467 SLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCF------------------TDMLIENHKKKK-SIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKV 1970
            S P  +   + V++Q++   +VF++      ++ NRR         F LNV++G   +  R+++  L       ++D + LP     LD GY +Y  FL       +P M  F                   D L    + +   +    D           + + +W +A TL++N  LQ  RK  
Sbjct:  509 SWPFWLTLALAVILQNMAAHWVFLETHDGHPQLTNRRVLYAATFLLFPLNVLVGAMVATWRVLLSALYNAIHLGQMDLSLLPPRAATLDPGYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTA 695          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Human
Match: STRA6 (stimulated by retinoic acid 6 [Source:HGNC Symbol;Acc:HGNC:30650])

HSP 1 Score: 53.9138 bits (128), Expect = 8.102e-7
Identity = 42/188 (22.34%), Postives = 76/188 (40.43%), Query Frame = 3
Query: 1467 SLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLI--------------------ENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKV 1970
            S P  +   + V++Q++   +VF++      ++ NRR         F LNV++G   +  R+++  L       ++D + LP     LD GY +Y  FL       +P M  F  +L+                    E  +  + +     M+   +    R  + +W +A TL++N  LQ  RK  
Sbjct:  463 SWPFWLTLALAVILQNMAAHWVFLETHDGHPQLTNRRVLYAATFLLFPLNVLVGAMVATWRVLLSALYNAIHLGQMDLSLLPPRAATLDPGYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRG-RARWGLAYTLLHNPTLQVFRKTA 649          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Zebrafish
Match: stra6l (STRA6-like [Source:ZFIN;Acc:ZDB-GENE-070410-116])

HSP 1 Score: 83.5741 bits (205), Expect = 3.236e-16
Identity = 80/281 (28.47%), Postives = 142/281 (50.53%), Query Frame = 3
Query: 1155 ICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXE-NSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSL------MEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNET----KRKYKIKWHVALTLINNCQLQTDRK 1964
            +  T+     S+  +F +L  +R H +++ +   S +      P  A  V+ + RYSG+Q A+ LWG ++V F  FLF+   +  ++LP+      SW+  + +  L + I    +VV+Q +LV+  F++++ S       + +NNR+AF  + +  FF NV+MG  N + R++   +   +  SRID   +    + +D GY ++IG ++   YH NP+M  F  +L+    +K   A  S  +  F N T      + +++W V  TL+ N  L   RK
Sbjct:  289 LATTIFSTLTSVTYTFHVLVCYRKHLKRLWRGQKSFLPEKFHTPSPAVSVAAITRYSGWQIAFTLWGFLIVHFVQFLFVLMFVYGVVLPIQKGHILSWLSNVGIILLTIFI-VIALVVLQIILVQVFFLQDKLSPEDKEKPLAINNRKAFHSFNYFFFFYNVIMGLSNCVLRLVSSCIVGTWLVSRIDRTIMQRGYESMDPGYSTWIGMIFADHYHSNPVMVSFCHLLLGRTLEKGGPAACSYAT--FSNNTGCSVGGRVRLRWLVLYTLLRNPSLILLRK 566          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Zebrafish
Match: stra6l (STRA6-like [Source:ZFIN;Acc:ZDB-GENE-070410-116])

HSP 1 Score: 83.5741 bits (205), Expect = 3.236e-16
Identity = 80/281 (28.47%), Postives = 142/281 (50.53%), Query Frame = 3
Query: 1155 ICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXE-NSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSL------MEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNET----KRKYKIKWHVALTLINNCQLQTDRK 1964
            +  T+     S+  +F +L  +R H +++ +   S +      P  A  V+ + RYSG+Q A+ LWG ++V F  FLF+   +  ++LP+      SW+  + +  L + I    +VV+Q +LV+  F++++ S       + +NNR+AF  + +  FF NV+MG  N + R++   +   +  SRID   +    + +D GY ++IG ++   YH NP+M  F  +L+    +K   A  S  +  F N T      + +++W V  TL+ N  L   RK
Sbjct:  289 LATTIFSTLTSVTYTFHVLVCYRKHLKRLWRGQKSFLPEKFHTPSPAVSVAAITRYSGWQIAFTLWGFLIVHFVQFLFVLMFVYGVVLPIQKGHILSWLSNVGIILLTIFI-VIALVVLQIILVQVFFLQDKLSPEDKEKPLAINNRKAFHSFNYFFFFYNVIMGLSNCVLRLVSSCIVGTWLVSRIDRTIMQRGYESMDPGYSTWIGMIFADHYHSNPVMVSFCHLLLGRTLEKGGPAACSYAT--FSNNTGCSVGGRVRLRWLVLYTLLRNPSLILLRK 566          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Zebrafish
Match: stra6 (stimulated by retinoic acid 6 [Source:NCBI gene;Acc:724007])

HSP 1 Score: 75.8702 bits (185), Expect = 7.440e-14
Identity = 88/398 (22.11%), Postives = 179/398 (44.97%), Query Frame = 3
Query:  837 NRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCL-ICGTVIGFFNSLIQSFLILRNFRLHFQKITK--KGFS--------SIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIAN---NSDMSLDFKNETKRKYKIK--------WHVALTLINNCQLQTDRK 1964
            +R+ + +   +Y     FR P  LAI + V     Y++ +  I  + P     ++++ +G+      + + F I+  N  +   V+I+       ++Y    L C+ IC       + L+   +++R+  LH   +    +G S        SI   R A  C       + ++ YQAA+L  G+ +     F+ + F + +I++P+++  N  +  +     P  +   +  +IQ +  RF+F+++ G   ++NNR +  + ++  F +NVM+G    I R++I  L  +    R+D + L   ++  D GY  Y  +L       +P+MK F  +L+++  +    A    +++  +    + K++ K+         W +  TL+NN  L   RK
Sbjct:  252 DRLRDAVKSYIYTPEDVFRFPLKLAISVVVAFIALYQMALLLISGVLP----TLHIVRRGVDENIAFLLAGFNIILSN-DRQEVVRIV-------VYY----LWCVEICYVSAVTLSCLVNLLMLMRSMVLHRSNLKGLYRGDSLNVFNCHRSIRPSRPALVC------WMGFTSYQAAFLCLGMAIQTLVFFICILFAVFLIIIPILWGTNLMLFHIIGNLWPFWLTLVLAALIQHVASRFLFIRKDGGTRDLNNRGSLFLLSYILFLVNVMIGVVLGIWRVVITALFNIVHLGRLDISLLNRNVEAFDPGYRCYSHYLKIEVSQSHPVMKAFCGLLLQSSGQDGLSAQRIRDAEEGIQLVQQEKKQNKVSNAKRARAHWQLLYTLVNNPSLVGSRK 627          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Zebrafish
Match: stra6 (stimulated by retinoic acid 6 [Source:NCBI gene;Acc:724007])

HSP 1 Score: 75.8702 bits (185), Expect = 7.440e-14
Identity = 88/398 (22.11%), Postives = 179/398 (44.97%), Query Frame = 3
Query:  837 NRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCL-ICGTVIGFFNSLIQSFLILRNFRLHFQKITK--KGFS--------SIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIAN---NSDMSLDFKNETKRKYKIK--------WHVALTLINNCQLQTDRK 1964
            +R+ + +   +Y     FR P  LAI + V     Y++ +  I  + P     ++++ +G+      + + F I+  N  +   V+I+       ++Y    L C+ IC       + L+   +++R+  LH   +    +G S        SI   R A  C       + ++ YQAA+L  G+ +     F+ + F + +I++P+++  N  +  +     P  +   +  +IQ +  RF+F+++ G   ++NNR +  + ++  F +NVM+G    I R++I  L  +    R+D + L   ++  D GY  Y  +L       +P+MK F  +L+++  +    A    +++  +    + K++ K+         W +  TL+NN  L   RK
Sbjct:  252 DRLRDAVKSYIYTPEDVFRFPLKLAISVVVAFIALYQMALLLISGVLP----TLHIVRRGVDENIAFLLAGFNIILSN-DRQEVVRIV-------VYY----LWCVEICYVSAVTLSCLVNLLMLMRSMVLHRSNLKGLYRGDSLNVFNCHRSIRPSRPALVC------WMGFTSYQAAFLCLGMAIQTLVFFICILFAVFLIIIPILWGTNLMLFHIIGNLWPFWLTLVLAALIQHVASRFLFIRKDGGTRDLNNRGSLFLLSYILFLVNVMIGVVLGIWRVVITALFNIVHLGRLDISLLNRNVEAFDPGYRCYSHYLKIEVSQSHPVMKAFCGLLLQSSGQDGLSAQRIRDAEEGIQLVQQEKKQNKVSNAKRARAHWQLLYTLVNNPSLVGSRK 627          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Zebrafish
Match: stra6 (stimulated by retinoic acid 6 [Source:NCBI gene;Acc:724007])

HSP 1 Score: 75.8702 bits (185), Expect = 7.440e-14
Identity = 88/398 (22.11%), Postives = 179/398 (44.97%), Query Frame = 3
Query:  837 NRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCL-ICGTVIGFFNSLIQSFLILRNFRLHFQKITK--KGFS--------SIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIAN---NSDMSLDFKNETKRKYKIK--------WHVALTLINNCQLQTDRK 1964
            +R+ + +   +Y     FR P  LAI + V     Y++ +  I  + P     ++++ +G+      + + F I+  N  +   V+I+       ++Y    L C+ IC       + L+   +++R+  LH   +    +G S        SI   R A  C       + ++ YQAA+L  G+ +     F+ + F + +I++P+++  N  +  +     P  +   +  +IQ +  RF+F+++ G   ++NNR +  + ++  F +NVM+G    I R++I  L  +    R+D + L   ++  D GY  Y  +L       +P+MK F  +L+++  +    A    +++  +    + K++ K+         W +  TL+NN  L   RK
Sbjct:  252 DRLRDAVKSYIYTPEDVFRFPLKLAISVVVAFIALYQMALLLISGVLP----TLHIVRRGVDENIAFLLAGFNIILSN-DRQEVVRIV-------VYY----LWCVEICYVSAVTLSCLVNLLMLMRSMVLHRSNLKGLYRGDSLNVFNCHRSIRPSRPALVC------WMGFTSYQAAFLCLGMAIQTLVFFICILFAVFLIIIPILWGTNLMLFHIIGNLWPFWLTLVLAALIQHVASRFLFIRKDGGTRDLNNRGSLFLLSYILFLVNVMIGVVLGIWRVVITALFNIVHLGRLDISLLNRNVEAFDPGYRCYSHYLKIEVSQSHPVMKAFCGLLLQSSGQDGLSAQRIRDAEEGIQLVQQEKKQNKVSNAKRARAHWQLLYTLVNNPSLVGSRK 627          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Xenopus
Match: stra6l.1 (stra6-like, gene 1 [Source:NCBI gene;Acc:100145324])

HSP 1 Score: 73.1738 bits (178), Expect = 7.861e-13
Identity = 66/264 (25.00%), Postives = 133/264 (50.38%), Query Frame = 3
Query: 1200 FLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRK---LFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSL------MEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRK 1964
            F IL  +R H +++     S +    + P     V+ + RYSG+Q AYLLWG I++     +         + P+   E   + K   +F+ ++ ++I    ++++Q +L R  F++++ S       + +NNR+AF  + +  FF NV++G    + R++  ++   +  +RID + L    +  D+GY ++IG +Y   YH NP++  F ++L+   + +K++   S       + +  + + +W +  TL+ N +L   RK
Sbjct:  326 FHILVCYRKHMKRLWIGNRSFLPVKFQVPSPYESVAAIARYSGWQVAYLLWGYIIMHIVQIILGLAFAYAFVYPIKHGEALKLFKGLGIFILTIGIVIA---LMMLQVVLARLFFLQQKISCNDKQKPLALNNRKAFHNFNYFFFFYNVIVGLSACLLRLLRSVILGSWLIARIDRSILQRGFESGDTGYTTWIGMIYVDHYHTNPVLVSFCNILL-TKRAEKTVRECSSYHGFSDSGSNIQARTRWLLYYTLLKNPRLILQRK 585          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Xenopus
Match: stra6l.1 (stra6-like, gene 1 [Source:NCBI gene;Acc:100145324])

HSP 1 Score: 72.7886 bits (177), Expect = 9.754e-13
Identity = 66/264 (25.00%), Postives = 133/264 (50.38%), Query Frame = 3
Query: 1200 FLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRK---LFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSL------MEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRK 1964
            F IL  +R H +++     S +    + P     V+ + RYSG+Q AYLLWG I++     +         + P+   E   + K   +F+ ++ ++I    ++++Q +L R  F++++ S       + +NNR+AF  + +  FF NV++G    + R++  ++   +  +RID + L    +  D+GY ++IG +Y   YH NP++  F ++L+   + +K++   S       + +  + + +W +  TL+ N +L   RK
Sbjct:  294 FHILVCYRKHMKRLWIGNRSFLPVKFQVPSPYESVAAIARYSGWQVAYLLWGYIIMHIVQIILGLAFAYAFVYPIKHGEALKLFKGLGIFILTIGIVIA---LMMLQVVLARLFFLQQKISCNDKQKPLALNNRKAFHNFNYFFFFYNVIVGLSACLLRLLRSVILGSWLIARIDRSILQRGFESGDTGYTTWIGMIYVDHYHTNPVLVSFCNILL-TKRAEKTVRECSSYHGFSDSGSNIQARTRWLLYYTLLKNPRLILQRK 553          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Xenopus
Match: STRA6 (stimulated by retinoic acid 6 [Source:NCBI gene;Acc:100124902])

HSP 1 Score: 50.8322 bits (120), Expect = 6.998e-6
Identity = 45/185 (24.32%), Postives = 87/185 (47.03%), Query Frame = 3
Query: 1434 ENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSD-MSLDFKNETKRK---YKIKWHVALTLINNCQLQTDRKKVCV 1976
            EN+W         P+ +   +  ++Q L   F+F++   SL +++NRR+  +       +N + G   S+ R+++  +  V  F R+D + L   +Q  D  Y +Y  FL       +P+++ F  +L  + +K+  +      M  D K +   +    +I+W +A TLI+N  L + R  +C 
Sbjct:  455 ENTW---------PIWLLLVLAALLQHLCTHFLFLER--SLAQIDNRRSLFLLTFLLLPVNALRGLLLSLLRLLVSTIFNVTHFCRLDVSLLQHSVQGWDPAYRNYCHFLMLEVNECHPLVRAFCLLLGPSKEKQADLEEGIQLMPPDGKPQKGGRSHLARIRWSLAYTLIHNPSLLSHRASICT 628          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Mouse
Match: Stra6l (STRA6-like [Source:MGI Symbol;Acc:MGI:1921402])

HSP 1 Score: 83.9593 bits (206), Expect = 1.758e-16
Identity = 74/265 (27.92%), Postives = 129/265 (48.68%), Query Frame = 3
Query: 1200 FLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVV--VVIQSLLVRFVFVK------ERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETK--RKYKIKWHVALTLINNCQLQTDRK 1964
            F IL  +R H +++       +     +P  A  V  + RYSG+Q AY+LWG +++     L    L+  ++LP+I      + + F   L VL  S VV  +++Q  +    F++      ++   + +NNRRAF  + +  FF NV++G    + R++I  L   +  +RID   +    +  D G+ ++IG L+   YH NP++  F  +LI +HK +K         L+     +   + + +W +  TLINN +L   RK
Sbjct:  248 FHILACYRKHMKRLWAGDKHFLPQKFHSPSSAASVVAIARYSGWQIAYILWGYLIIHVVQSLCGVMLMYGLVLPIIHHRGLEMLQGF--GLGVLTLSIVVGLIILQVWIAGTFFLQPKLGTSDKQKPLALNNRRAFHNFNYFLFFYNVLLGLGACLSRLLISCLLGTWLIARIDRTIMQSGYEGADMGFGAWIGMLFVDHYHTNPVLVSFCHILITSHKDRKLQKTVKYWCLNQSAGPRFSARARTRWFLLQTLINNPRLVMLRK 510          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Mouse
Match: Stra6l (STRA6-like [Source:MGI Symbol;Acc:MGI:1921402])

HSP 1 Score: 83.9593 bits (206), Expect = 2.176e-16
Identity = 74/266 (27.82%), Postives = 129/266 (48.50%), Query Frame = 3
Query: 1200 FLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVV--VVIQSLLVRFVFVK------ERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETK--RKYKIKWHVALTLINNCQLQTDRKK 1967
            F IL  +R H +++       +     +P  A  V  + RYSG+Q AY+LWG +++     L    L+  ++LP+I      + + F   L VL  S VV  +++Q  +    F++      ++   + +NNRRAF  + +  FF NV++G    + R++I  L   +  +RID   +    +  D G+ ++IG L+   YH NP++  F  +LI +HK +K         L+     +   + + +W +  TLINN +L   RK 
Sbjct:  339 FHILACYRKHMKRLWAGDKHFLPQKFHSPSSAASVVAIARYSGWQIAYILWGYLIIHVVQSLCGVMLMYGLVLPIIHHRGLEMLQGF--GLGVLTLSIVVGLIILQVWIAGTFFLQPKLGTSDKQKPLALNNRRAFHNFNYFLFFYNVLLGLGACLSRLLISCLLGTWLIARIDRTIMQSGYEGADMGFGAWIGMLFVDHYHTNPVLVSFCHILITSHKDRKLQKTVKYWCLNQSAGPRFSARARTRWFLLQTLINNPRLVMLRKS 602          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Mouse
Match: Stra6l (STRA6-like [Source:MGI Symbol;Acc:MGI:1921402])

HSP 1 Score: 83.9593 bits (206), Expect = 2.176e-16
Identity = 74/266 (27.82%), Postives = 129/266 (48.50%), Query Frame = 3
Query: 1200 FLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVV--VVIQSLLVRFVFVK------ERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETK--RKYKIKWHVALTLINNCQLQTDRKK 1967
            F IL  +R H +++       +     +P  A  V  + RYSG+Q AY+LWG +++     L    L+  ++LP+I      + + F   L VL  S VV  +++Q  +    F++      ++   + +NNRRAF  + +  FF NV++G    + R++I  L   +  +RID   +    +  D G+ ++IG L+   YH NP++  F  +LI +HK +K         L+     +   + + +W +  TLINN +L   RK 
Sbjct:  339 FHILACYRKHMKRLWAGDKHFLPQKFHSPSSAASVVAIARYSGWQIAYILWGYLIIHVVQSLCGVMLMYGLVLPIIHHRGLEMLQGF--GLGVLTLSIVVGLIILQVWIAGTFFLQPKLGTSDKQKPLALNNRRAFHNFNYFLFFYNVLLGLGACLSRLLISCLLGTWLIARIDRTIMQSGYEGADMGFGAWIGMLFVDHYHTNPVLVSFCHILITSHKDRKLQKTVKYWCLNQSAGPRFSARARTRWFLLQTLINNPRLVMLRKS 602          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. UniProt/SwissProt
Match: sp|Q9DBN1|STR6L_MOUSE (Stimulated by retinoic acid gene 6 protein-like OS=Mus musculus OX=10090 GN=Stra6l PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.522e-15
Identity = 74/266 (27.82%), Postives = 129/266 (48.50%), Query Frame = 3
Query: 1200 FLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVV--VVIQSLLVRFVFVK------ERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETK--RKYKIKWHVALTLINNCQLQTDRKK 1967
            F IL  +R H +++       +     +P  A  V  + RYSG+Q AY+LWG +++     L    L+  ++LP+I      + + F   L VL  S VV  +++Q  +    F++      ++   + +NNRRAF  + +  FF NV++G    + R++I  L   +  +RID   +    +  D G+ ++IG L+   YH NP++  F  +LI +HK +K         L+     +   + + +W +  TLINN +L   RK 
Sbjct:  339 FHILACYRKHMKRLWAGDKHFLPQKFHSPSSAASVVAIARYSGWQIAYILWGYLIIHVVQSLCGVMLMYGLVLPIIHHRGLEMLQGF--GLGVLTLSIVVGLIILQVWIAGTFFLQPKLGTSDKQKPLALNNRRAFHNFNYFLFFYNVLLGLGACLSRLLISCLLGTWLIARIDRTIMQSGYEGADMGFGAWIGMLFVDHYHTNPVLVSFCHILITSHKDRKLQKTVKYWCLNQSAGPRFSARARTRWFLLQTLINNPRLVMLRKS 602          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. UniProt/SwissProt
Match: sp|F1RAX4|STRA6_DANRE (Receptor for retinol uptake stra6 OS=Danio rerio OX=7955 GN=stra6 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 5.617e-13
Identity = 88/398 (22.11%), Postives = 179/398 (44.97%), Query Frame = 3
Query:  837 NRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCL-ICGTVIGFFNSLIQSFLILRNFRLHFQKITK--KGFS--------SIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIAN---NSDMSLDFKNETKRKYKIK--------WHVALTLINNCQLQTDRK 1964
            +R+ + +   +Y     FR P  LAI + V     Y++ +  I  + P     ++++ +G+      + + F I+  N  +   V+I+       ++Y    L C+ IC       + L+   +++R+  LH   +    +G S        SI   R A  C       + ++ YQAA+L  G+ +     F+ + F + +I++P+++  N  +  +     P  +   +  +IQ +  RF+F+++ G   ++NNR +  + ++  F +NVM+G    I R++I  L  +    R+D + L   ++  D GY  Y  +L       +P+MK F  +L+++  +    A    +++  +    + K++ K+         W +  TL+NN  L   RK
Sbjct:  252 DRLRDAVKSYIYTPEDVFRFPLKLAISVVVAFIALYQMALLLISGVLP----TLHIVRRGVDENIAFLLAGFNIILSN-DRQEVVRIV-------VYY----LWCVEICYVSAVTLSCLVNLLMLMRSMVLHRSNLKGLYRGDSLNVFNCHRSIRPSRPALVC------WMGFTSYQAAFLCLGMAIQTLVFFICILFAVFLIIIPILWGTNLMLFHIIGNLWPFWLTLVLAALIQHVASRFLFIRKDGGTRDLNNRGSLFLLSYILFLVNVMIGVVLGIWRVVITALFNIVHLGRLDISLLNRNVEAFDPGYRCYSHYLKIEVSQSHPVMKAFCGLLLQSSGQDGLSAQRIRDAEEGIQLVQQEKKQNKVSNAKRARAHWQLLYTLVNNPSLVGSRK 627          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. UniProt/SwissProt
Match: sp|Q0V8E7|STRA6_BOVIN (Receptor for retinol uptake STRA6 OS=Bos taurus OX=9913 GN=STRA6 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.238e-10
Identity = 83/387 (21.45%), Postives = 161/387 (41.60%), Query Frame = 3
Query:  867 VYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIV-SGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCA-GLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNE------TK-----------RKYKIKWHVALTLINNCQLQTDRKKV 1970
            VY+   GFR+P  L + +++     Y++ +  ++ + P     I  +  GI+     + + F IV S +  +  E+   + ++    + + L L CL+  T +   +SL+         R + + + + G   I  L ++P  +   +   + ++ YQ A+   G++V     FL    L  ++ +P++   N  +      S P  +   + V +Q+    + F+        + NRRA        F +NV++G   +  R+++  L       R+D + LP+    LD GY +Y  FL       +P    F  +L+   + K        + L  + E      TK           R+ + +W +A TL++N  LQ  RK  
Sbjct:  284 VYIPQRGFRLPLKLVLSVTLTGTAIYQVALLLLVGVVP----TIQKVRAGITTDVSYLLAGFGIVLSEDRQEVVELVKHHLWALEVCYISALVLSCLL--TFLMLVHSLV-------THRTNLRALHRGGALDIGPLTQSPRPSRQAIFCWMSFTAYQTAFTCLGLLVQQILFFLGTLTLAFLVFMPMLHGRNLLLLHYLKSSWPFWLTLALAVTLQNAAAHWAFLDTHHGRPGLTNRRALYAATFLLFPVNVLVGTMVAAWRVLLSALYNAVHLGRMDLSLLPLRAATLDPGYHTYCNFLRMEASQSHPAATAFCALLLRTQRPKPRATPQDGLRLGEEEEGIQLLQTKDLVAKGAGPRARQGRARWGLAYTLLHNPALQAFRKTA 657          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. UniProt/SwissProt
Match: sp|Q5R7B4|STRA6_PONAB (Receptor for retinol uptake STRA6 OS=Pongo abelii OX=9601 GN=STRA6 PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.676e-8
Identity = 82/389 (21.08%), Postives = 157/389 (40.36%), Query Frame = 3
Query:  867 VYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIV-SGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLI--------------------ENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKV 1970
            +Y    GFR+P  L +  ++     Y++ +  ++ + P     I  +  G++     + + F IV S +  +  E+   + ++    + + L L C +  T +    SL+     LR         +     S    R+A  C       + +S YQ A++  G++V     FL    L  ++L+P++   N  + +    S P  +   + V++QS+   +VF++      ++ NRR         F LNV++G   +  R+++  L       ++D + LP     LD GY +Y  FL       +P M  F  +L+                    E  +  + +     M+   +    R  + +W +A TL++N  LQ  RK  
Sbjct:  283 IYTPQPGFRLPLKLVLSATLTGTAIYQVALLLLVGMVPN----IQKVRAGVTTDVSYLLAGFGIVLSEDKQEVVELVKHHLWALEVCYISALVLSCSL--TFLVLMRSLVTHRTNLRALHRGAALDSSPLHRSPHPSRRAIFC------WMSFSAYQTAFICLGLLVQQIIFFLGTTALAFLVLMPVLHGRNLLLFRSLESSWPFWLTLALAVILQSMAAHWVFLETHDGHPQLTNRRVLYAATFLLFPLNVLVGAMVATWRVLLSALYNAIHLGQMDLSLLPPRAATLDPGYYTYRNFLKIEVSQSHPAMTAFCSLLLQARSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPRANRG-RARWGLAYTLLHNPTLQVFRKTA 658          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. UniProt/SwissProt
Match: sp|Q9BX79|STRA6_HUMAN (Receptor for retinol uptake STRA6 OS=Homo sapiens OX=9606 GN=STRA6 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 4.087e-6
Identity = 42/188 (22.34%), Postives = 76/188 (40.43%), Query Frame = 3
Query: 1467 SLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLI--------------------ENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKV 1970
            S P  +   + V++Q++   +VF++      ++ NRR         F LNV++G   +  R+++  L       ++D + LP     LD GY +Y  FL       +P M  F  +L+                    E  +  + +     M+   +    R  + +W +A TL++N  LQ  RK  
Sbjct:  472 SWPFWLTLALAVILQNMAAHWVFLETHDGHPQLTNRRVLYAATFLLFPLNVLVGAMVATWRVLLSALYNAIHLGQMDLSLLPPRAATLDPGYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRG-RARWGLAYTLLHNPTLQVFRKTA 658          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. TrEMBL
Match: T2M6R0 (Stimulated by retinoic acid gene 6 protein homolog OS=Hydra vulgaris OX=6087 GN=STRA6 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 3.900e-26
Identity = 156/647 (24.11%), Postives = 273/647 (42.19%), Query Frame = 3
Query:  198 GLLLVAILILMFNTKRLSFKINTCKGRPGLAIPMDMLKNNEHIIEYVVGFLSLSEDIYQAIFESKYWTPTMLPIEKFXXXXXXXXXXXXXXXPIFTGIYAKRLTEYAIGFIYAVLLMIFGILDNYSKIDCLVGTI---------IIPKLIIFTFCTI--------------IDGS-------LVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSR-------KYVTRLLRRNIEKVNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNT-----NINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRN----FRLHFQKITKKGFSSIIALRKAPDCAGLVSGLV---RYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKK---------KSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRK 1964
             L  + + I+MF TKR       C GRPG  IP++ML + E+   Y + F       +  IF S Y     L + +            +   P +  ++ K +T  AI  +     +I   LDN   + CL+G           +  K+ I + C++              +D         LV+ FTW +   IK    +      FI    + ++       K+V  LL    +K+  + N   K K N +  +          GF+              F+ RI +   I         +Y++  GI  +            F  + G  + + ++ I       +L Y    + C+     I    S+   F ++ N    +R H   + K  +S + A     D    +  +V    ++GYQ AY +WG I++    F+ L  +   I LP+++ ENS++ K  +   P ++   V++++Q LL RF+ + E+  ++ V+NRR F   A   F+ N+ +G F+S  R+I  ++  V  + RI  ++LP   +  D+GYMSYIG++    YH NP+++CF  +L+E +++K          S+ + S+     KN  K +   +WH+ + L+ N  LQ  R 
Sbjct:  117 SLAYIFVTIMMFFTKRKFIATKLCWGRPGCLIPVNMLDSYENRYGYALSFGLTVSSCFSVIF-SDYSDIVGLEMAQ-----------KLTLLPSYLSVFVK-MTFSAIISVSGAPFLICQSLDN-QLVGCLIGLCMSLSWFVYELSLKIPILSACSLGMLELSGFRILYLLVDLPKHVCLLLLVIKFTWTVIIKIKFRLKQRKSGQGFIWMQTDKTKTNNEYIYKHVASLLSSKQKKIQCDDNNLSKFKFNSLIRD-------NNPGFK--------------FSLRIILSAFISCL-----AVYIMLIGIFMSYEFLFGFRKSEGFFNIGGLETLHLQLGI-------SLEYLKRLVICIKASIWIATLLSVGIFFFVMVNSLFWYRFHILSLRKGDWSFLPATINKHDLISPIDVMVASMNFAGYQVAYSIWGFIIIFILFFVILMIITTQIFLPIVYKENSFLLKQIISLWPTILIGCVIILLQRLLARFILLIEK-DVLAVDNRRIFHGAAFFLFYFNIFIGIFSSFLRIIYGLILGVLFYQRIQKSSLPRSFENWDNGYMSYIGYILLEHYHTNPVLQCFVRLLLEVNERKFLKDDSDLYSSLYSLSETHSTVKNIQKTRALNRWHLYVILLQNPSLQKFRS 715          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. TrEMBL
Match: A0A1S3K4F1 (stimulated by retinoic acid gene 6 protein-like OS=Lingula unguis OX=7574 GN=LOC106178591 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.692e-25
Identity = 141/613 (23.00%), Postives = 272/613 (44.37%), Query Frame = 3
Query:  207 LVAILILMFNTKRLSFKINTCKGRPGLAIPMDMLKNNEHIIEYVVGFLSLSEDIYQA-IFESKYWTPTMLPIEKFXXXXXXXXXXXXXXXPIFTGIYAKRLTEYAIGFIYAVLLMIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIIDGSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSR-KYVTRLLRRNIEKVNEETNFFQKIKCNRINEELTQR-VYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQ-SLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQ-KLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKK-----------------KSIANNSD----MSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKK 1967
            ++ ++I  F  KR +       GRPG+  PM+ L++      Y   +  L+  +    +FE +  T    P  K L  + +++ Y ++ YP+FT I    +  Y+IG++Y ++ M   +L    +++C    + +  L +     +    L V F  +I  HI       + +    H + E+ + KYV  +L++ +    +  +   ++K   I+  L +R  Y ++ G++    +    +V +   Y   +            + Y +              FL +  +Y  Y E  + + F  L      +  GC+I    I F  SL+    ++ NFR +   I +  +S+I    K  +  G + G V+++G+Q AY+ W  ++    +      +  VI L ++      I  + LQ + P  + + V+++IQ LL   VF++ERG ++ VNNR     +    F  N+++G F+++ R++  M   +    R+D + LP +    LD GY +Y+G L+    H +P+M  F  +L+    KK                 + +A+ ++    M L    E   + + +W +A TL+NN +L  +RK+
Sbjct:   54 VIVLVIFSFTEKRRNLCSGCLHGRPGIVFPMNCLESRHDRWAYAAAYAVLAISVLDFFLFEDQ--TTVGPPYMKQLSLVLLVLRYGLVVYPLFTAITLNTIFSYSIGWVYLIIYMGIEVL---YRVECTGDQVWVMYLGMCLPAYLGMVILFVDFPVQIIRHIVYRIKYRSFKERINHFLQENYQAKYVRVILKKKVTIDTQGLSRGARVKSGCIS--LFKRYTYTRMPGYKYSTRMVTTFTVAIILVYAFAL------------MFYFL--------------FLSIVDDYGAYLE-YLYSDFGVLI----QVTRGCVIGALTIAFLASLLTIAYMMANFRENLMAIQRGDYSNIPPPSKKGNI-GWMMGYVKFAGFQVAYITWAFVIHALVLTAVFVLIGIVIALLVMENAAVDILIMILQYAWPYAVTTIVLLIIQRLLTWLVFLQERGKVLAVNNRNLMFNFLFFMFIYNMLLGLFSTLMRILKGMAVGLLFLGRLDHSTLPRHADLMLDPGYGAYVGMLHVENAHTHPVMVTFVHILVIEFNKKNAANDDLDDDLTVVHHTEPVASKTENGIKMELKTPEEGVTRARTRWLLAYTLLNNPKLIYERKR 627          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. TrEMBL
Match: R7UPT0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_225028 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.008e-23
Identity = 74/269 (27.51%), Postives = 145/269 (53.90%), Query Frame = 3
Query: 1188 LIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNET-----KRKYKIKWHVALTLINNCQLQTDRKKVCVK 1979
            L    L+  N+R    K+ K  +S    + +    A  + G ++YSG+Q A+ ++   ++   + + L  +  ++++P+   E++++ ++  +  P +I +  +   Q +L +F F+++ G+ M + NRRA  I ++  FF NV++G F+ ++R++  +L      SR+D   L    ++LD+GY +Y+G L    YH +PI+K F D++IE+ ++          S D  ++T     KR  + +W  ALTL+NN  +  DR +V +K
Sbjct:  390 LFSMVLVFLNYRKDLLKLFKGNYSWQPKMIEKSSAASALFGSMKYSGFQIAFFIYAWFLLSVILVVVLMLVCYLVIVPIRDKESNFVLRMLYKLWPTVIVTVALNFAQLMLCKFCFLQQNGAFMALTNRRAMNIASYFLFFFNVLLGLFSCLRRILFSVLIGTILISRLDRLLLTKGFERLDTGYSTYLGMLKVDLYHTHPILKAFVDIVIEHRREVTEAPATVIHSKDTADKTQPMTRKRIARNRWRKALTLVNNPTILLDRLQVQIK 658          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. TrEMBL
Match: A0A183A661 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2446 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 9.314e-23
Identity = 98/391 (25.06%), Postives = 183/391 (46.80%), Query Frame = 3
Query:  735 HCIDEDSRKYVTRLLRRNIEKVNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQII----DLTPQGWTVIYL----INKGISN----TNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSL 1871
            H ++E ++++ T+ +RR +   N                   +R+Y    GF  PP+L   ++V L   Y   M+Q +    +L   G + I      INK +      +N         +S N S    +K+  AF Y   ++ ++ L C+I  + +  F++ +  F I+ N++     I ++G+ S+ A++   D   +  G + Y  YQ A +  G  + +        FL  V+ +     + +++   F  S P ++   V   +Q L +RF+F K  G     NN R+  +YA  A F NV+ G  + + R++   ++   C SR+D + L + LQ +D+ YM+++GFLY+     NP +K F  +L++N  +  + ++N D +L
Sbjct:   63 HGLNEIAQEHQTKSMRRCVGLRNA-----------------VRRLYNPPVGFTYPPILIWSLTVSLLLQY-FLMNQTLTWFYNLASHGRSSITHKFPEINKTLKENLAISNARYVYTLFQMSANSSHQDMLKMQYAFIY---YWIDIILVCVISTSFLAIFSNSVNVFQIMLNYQRLCFGIYRRGYESVPAMKLLLDPFKVTHGTILYPSYQIALMACGFYLQVLIYGTIFIFLAIVVNMNAFT-KYAFVVYFFQTSWPSIVLISVFGTVQQLAIRFLFTKHGGKSYGFNNVRSLQVYAFFASFYNVIFGLISGVGRILYCPISSAICISRLDISPLGLPLQNMDTSYMAFLGFLYSDTMINNPTVKAFLWILLQNQYEDLAQSSNFDSAL 431          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. TrEMBL
Match: A0A4E0QZH5 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_008942 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.098e-20
Identity = 84/334 (25.15%), Postives = 157/334 (47.01%), Query Frame = 3
Query:  861 QRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQII---DLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNY-------SKYSEVKIINAFSYLTLFY-TNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENH 1829
             R++    GF  PP+L   ++V L   Y +    +    D+  QG    Y I++   + N  +     I +  +        K S  + I    Y  ++Y  ++F  C++  + +  F++ +  F I+ N++     I + G +++ A+++  +   +  G + Y  YQ A +  G  + I         L  V+ +     + ++I   F  S P ++   +   +Q L +RF+F K RG     NN R+  +YA  A F NV+ G  + + R++   ++   C SR+D + L + LQ +D+GY++++GFLY      NPIMK F  +L+ +H
Sbjct:  342 SRLFNPPMGFTYPPILVWSLTVSLLLQYFLINQSLTWFYDVIAQG---RYSISQRFPDLNKTLGENLAISNARHVYSLFELPKNSSAETILRLQYAFIYYWIDIFWLCVLISSFLALFSNTVSVFQIMLNYQELSFAIYRGGHNAVPAMKRLLNPFKVTRGTILYPSYQIALMACGFYLQILIYGAIFILLSVVVTMNAFTNQ-AFIVYFFRTSWPSVVLITIFRTVQELAIRFLFTKHRGKSYGFNNVRSLQVYAFFASFYNVIFGLISGVGRILYCPISSAICISRMDISPLGIPLQNVDTGYVAFLGFLYADTTTNNPIMKTFLWILLHDH 671          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Cavefish
Match: stra6 (stimulated by retinoic acid 6 [Source:NCBI gene;Acc:103022151])

HSP 1 Score: 79.337 bits (194), Expect = 6.068e-15
Identity = 136/619 (21.97%), Postives = 261/619 (42.16%), Query Frame = 3
Query:  165 PNGDS--YFIIKSGLLLVAILILMFNTKRLSFKINTCKGRPGLAIPMDMLKNNEHIIEYVVGFLSLSEDIYQAIFESKYWTPTMLPIEKFXXXXXXXXXXXXXXXP-IFTGIYAKRLTEYAIGFIYAVLL--MIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIIDGSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSRKYVTRLLRRNIEKVNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLT--LFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIAN---NSDMSLDFKNETKRKYKI---------KWHVALTLINNCQLQTDRK 1964
            P  D   Y I  + + LV +LIL    +R     ++ KG PGL  P++ L + +H    V  F  L   I   +  S       LP  K        +  ++  YP ++  + A       +G++   LL    FG+L  + K+DC     I     +F+    I     + F + +       G      SE     D  S  Y   + +   +K   + +   K+   RI++     +Y     FR P  LAI + V     Y++ +  +  + P     + ++ +G+      + + F I   +  K   VKI+  + +     + + + L CL+  T+  F  S++   L   N R  ++      ++    +R  P    LV  +  ++ YQAA++  G+I+     F+ L F + ++++P+ + +N  +  +  +  P  +  ++V +IQ L  RF+F+K+     ++ NR +  +  +  F +N+++G    I R++I  L  +    R+D + L   ++  D GY  Y  +L       +P+MK F  +L++   + K       +++  +   ++ K++ K           WH+  TL+NN  L   RK
Sbjct:   34 PTADDGLYHICIAAISLVVMLILAVLARRQKVG-DSLKGVPGLLSPVNFLDHTQHKGLSVAVFGVLFCKIIGLVLAS-----NPLPFTKDTQYKEYWLILALFYYPALYYPLLACGTLHNKVGYVLGSLLSWTHFGVL-VWQKVDCPKTPQIYKYYALFSSLPQIACLAFLSFQYPLLLFKGLKGTEKTNASE-----DLKSSYYRDYVKKILKKKKPSQASSRPKLS-ERISDAFKSYIYTPEEVFRFPLKLAISLVVAFIALYQMALLLVTGIVP----TLQIVRRGVDEDIAFLLAGFNIHLSDDRK-EVVKIVVHYMWCVEVCYASAVTLSCLVNLTM--FMRSMV---LHRSNLRGLYRGDIYNVYNCQRNIR--PSRPALVCWM-GFTSYQAAFICLGMIIQTLVFFICLLFGVFLVIIPIFYGKNMLLFHVIGRMWPFWLMLFLVGLIQHLTSRFLFIKKEAGTRDLTNRGSLFLLTYLLFPVNILVGALLGIWRLVITALFNIVHLGRLDISLLNRNVEAFDPGYHCYAHYLKIEVSQSHPVMKAFCGLLLQAPGQDKGSGQAVRDAEEGIQLVSQDKKQNKPVSNGKRARGHWHLLYTLVNNPSLVGSRK 626          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Cavefish
Match: stra6l (STRA6-like [Source:ZFIN;Acc:ZDB-GENE-070410-116])

HSP 1 Score: 73.9442 bits (180), Expect = 2.812e-13
Identity = 69/259 (26.64%), Postives = 134/259 (51.74%), Query Frame = 3
Query: 1218 FRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXE-NSWIRKL--FLQSLPVLIGSYVVVVIQSLLVRFVFVKER------GSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENH-KKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRK 1964
            +R H +++     S +      P  A  V+ L +Y G Q A+ +WG ++V   +F+F    + ++++P+  +    W+  L  FL +  ++I    ++++Q LLV+  F++E+         + +NNR+AF  + +  FF NV++G  + I R+       +   SRI+   +P   + LD GY ++IG +    YH +P+M CF  +L++   +++KS    S ++    +  + + +  WHV+ TL+ N +L   RK
Sbjct:  355 YRKHMKRLWAGNKSFLPNNDYVPHSAVSVAALAKYPGCQIAFTIWGYLIVHIALFVFGMIFVYLVVVPIRCVGLGKWLINLLIFLSNFLIVIA---LLMLQILLVQVFFLQEKIKPENKEKPLALNNRKAFHNFNYFFFFYNVILGLGSCILRLFGSAFVGLLLVSRINRTIMPKGFEMLDKGYQTWIGMIMADHYHSSPVMVCFCHLLLKRTLERQKSTKAYSRLNSTSGSPAEVRARAHWHVSYTLLRNPKLIMLRK 610          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Cavefish
Match: stra6l (STRA6-like [Source:ZFIN;Acc:ZDB-GENE-070410-116])

HSP 1 Score: 73.9442 bits (180), Expect = 2.891e-13
Identity = 69/259 (26.64%), Postives = 134/259 (51.74%), Query Frame = 3
Query: 1218 FRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXE-NSWIRKL--FLQSLPVLIGSYVVVVIQSLLVRFVFVKER------GSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENH-KKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRK 1964
            +R H +++     S +      P  A  V+ L +Y G Q A+ +WG ++V   +F+F    + ++++P+  +    W+  L  FL +  ++I    ++++Q LLV+  F++E+         + +NNR+AF  + +  FF NV++G  + I R+       +   SRI+   +P   + LD GY ++IG +    YH +P+M CF  +L++   +++KS    S ++    +  + + +  WHV+ TL+ N +L   RK
Sbjct:  337 YRKHMKRLWAGNKSFLPNNDYVPHSAVSVAALAKYPGCQIAFTIWGYLIVHIALFVFGMIFVYLVVVPIRCVGLGKWLINLLIFLSNFLIVIA---LLMLQILLVQVFFLQEKIKPENKEKPLALNNRKAFHNFNYFFFFYNVILGLGSCILRLFGSAFVGLLLVSRINRTIMPKGFEMLDKGYQTWIGMIMADHYHSSPVMVCFCHLLLKRTLERQKSTKAYSRLNSTSGSPAEVRARAHWHVSYTLLRNPKLIMLRK 592          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Cavefish
Match: stra6 (stimulated by retinoic acid 6 [Source:NCBI gene;Acc:103022151])

HSP 1 Score: 73.559 bits (179), Expect = 3.227e-13
Identity = 126/585 (21.54%), Postives = 247/585 (42.22%), Query Frame = 3
Query:  261 NTCKGRPGLAIPMDMLKNNEHIIEYVVGFLSLSEDIYQAIFESKYWTPTMLPIEKFXXXXXXXXXXXXXXXP-IFTGIYAKRLTEYAIGFIYAVLL--MIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIIDGSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSRKYVTRLLRRNIEKVNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLT--LFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIAN---NSDMSLDFKNETKRKYKI---------KWHVALTLINNCQLQTDRK 1964
            ++ KG PGL  P++ L + +H    V  F  L   I   +  S       LP  K        +  ++  YP ++  + A       +G++   LL    FG+L  + K+DC     I     +F+    I     + F + +       G      SE     D  S  Y   + +   +K   + +   K+   RI++     +Y     FR P  LAI + V     Y++ +  +  + P     + ++ +G+      + + F I   +  K   VKI+  + +     + + + L CL+  T+  F  S++   L   N R  ++      ++    +R  P    LV  +  ++ YQAA++  G+I+     F+ L F + ++++P+ + +N  +  +  +  P  +  ++V +IQ L  RF+F+K+     ++ NR +  +  +  F +N+++G    I R++I  L  +    R+D + L   ++  D GY  Y  +L       +P+MK F  +L++   + K       +++  +   ++ K++ K           WH+  TL+NN  L   RK
Sbjct:   15 DSLKGVPGLLSPVNFLDHTQHKGLSVAVFGVLFCKIIGLVLAS-----NPLPFTKDTQYKEYWLILALFYYPALYYPLLACGTLHNKVGYVLGSLLSWTHFGVL-VWQKVDCPKTPQIYKYYALFSSLPQIACLAFLSFQYPLLLFKGLKGTEKTNASE-----DLKSSYYRDYVKKILKKKKPSQASSRPKLS-ERISDAFKSYIYTPEEVFRFPLKLAISLVVAFIALYQMALLLVTGIVP----TLQIVRRGVDEDIAFLLAGFNIHLSDDRK-EVVKIVVHYMWCVEVCYASAVTLSCLVNLTM--FMRSMV---LHRSNLRGLYRGDIYNVYNCQRNIR--PSRPALVCWM-GFTSYQAAFICLGMIIQTLVFFICLLFGVFLVIIPIFYGKNMLLFHVIGRMWPFWLMLFLVGLIQHLTSRFLFIKKEAGTRDLTNRGSLFLLTYLLFPVNILVGALLGIWRLVITALFNIVHLGRLDISLLNRNVEAFDPGYHCYAHYLKIEVSQSHPVMKAFCGLLLQAPGQDKGSGQAVRDAEEGIQLVSQDKKQNKPVSNGKRARGHWHLLYTLVNNPSLVGSRK 574          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Cavefish
Match: stra6 (stimulated by retinoic acid 6 [Source:NCBI gene;Acc:103022151])

HSP 1 Score: 71.2478 bits (173), Expect = 1.750e-12
Identity = 86/390 (22.05%), Postives = 177/390 (45.38%), Query Frame = 3
Query:  837 NRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLT--LFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIAN---NSDMSLDFKNETKRKYKI---------KWHVALTLINNCQLQTDRK 1964
             RI++     +Y     FR P  LAI + V     Y++ +  +  + P     + ++ +G+      + + F I   +  K   VKI+  + +     + + + L CL+  T+  F  S++   L   N R  ++      ++    +R  P    LV  +  ++ YQAA++  G+I+     F+ L F + ++++P+ + +N  +  +  +  P  +  ++V +IQ L  RF+F+K+     ++ NR +  +  +  F +N+++G    I R++I  L  +    R+D + L   ++  D GY  Y  +L       +P+MK F  +L++   + K       +++  +   ++ K++ K           WH+  TL+NN  L   RK
Sbjct:  232 ERISDAFKSYIYTPEEVFRFPLKLAISLVVAFIALYQMALLLVTGIVP----TLQIVRRGVDEDIAFLLAGFNIHLSDDRK-EVVKIVVHYMWCVEVCYASAVTLSCLVNLTM--FMRSMV---LHRSNLRGLYRGDIYNVYNCQRNIR--PSRPALVCWM-GFTSYQAAFICLGMIIQTLVFFICLLFGVFLVIIPIFYGKNMLLFHVIGRMWPFWLMLFLVGLIQHLTSRFLFIKKEAGTRDLTNRGSLFLLTYLLFPVNILVGALLGIWRLVITALFNIVHLGRLDISLLNRNVEAFDPGYHCYAHYLKIEVSQSHPVMKAFCGLLLQAPGQDKGSGQAVRDAEEGIQLVSQDKKQNKPVSNGKRARGHWHLLYTLVNNPSLVGSRK 608          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Sea Lamprey
Match: stra6 (stimulated by retinoic acid 6 [Source:NCBI gene;Acc:724007])

HSP 1 Score: 63.5438 bits (153), Expect = 8.171e-11
Identity = 68/290 (23.45%), Postives = 123/290 (42.41%), Query Frame = 3
Query: 1155 ICGTVIGFFNSLIQSFLILRNF---RLHFQKITKKGFSSIIALRKAPDCAGL-VSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIE---NHKKKKSIANNSDMS--------LDFKNETKR-----KYKIKWHVALTLINN-CQLQTDR 1961
            +C  V      LI  +++LR F   R H   + +   S II   ++   +GL V   + YSG+Q A +  G  +     ++    +  ++++P ++   +    +     P  +   +V+V+Q LL R VF+K+      ++N R   I  +  F  N+ +G      R+II  +       R+D + L   +   D GY  Y+GFL     H +P+++ F   L+    N     S+    D+         +  + +  R     + + +W VA TL+ N C L   R
Sbjct:  295 VCYVVSVAAACLITIYMLLRTFAMQREHLLAMYRGDTSEIIPKNQSLPSSGLSVVSWMTYSGFQTALIFLGFAIQAIIYYICSVAIAFLLIIPSMYGLTAVALNIVRNMWPFWLMLVLVIVVQHLLARLVFLKKSEHHSSLDNLRLLYITTYMLFCYNIFIGVLTGFWRLIITAMYNTVHLCRMDVSLLSQGVALYDPGYRCYVGFLQLEASHAHPVVRAFCKALVRATSNSSCSASVVPTRDVEEAPAGVQLVQRRAQGVRLLRAHQSRGRWLVAYTLLRNPCLLPRKR 584          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Sea Lamprey
Match: stra6l (STRA6-like [Source:ZFIN;Acc:ZDB-GENE-070410-116])

HSP 1 Score: 56.6102 bits (135), Expect = 8.996e-9
Identity = 61/227 (26.87%), Postives = 114/227 (50.22%), Query Frame = 3
Query: 1200 FLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXEN-SWIRKLFLQSLPVLIGSYVVVVIQS-----LLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIEN-HKKKKSIANNS 1859
            F IL  +R H +++ + G  S +  RK P    +++  VRY+G+Q AYLLWG +V+    FL +  +    +LP++       ++ L +  L + +   V+VV         L   +  ++    + +NN RAF+ +++  FF +VM+G    I R++          +RID   +P   + +D GY ++IG L+   YH +P++  F  +L++  H    ++ N +
Sbjct:  167 FHILVCYRKHIKRLWR-GDRSFLP-RKQPKAGPMIAAGVRYTGWQIAYLLWGYLVLHGVQFLLMLLIAYGFVLPIMSGRGLQMLQGLEMGQLSIFLVIGVIVVQVIISDVCFLQPKINAEDSSRPLALNNIRAFLNFSYFFFFYDVMLGMGACIVRLLFGATIGACLVARIDRTIMPRGYEVVDMGYSTWIGMLHMDLYHSHPVLLAFCTLLLDGCHCSTGTLPNGA 391          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Nematostella
Match: EDO45675 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS29])

HSP 1 Score: 107.457 bits (267), Expect = 2.443e-24
Identity = 94/334 (28.14%), Postives = 166/334 (49.70%), Query Frame = 3
Query:  999 YLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITK--KGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXE-NSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKK---KSIANNS----DMSLDFKNE-TKRKYKIKWHVALTLINNCQLQTDRKK 1967
            Y +N    N  I         + +Y KY E+  +        +Y  L L C+ C  ++           +L  +R H   + K  K F     L+K P    L +GL +YSGYQ AY+ W  ++  F +FL L  L    + P++    +S +    L+  P +  S ++++IQ LL +FVF+ + GS + ++NRR F I  +  FF N+ +G  + + R+II     +   +R   + +    +  D G+ +Y+G+LY    H NP++  F+ +L+ + ++K   +  A+ S    D+ LD + + ++R+ +I+W +A+TLINN  L   RK+
Sbjct:  260 YSLNYLADNPKILEDLGLTDYAADYEKYLEICFVA-------WYVALGLTCVKCVVLVAN---------MLTWYRTHVMCLQKGDKSFLPADTLKKTPSNMTL-AGL-KYSGYQVAYIAWAFVIAHFVIFLVLAILGIEFIQPIVDGSMDSLVWAQVLKIWPAIFVSLMIILIQFLLAKFVFLIDNGSYLALDNRRLFHICTYFLFFFNIFLGLASCLLRIIIGSALGIVFLARTQKSVISRDYEDRDPGFHAYVGYLYLEHTHSNPVLVTFSRLLVMSLRQKDWDERAAHESQEHQDIELDEEKQLSRRRARIRWSLAVTLINNPNLCELRKR 575          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Nematostella
Match: EDO30950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZB2])

HSP 1 Score: 75.8702 bits (185), Expect = 2.815e-14
Identity = 72/271 (26.57%), Postives = 123/271 (45.39%), Query Frame = 3
Query: 1314 VRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXE-NSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLI---------ENHKKKKSIANNS------------------------------------------DMSLDFKNE-TKRKYKIKWHVALTLINNCQLQTDRKK 1967
            ++YSGYQ AYL W  ++  F MFL    L    + P++    +S++    L+  P +  S ++ +IQ LL +FVF+ +RGS M ++NRR F I A+  FF N  +G  + + R+I+     +   +R   + +    +  D G+ +Y+G+L    +H NP++  F  +LI         E  K       N+                                          D+ LD + + ++R+ +I+W +A+TLINN  L   RK+
Sbjct:  484 LKYSGYQVAYLAWAFVINHFVMFLVAALLGIEFIQPIVDGSMDSFVWTQVLKLWPAIFVSLLIFLIQFLLAKFVFLIDRGSSMSLDNRRLFHICAYFLFFFNTFLGLISCLLRIILGAALGIVFLARTQKSVVSRDFEDYDPGFHAYVGYLLLEHHHSNPVLVTFCRVLIMSLRQRYWGETPKTDDDQQENATFNGCRVLEACVDSRALPXEKARIMPTNKLSFFFFLISLEHQDIELDEEKQLSRRRARIRWSLAVTLINNPNLCELRKR 754          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Nematostella
Match: EDO46687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPH6])

HSP 1 Score: 46.595 bits (109), Expect = 1.023e-6
Identity = 24/72 (33.33%), Postives = 41/72 (56.94%), Query Frame = 3
Query: 1605 FFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLI 1820
            F  NV++G F+++ R +  ++  +    RID   L    Q  D GY+SY+GF+  L+ H +P+M  F  +L+
Sbjct:    6 FMYNVIVGIFSAVIRGLKSLILGLVFLPRIDRTPLMQQYQYWDKGYLSYVGFINVLKAHSHPVMLVFCQLLL 77          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Medaka
Match: stra6 (stimulated by retinoic acid 6 [Source:NCBI gene;Acc:101164553])

HSP 1 Score: 88.5817 bits (218), Expect = 7.410e-18
Identity = 148/645 (22.95%), Postives = 262/645 (40.62%), Query Frame = 3
Query:  120 SLDVQTQKLNCTKLFPNGDS--YFIIKSGLLLVAILILMFNTKRLSFKINTCKGRPGLAIPMDMLKNNEHIIEYVVGFLSLSEDIYQAIFESKYW----TPTMLPIEKFXXXXXXXXXXXXXXXP-IFTGIYAKRLTEYAIGFIYAVLL--MIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIIDGSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSRKYVTRLLRRNIEKVNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKIT--KKGF--------SSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIAN---NSDMSLDFKNETKRKYKIK--------WHVALTLINNCQLQTDRK 1964
             L  + QK       P  D   Y I  + + LV +LIL    +R S      KG PGL  P++ L + +H    V  F          +   K W    +P  LP           +   +  YP ++  + A       +G++   LL    FGIL  + KIDC +  +I     +F+    I     + F + +       G      +E +       R YV ++      K N  +N  +     RI + +   +Y     FR P  LAI   +     Y++ +  I  + P   T  Y +++ I+N    + + F IV     +   V+I+       ++Y      C I    +     LI   +++R+  LH   +T   +G          SI A R A  C       + YS + AA++  G+++     FL L   + +I++P+   +N ++ +      P  +   + V+IQ +  RF F+K+  S ++++NR    +  +  F +NV++G   ++ RMII  L  +    R D + L   ++  D  Y  Y  +L       +P+MK F  +L+E+  ++   A    +++  +    + K+++KI         W +  TL+NN  L   RK
Sbjct:   16 PLPTKIQKETIPPCHPTADDMLYHICITAISLVVMLILAVLARR-SKAAGRQKGLPGLLSPVNFLDHTQHKGLAVAVF---------GVLLCKLWGLLISPDPLPFTNGTENKQNWVILGVFYYPALYYPLLACGTLHNKVGYVLGSLLSWTHFGIL-VWQKIDCPITPLIHKHYSLFSSLPQIACLAFLSFQYPLLLFKGFKGTEKGNATEDLS--SSYYRDYVKKIFNEKKSKKNSSSNIDKPKLPQRIIDAVKSYIYTPQDAFRFPLKLAISGVISFITLYQVGLLLISAVIPTLQTARYGVDEDIAN----VLAGFQIVLSP-DRREVVRIV-------VYYMWCVEVCYISAMTLSV---LINLAMLMRSMVLHRSNLTCLYRGDILNVYNCQRSIRASRPALVC------WMGYSSFTAAHICIGMVIQTLVFFLCLLITVFLIIIPIFHGQNLFLLQTAWSMWPFWLMILLSVLIQHITARFCFIKKTASTLDLDNRGNLFLLTYLLFPVNVLIGVLLALWRMIITALFNIVHMGRTDISLLNRNVEAFDPAYRCYAHYLKIEVSQSHPVMKAFCGVLLESVGQESKAAQRPRDAEEGIQLVQQEKKQHKISSAKRARRHWQLLYTLVNNPSLVGTRK 626          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Medaka
Match: stra6l (stimulated by retinoic acid gene 6 protein-like [Source:NCBI gene;Acc:101160617])

HSP 1 Score: 82.4185 bits (202), Expect = 5.656e-16
Identity = 86/289 (29.76%), Postives = 146/289 (50.52%), Query Frame = 3
Query: 1155 ICGTVIGFFNSLIQSFLILRNFRLHFQKITK--KGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXE--NSWIRKLFLQSLPVLIGS----YVVVVIQSLLVRFVFVKERGSLME------VNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETKRKY-----KIKWHVALTLINNCQLQTDRK 1964
            +  TV    NS+   F I+  +R H +++ K  KGF  +      P  A  V+ + RYSG+Q A+ LWG ++V F  FLF      +++LP+      N       L SL +++ +      ++V+Q +LV+  F++++ S  +      +NNRRAF  + +  FF NV+MG    I R++  ++   +  SRID   +    +K+D+GY ++IG ++   YH NP+M CF  +L+ N  +++S    +   L F N T   +     + +W +  TL  N  L   RK
Sbjct:  299 LATTVFASVNSVAYVFHIMVCYRKHMKRLWKGQKGF--LPERFHKPRSAVSVASIARYSGWQIAFTLWGYLIVHFIHFLFALLFAYLLVLPIKHGNVLN------MLSSLGIILLTIGLVTALIVLQIVLVQVFFLQDKMSPTDKEKPLALNNRRAFHCFNYFFFFYNVVMGISICIVRLMFSIIAGTWLVSRIDRTIMQRGYEKMDAGYSTWIGMIFADHYHNNPVMVCFCQLLVSNTLERQS----ATTYLSFSNATSAAHANSRARRRWTLLYTLQKNPHLILFRK 575          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Medaka
Match: stra6l (stimulated by retinoic acid gene 6 protein-like [Source:NCBI gene;Acc:101160617])

HSP 1 Score: 82.4185 bits (202), Expect = 6.440e-16
Identity = 85/287 (29.62%), Postives = 149/287 (51.92%), Query Frame = 3
Query: 1155 ICGTVIGFFNSLIQSFLILRNFRLHFQKITK--KGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGS----YVVVVIQSLLVRFVFVKERGSLME------VNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETKRKY-----KIKWHVALTLINNCQLQTDRK 1964
            +  TV    NS+   F I+  +R H +++ K  KGF  +      P  A  V+ + RYSG+Q A+ LWG ++V F  FLF      +++LP+   ++  +  + L SL +++ +      ++V+Q +LV+  F++++ S  +      +NNRRAF  + +  FF NV+MG    I R++  ++   +  SRID   +    +K+D+GY ++IG ++   YH NP+M CF  +L+ N  +++S    +   L F N T   +     + +W +  TL  N  L   RK
Sbjct:  323 LATTVFASVNSVAYVFHIMVCYRKHMKRLWKGQKGF--LPERFHKPRSAVSVASIARYSGWQIAFTLWGYLIVHFIHFLFALLFAYLLVLPI---KHGNVLNM-LSSLGIILLTIGLVTALIVLQIVLVQVFFLQDKMSPTDKEKPLALNNRRAFHCFNYFFFFYNVVMGISICIVRLMFSIIAGTWLVSRIDRTIMQRGYEKMDAGYSTWIGMIFADHYHNNPVMVCFCQLLVSNTLERQS----ATTYLSFSNATSAAHANSRARRRWTLLYTLQKNPHLILFRK 599          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Medaka
Match: stra6l (stimulated by retinoic acid gene 6 protein-like [Source:NCBI gene;Acc:101160617])

HSP 1 Score: 82.0333 bits (201), Expect = 7.433e-16
Identity = 85/284 (29.93%), Postives = 148/284 (52.11%), Query Frame = 3
Query: 1164 TVIGFFNSLIQSFLILRNFRLHFQKITK--KGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGS----YVVVVIQSLLVRFVFVKERGSLME------VNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETKRKY-----KIKWHVALTLINNCQLQTDRK 1964
            TV    NS+   F I+  +R H +++ K  KGF  +      P  A  V+ + RYSG+Q A+ LWG ++V F  FLF      +++LP+   ++  +  + L SL +++ +      ++V+Q +LV+  F++++ S  +      +NNRRAF  + +  FF NV+MG    I R++  ++   +  SRID   +    +K+D+GY ++IG ++   YH NP+M CF  +L+ N  +++S    +   L F N T   +     + +W +  TL  N  L   RK
Sbjct:  369 TVFASVNSVAYVFHIMVCYRKHMKRLWKGQKGF--LPERFHKPRSAVSVASIARYSGWQIAFTLWGYLIVHFIHFLFALLFAYLLVLPI---KHGNVLNM-LSSLGIILLTIGLVTALIVLQIVLVQVFFLQDKMSPTDKEKPLALNNRRAFHCFNYFFFFYNVVMGISICIVRLMFSIIAGTWLVSRIDRTIMQRGYEKMDAGYSTWIGMIFADHYHNNPVMVCFCQLLVSNTLERQS----ATTYLSFSNATSAAHANSRARRRWTLLYTLQKNPHLILFRK 642          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Medaka
Match: ENSORLT00000034582.1 (stimulated by retinoic acid gene 6 protein-like [Source:NCBI gene;Acc:101165497])

HSP 1 Score: 69.707 bits (169), Expect = 6.242e-12
Identity = 73/265 (27.55%), Postives = 134/265 (50.57%), Query Frame = 3
Query: 1206 ILRNFRLHFQKITKKGFSSIIALR-KAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXX-----XXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRF-VFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIEN-----HKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRK 1964
            IL  +R H ++  + G  S + L+ + P  A  ++ + +YSG Q A+ LWG ++V   +FLF       +++P+     + L  +W   +    L V + +  VV +Q   ++  +   ++   + +NNR+AF  +++  F  NV +G    I R+++ M+      SRID + +    ++LD G+M+++G ++   YH NP+M CF  +L  N      K   S+ +N+      K    R +K +W ++ TL+ N QL   RK
Sbjct:  323 ILACYRKHLRRF-RTGQKSFLPLKLQNPKAAFCLASIAQYSGCQIAFTLWGYVIVHVVLFLFAVTFAYALVIPIKNGMGLSLLQTWGTGILNIGLIVALKAAQVVFVQIFFLQDKISPTDKQKPLSLNNRKAFSFFSYFFFLYNVGVGLTACILRLLLNMVIGTALVSRIDRSIMQKGYERLDLGHMTWVGMIFADHYHNNPVMLCFCQLLWSNTVKDQRKPAYSLLHNTTSGSFVK---VRAWK-RWMLSYTLLRNPQLILLRK 582          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Planmine SMEST
Match: SMESG000031046.1 (SMESG000031046.1)

HSP 1 Score: 1218.76 bits (3152), Expect = 0.000e+0
Identity = 646/650 (99.38%), Postives = 647/650 (99.54%), Query Frame = 3
Query:   48 MSSFFQVAIYAVQGINETLFILSKSLDVQTQKLNCTKLFPNGDSYFIIKSGLLLVAILILMFNTKRLSFKINTCKGRPGLAIPMDMLKNNEHIIEYVVGFLSLSEDIYQAIFESKYWTPTMLPIEKFXXXXXXXXXXXXXXXPIFTGIYAKRLTEYAIGFIYAVLLMIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIIDGSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSRKYVTRLLRRNIEKVNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKVCVKLITEKL 1997
            MSSFFQVAIYAVQGINETLFILSKSLDVQTQKLNCTKLFPNGDSYFIIKSGLLLVAILILMFNTKRLSFKINTCKGRPGLAIPMDMLKNNEHIIEYVVGFLSLSEDIYQAIFESKYWTPTMLPIEKFLLKLTIIIYYSILSYPIFTGIYAKRLTEYAIGFIYAVLLMIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIIDGSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSRKYVTRLLRRNIEKVNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLI GTVIGF NSLIQSFLILRNFRLHFQKI+KKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGIIVVIFFMFLFLFFLIGVILLPLIFLENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKS ANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKVCVKLITEKL
Sbjct:    1 MSSFFQVAIYAVQGINETLFILSKSLDVQTQKLNCTKLFPNGDSYFIIKSGLLLVAILILMFNTKRLSFKINTCKGRPGLAIPMDMLKNNEHIIEYVVGFLSLSEDIYQAIFESKYWTPTMLPIEKFLLKLTIIIYYSILSYPIFTGIYAKRLTEYAIGFIYAVLLMIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIIDGSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSRKYVTRLLRRNIEKVNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLIFGTVIGFLNSLIQSFLILRNFRLHFQKISKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGIIVVIFFMFLFLFFLIGVILLPLIFLENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSFANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKVCVKLITEKL 650          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Planmine SMEST
Match: SMESG000031041.1 (SMESG000031041.1)

HSP 1 Score: 813.527 bits (2100), Expect = 0.000e+0
Identity = 444/651 (68.20%), Postives = 521/651 (80.03%), Query Frame = 3
Query:   48 MSSFFQVAIYAVQGINETLFILSKSLDVQTQKLNCTKLFPNGDSYFIIKSGLLLVAILILMFNTKRLSFKINTCKGRPGLAIPMDMLKNNEHIIEYVVGFLSLSEDIYQAIFESKYWTPTMLPIEKFXXXXXXXXXXXXXXXPIFTGIYAKRLTEYAIGFIYAVLLMIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIIDGSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSRKYVTRLL-RRNIEKVNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKVCVKLITEKL 1997
            M+   Q+A YA+ GI ETL I+  S   +T+  NCT    N D+Y I  S LL+++IL+L F TKR+SF ++ C GRPGLAIPMDM+ +N++I EY+V FLSLSE+IYQ I  S  +    L IE+ L K+  +I  S+ SYP+F  +  K L  Y +G  ++V  +++GI +N+S + C  G I+IP+LII+T C IID  +V+IF WKI +HIK NGL N+   +  +  DE SR+YV  LL RR  +K  ++  F  KI C       +QR+Y KI+GF+IPPLL IGISVGLYFAYRIFMDQII LTPQGW +IYLIN+    T+ NMKSAF IVSGNYS+YSE+KIINAF YLT FYTNL LGCLI   +IGF NSLIQSFLILRNFRLHFQKI+KKGFSSIIALRKAPDCAGLVSGLVRYSG+QAAY+LWGI VV  FMFLFLFFLIGVILLPLI+LENSWIRKL LQ LP LI +Y+V+ IQ LL++FVFVKERGSLME+NNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQ+LDSGYMSYIGFLYTLQYHQNPI+KCFTDML+ENHKKKKSIANNSDMSLD+KN +KR YKIKWHVALTLINNCQLQTDRKKVC K+ITE++
Sbjct:    1 MADAVQIANYALLGIGETLKIIINSFGAETKIKNCTNFLQNRDTYEIGSSSLLVLSILVLAFVTKRVSFNVHACGGRPGLAIPMDMISSNDNIYEYIVAFLSLSENIYQFINGSDKFEQFSL-IERLLWKIFFVILSSLFSYPLFASLCCKHLVGYTVGLCHSVAFLVYGIFENFSSVLCARGPILIPQLIIYTNCIIIDLIMVMIFVWKIAKHIKNNGLSNSENPKLNNSFDESSRQYVKELLIRRKCQKEKDKKTFRGKINC-------SQRIYFKISGFKIPPLLVIGISVGLYFAYRIFMDQIIALTPQGWDIIYLINQRFYTTDTNMKSAFEIVSGNYSQYSEIKIINAFRYLTFFYTNLLLGCLIAAIIIGFLNSLIQSFLILRNFRLHFQKISKKGFSSIIALRKAPDCAGLVSGLVRYSGFQAAYILWGITVVTVFMFLFLFFLIGVILLPLIYLENSWIRKLILQLLPFLIATYIVIAIQRLLIKFVFVKERGSLMEINNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQRLDSGYMSYIGFLYTLQYHQNPILKCFTDMLMENHKKKKSIANNSDMSLDYKNASKRNYKIKWHVALTLINNCQLQTDRKKVCFKIITERI 643          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Planmine SMEST
Match: SMESG000041908.1 (SMESG000041908.1)

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 347/500 (69.40%), Postives = 410/500 (82.00%), Query Frame = 3
Query:  474 PIFTGIYAKRLTEYAIGFIYAVLLMIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIIDGSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSRKYVTRLLRRNIEKVNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNI-NMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKV 1970
            PIF  I +K L  Y IG IY+    I+ + D+YS ++C+ GT+IIP+LII+T CTII+ SLV+IF WKI  HI+ NGL+++ +SE    IDE S+++V  LL R     N+  +   K K N+IN EL+QR+Y+K+ G +IPPLL IGISVGLYFAYRIFMDQII LTPQGW +IYLINK  S TN  N+KSAF IVSGNYS+YSE+KIINAF YL  FYTNL LGCLI   +IGF NSLIQSFLILRNFRLHFQKI+KKGFSSIIALRKAP  +GL+SG VRYSGYQAAY+LWGIIVVIFFMFLFLFFLIGVILLPLIFLENSW+RK FL+SLPV++GS ++ V Q+++VR VFVKERG+LMEVNNRR F IYAHCAFFLNVMMGFFNSI+RMI+ + NFVFCFSRIDFN LP+YLQ+LDSGYMSYIGFLYTLQYHQNPIMKCFTD+ +ENH +KK +  N  + LD + E  RKY+IKW +ALTLINN QLQ+DRKK+
Sbjct:    9 PIFVSIGSKHLIGYTIGLIYSFCFFIYDVFDDYSDVNCIEGTVIIPRLIIYTVCTIINLSLVLIFAWKILTHIQANGLKSSRKSESTQTIDEYSKQFVKDLLNRKNPNKNDNGSLSVKKKYNKINTELSQRIYLKMYGLKIPPLLGIGISVGLYFAYRIFMDQIIALTPQGWDIIYLINKKFSTTNTTNIKSAFQIVSGNYSQYSEIKIINAFRYLAFFYTNLLLGCLIAAIIIGFLNSLIQSFLILRNFRLHFQKISKKGFSSIIALRKAPCSSGLISGFVRYSGYQAAYILWGIIVVIFFMFLFLFFLIGVILLPLIFLENSWMRKFFLRSLPVIVGSIIIAVFQTVIVRLVFVKERGNLMEVNNRRVFTIYAHCAFFLNVMMGFFNSIRRMIMSIFNFVFCFSRIDFNTLPIYLQRLDSGYMSYIGFLYTLQYHQNPIMKCFTDIFVENHNRKKDLPVNYTIDLDHRIEVGRKYRIKWQLALTLINNPQLQSDRKKI 508          

HSP 2 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 371/597 (62.14%), Postives = 448/597 (75.04%), Query Frame = 3
Query:  210 VAILILMFNTKRLSFKINTCKGRPGLAIPMDMLKNNEHIIEYVVGFLSLSEDIYQAIFESKYWTPTML-PIEKFXXXXXXXXXXXXXXXPIFTGIYAKRLTEYAIGFIYAVLLMIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIIDGSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSRKYVTRLLRRNIEKVNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKVCVK-LITEK 1994
              ++I  F TKR+SFK+N+C GRPGLA+PMDM+ +NE+   YV+ FLS SEDIY+AIF   Y T  M  PI KFL+KL  +I +S+  YPIF GI AK L  Y +G I+A +L+   +     K+ C++G  I+P  II   C   +  L++IF WKIF+H+KEN L+ + +SE +HCIDE+SR+YV  LL R  +  N      +K+    IN E+T+ VYVKI+GFR+PPLLA+GISVGLYFAYRIFM+ II  TP+ W  IYL+NK  +  N+++KSAF +VSGN S++S  ++  A+ YL  FY NL L   I   ++GF NSLIQSFLILRN+RLHFQKI+KKGFSSIIALRKAP+CAGLVSGLVRYSGYQAAY+LWGIIVVIFFMFLFLF  IGV+LLPLIFLENSW RKLFLQSLPV+  S+V+ + QSLLVRFVFVKERGSLME+NNRRAFMIYAHCAFFLNVM+GFF SIKRMIIWMLNFVFCFSRIDFNALPVYL   DSGYMSYIGFLYTLQYHQNPI+KCF D+L E H   ++  N          E+K +   KW VA TLINN QLQ DRK+   K L+ EK
Sbjct:  833 AGVIIFAFVTKRVSFKVNSCYGRPGLAVPMDMINSNENRYAYVMAFLSFSEDIYRAIFV--YETDNMQEPILKFLIKLGYVIVFSVTYYPIFAGICAKHLIGYCMGLIFAAVLLCCNLELVNEKVKCIIGYDIVPFFIIHIVCLTNNFVLILIFVWKIFKHVKENRLKISTKSELVHCIDENSRQYVKELLNRKNKYENGVKTLRRKLTFREINAEVTEIVYVKISGFRVPPLLAVGISVGLYFAYRIFMELIILFTPETWKFIYLLNKHFAEINLDLKSAFRVVSGNLSQHSATELATAYRYLIFFYVNLLLFSFIAAFIVGFLNSLIQSFLILRNYRLHFQKISKKGFSSIIALRKAPNCAGLVSGLVRYSGYQAAYILWGIIVVIFFMFLFLFISIGVVLLPLIFLENSWTRKLFLQSLPVIGLSFVLFIGQSLLVRFVFVKERGSLMEINNRRAFMIYAHCAFFLNVMIGFFTSIKRMIIWMLNFVFCFSRIDFNALPVYLHSFDSGYMSYIGFLYTLQYHQNPILKCFVDLLEEKHLVNRNPLNEGKEKSQL--ESKSRNLKKWQVAFTLINNLQLQVDRKRRIGKFLMNEK 1425          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Planmine SMEST
Match: SMESG000031048.1 (SMESG000031048.1)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 338/596 (56.71%), Postives = 415/596 (69.63%), Query Frame = 3
Query:  210 VAILILMFNTKRLSFKINTCKGRPGLAIPMDMLKNNEHIIEYVVGFLSLSEDIYQAIFESKYWTPTMLPIEKFXXXXXXXXXXXXXXXPIFTGIYAKRLTEYAIGFIYAVLLMIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIIDGSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSRKYVTRLLRRNIEKVNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKVCVK-LITEK 1994
            + I+I  F TKR+SFK+N+C GRPGLA+PMDM+ +NE+          + + I++ +  +                                G   K      +G I+A +L+   +     K+ C++G  IIP  II   C   +  L++IF  KIF+H+KEN L+ + +SE +HCIDE+SR+YV  LL R  +  N E    +K+    IN E+T+ VYVKI+GFR+PPLLA+GISVGLYFAYRIFM+ II  TP+ W  IYL+NK  +  N+++KS F +VSGN S++S  ++  A+ YL  FY NL L   I   ++GF NSLIQSFLILRN+RLHFQKI+KKGFSSIIALRKAP+CAGL+SGLVRYSGYQAAY+LWGIIVVIFFMFLFLF  IGV+LLPLIFLENSW RKLFLQSLPV+  S+V+ + QSLLVRFVFVKERGSLME+NNRRAFMIYAHCAFFLNVM+GFF SIKRMIIWMLNFVFCFSRIDFNALPVYL   DSGYMSYIGFLYTLQYHQN I+KCF D+L E H   ++  N          E+K +   KW VA TLINN QLQ DRK+   K L+ EK
Sbjct:   53 ILIIIFAFVTKRVSFKVNSCYGRPGLAVPMDMINSNEN---------RICDCIFRNVLSN------------------------------ICGNLRKAFDWLLMGLIFAAVLLCCNLELVNEKVKCIIGYDIIPFFIIHIVCLTNNFVLILIFVRKIFKHVKENRLKISTKSELVHCIDENSRQYVKELLNRKNKDENGEKTLRRKLTFREINAEVTKIVYVKISGFRVPPLLAVGISVGLYFAYRIFMELIILFTPETWKFIYLLNKHFAEINLDLKSGFRVVSGNLSQHSATELATAYRYLIFFYVNLLLFSFIAAFIVGFLNSLIQSFLILRNYRLHFQKISKKGFSSIIALRKAPNCAGLISGLVRYSGYQAAYILWGIIVVIFFMFLFLFISIGVVLLPLIFLENSWTRKLFLQSLPVIGLSFVLFIGQSLLVRFVFVKERGSLMEINNRRAFMIYAHCAFFLNVMIGFFTSIKRMIIWMLNFVFCFSRIDFNALPVYLHSFDSGYMSYIGFLYTLQYHQNLILKCFVDLLEEKHLVNRNPLNEGKEKSQL--ESKSRNLKKWQVAFTLINNLQLQVDRKRRIGKFLMNEK 607          
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Planmine SMEST
Match: SMESG000041900.1 (SMESG000041900.1)

HSP 1 Score: 499.59 bits (1285), Expect = 1.067e-168
Identity = 290/625 (46.40%), Postives = 412/625 (65.92%), Query Frame = 3
Query:  141 KLNCTKLFPNGDSYFIIKSGLLLVAILILMFNT--KRLSFKINTCKGRPGLAIPMDMLKNNEHIIEYVVGFLSLSEDIYQAIFESKYWTPTMLPIEKFXXXXXXXXXXXXXXXPIFTGIYAKRLTEYAIGFIYAVLLMIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIIDGSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDED---SRKYVTRLLRRNIE-----------KVNEETNFF-QKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYRIFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKIINAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITKKGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGXXXXXXXXXXXXXXXXXXXXXXXXXXENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKERGSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRIDFNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSIANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRK 1964
            KLNC++  P    Y     G+  V I I++F+T  KR+S+K + C G+PGL +PM+ML ++ +I+EY + FLSLSE+IY  IF SK     ++P+ KF +KL I+I +SILSYPIF  I ++ L  Y    + AV     G+   Y+   CLVG  I+P L      + ID S+V +F WK   H++ENG +N    EF   +  D   S+ YV +LL+ N+E           +  E+ NF     KC+ +  ++ +R+Y  I GF  PP L IG+ VGLYFAYRIF+D I+ LTP  W +I  IN     T  N+  +F ++  NYS YS+++I N+F YLT  YT+L + CL+    I F NS+IQS L+LRN+RLHF +IT+KGFS+ + +++AP    L+ G VR+SGYQAAY LWGI+VV FFMF+ L+ LIG+ LLPL ++ENSW RKL +   PVL+ + +  +IQ+ +V+++FV E+G+LMEVNNRR+FMIY HCAFFLN MMG FNS+KR+IIW+ +  FCFSRIDF++LP YL   DSGYM+Y+GF+YT QYH NPI++CF+ +L+E  ++K       +++L   ++ + +++  WHVA+TLINN QL  +RK
Sbjct:   51 KLNCSRSSP-ATEYAEYAIGIYYV-ICIIIFSTMVKRVSYKRDHCNGKPGLVLPMNMLNSHNYILEYTLVFLSLSEEIYAYIFGSKVEVSKLIPVVKFFIKLFIVIMFSILSYPIFAAITSRHLFGYVTVMLAAVAYFFVGVSATYTYCFCLVGVKIVPFLFAAVLYSSIDISIVGMFVWKTVCHVRENGFKNR---EFNCKLSRDWKYSKIYVRKLLKENLEIKSLKTENPTEEKEEDLNFIVSHFKCDELKSKMRERIYRPIPGFGFPPRLMIGMLVGLYFAYRIFIDNILGLTPIAWKLIAEINNKYLITQTNISRSFYLIWSNYSLYSKMEIQNSFRYLTFSYTHLLISCLLSAIFIAFINSVIQSLLLLRNYRLHFHRITRKGFSTFMDVKRAPPPYSLILGYVRFSGYQAAYTLWGILVVTFFMFIILYLLIGIFLLPLFYVENSWSRKLLINYGPVLVVTIIFNIIQTTVVKYIFVMEKGTLMEVNNRRSFMIYTHCAFFLNAMMGIFNSVKRVIIWIFSGAFCFSRIDFSSLPEYLHGFDSGYMAYVGFVYTEQYHFNPILQCFSHLLMEMKREKNIYVKEDELNLLNNDKRRMRFRNLWHVAVTLINNPQLFAERK 670          
The following BLAST results are available for this feature:
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STRA67.066e-722.34stimulated by retinoic acid 6 [Source:HGNC Symbol;... [more]
STRA67.066e-722.34stimulated by retinoic acid 6 [Source:HGNC Symbol;... [more]
STRA67.658e-721.93stimulated by retinoic acid 6 [Source:HGNC Symbol;... [more]
STRA67.658e-721.93stimulated by retinoic acid 6 [Source:HGNC Symbol;... [more]
STRA68.102e-722.34stimulated by retinoic acid 6 [Source:HGNC Symbol;... [more]
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stra6l3.236e-1628.47STRA6-like [Source:ZFIN;Acc:ZDB-GENE-070410-116][more]
stra6l3.236e-1628.47STRA6-like [Source:ZFIN;Acc:ZDB-GENE-070410-116][more]
stra67.440e-1422.11stimulated by retinoic acid 6 [Source:NCBI gene;Ac... [more]
stra67.440e-1422.11stimulated by retinoic acid 6 [Source:NCBI gene;Ac... [more]
stra67.440e-1422.11stimulated by retinoic acid 6 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
stra6l.17.861e-1325.00stra6-like, gene 1 [Source:NCBI gene;Acc:100145324... [more]
stra6l.19.754e-1325.00stra6-like, gene 1 [Source:NCBI gene;Acc:100145324... [more]
STRA66.998e-624.32stimulated by retinoic acid 6 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Stra6l1.758e-1627.92STRA6-like [Source:MGI Symbol;Acc:MGI:1921402][more]
Stra6l2.176e-1627.82STRA6-like [Source:MGI Symbol;Acc:MGI:1921402][more]
Stra6l2.176e-1627.82STRA6-like [Source:MGI Symbol;Acc:MGI:1921402][more]
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DBN1|STR6L_MOUSE1.522e-1527.82Stimulated by retinoic acid gene 6 protein-like OS... [more]
sp|F1RAX4|STRA6_DANRE5.617e-1322.11Receptor for retinol uptake stra6 OS=Danio rerio O... [more]
sp|Q0V8E7|STRA6_BOVIN3.238e-1021.45Receptor for retinol uptake STRA6 OS=Bos taurus OX... [more]
sp|Q5R7B4|STRA6_PONAB1.676e-821.08Receptor for retinol uptake STRA6 OS=Pongo abelii ... [more]
sp|Q9BX79|STRA6_HUMAN4.087e-622.34Receptor for retinol uptake STRA6 OS=Homo sapiens ... [more]
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T2M6R03.900e-2624.11Stimulated by retinoic acid gene 6 protein homolog... [more]
A0A1S3K4F12.692e-2523.00stimulated by retinoic acid gene 6 protein-like OS... [more]
R7UPT04.008e-2327.51Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A183A6619.314e-2325.06Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4E0QZH51.098e-2025.15Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stra66.068e-1521.97stimulated by retinoic acid 6 [Source:NCBI gene;Ac... [more]
stra6l2.812e-1326.64STRA6-like [Source:ZFIN;Acc:ZDB-GENE-070410-116][more]
stra6l2.891e-1326.64STRA6-like [Source:ZFIN;Acc:ZDB-GENE-070410-116][more]
stra63.227e-1321.54stimulated by retinoic acid 6 [Source:NCBI gene;Ac... [more]
stra61.750e-1222.05stimulated by retinoic acid 6 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
stra68.171e-1123.45stimulated by retinoic acid 6 [Source:NCBI gene;Ac... [more]
stra6l8.996e-926.87STRA6-like [Source:ZFIN;Acc:ZDB-GENE-070410-116][more]
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO456752.443e-2428.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309502.815e-1426.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466871.023e-633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stra67.410e-1822.95stimulated by retinoic acid 6 [Source:NCBI gene;Ac... [more]
stra6l5.656e-1629.76stimulated by retinoic acid gene 6 protein-like [S... [more]
stra6l6.440e-1629.62stimulated by retinoic acid gene 6 protein-like [S... [more]
stra6l7.433e-1629.93stimulated by retinoic acid gene 6 protein-like [S... [more]
ENSORLT00000034582.16.242e-1227.55stimulated by retinoic acid gene 6 protein-like [S... [more]
back to top
BLAST of Stimulated by retinoic acid gene 6-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031046.10.000e+099.38SMESG000031046.1[more]
SMESG000031041.10.000e+068.20SMESG000031041.1[more]
SMESG000041908.10.000e+069.40SMESG000041908.1[more]
SMESG000031048.10.000e+056.71SMESG000031048.1[more]
SMESG000041900.11.067e-16846.40SMESG000041900.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007314 ID=SMED30007314|Name=Stimulated by retinoic acid gene 6-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2040bp
GCAAAATCTAATAAATTTATATTATAACTCCAATACCTTACATCTCAATG
TCAAGCTTTTTTCAGGTTGCTATATATGCTGTCCAAGGAATTAATGAGAC
TTTGTTTATCCTTTCCAAATCTCTTGACGTCCAGACCCAGAAACTGAATT
GTACAAAATTATTTCCAAATGGTGATTCGTACTTTATAATCAAATCTGGT
TTGTTACTAGTGGCCATTTTGATTTTAATGTTCAATACTAAACGATTATC
CTTCAAGATCAACACGTGCAAGGGTCGGCCTGGATTGGCTATACCGATGG
ATATGCTGAAAAATAACGAACACATTATTGAATATGTTGTAGGGTTTTTG
TCGCTATCTGAAGACATTTACCAAGCAATTTTCGAATCGAAATATTGGAC
TCCAACAATGTTACCTATTGAAAAGTTTTTGTTGAAATTAACCATCATCA
TTTATTACTCTATTTTGTCGTATCCAATATTTACGGGAATTTATGCAAAA
CGCCTCACAGAATACGCAATAGGATTCATTTACGCAGTGCTTTTAATGAT
CTTTGGAATTTTGGATAATTACTCTAAAATAGATTGTTTGGTCGGTACCA
TTATCATCCCGAAATTAATAATATTTACTTTTTGCACAATTATTGATGGG
TCTTTGGTTGTGATCTTTACATGGAAGATATTTGAGCACATCAAAGAAAA
CGGACTGAGAAATAACGGGAGATCTGAATTTATTCATTGCATCGATGAAG
ATAGTAGAAAATATGTTACAAGGCTATTGAGAAGAAATATAGAAAAAGTA
AACGAAGAAACAAACTTCTTTCAAAAAATTAAATGTAATAGAATCAATGA
AGAACTTACACAAAGAGTTTATGTGAAGATAGCTGGATTCAGAATTCCCC
CTTTGCTAGCAATCGGAATCTCCGTTGGATTGTATTTTGCTTATCGAATT
TTCATGGATCAGATCATTGACCTTACTCCACAAGGTTGGACTGTGATTTA
TTTGATAAATAAAGGGATCTCCAATACTAATATAAACATGAAATCTGCGT
TCCTCATCGTTTCAGGAAACTATTCTAAATATTCCGAAGTCAAAATAATA
AATGCTTTTAGTTATTTAACTCTTTTCTATACAAATCTTTTCCTCGGTTG
CTTAATATGCGGCACTGTAATAGGATTTTTCAACTCCTTAATTCAGTCGT
TTTTGATTCTGAGAAACTTTCGGCTACATTTTCAGAAAATCACCAAGAAA
GGGTTTTCATCCATTATTGCACTGAGAAAGGCTCCAGATTGTGCTGGATT
GGTATCTGGTTTAGTGAGGTATAGCGGATATCAGGCTGCCTACTTATTGT
GGGGGATAATTGTTGTCATATTCTTTATGTTTTTATTTTTGTTCTTTTTG
ATTGGGGTCATTTTACTGCCTCTGATATTTTTGGAAAACTCTTGGATAAG
AAAGTTATTTTTACAATCTTTACCCGTATTAATTGGTTCATATGTTGTAG
TTGTCATTCAAAGTCTTTTGGTTAGATTTGTATTTGTGAAAGAAAGAGGA
AGCTTAATGGAAGTAAATAACCGAAGAGCATTTATGATTTATGCACATTG
TGCCTTCTTTCTGAATGTGATGATGGGATTTTTCAATTCAATCAAACGAA
TGATTATTTGGATGCTGAATTTTGTGTTCTGTTTCTCTAGAATCGACTTT
AATGCTTTGCCAGTCTATTTGCAAAAGCTGGACAGCGGGTACATGAGCTA
TATTGGGTTTCTCTATACCCTGCAGTACCATCAGAACCCGATCATGAAAT
GCTTCACTGATATGTTGATAGAAAACCATAAAAAGAAAAAAAGTATCGCT
AATAATTCCGATATGAGTCTTGATTTCAAAAATGAAACCAAGCGAAAATA
TAAGATCAAATGGCATGTAGCGTTGACATTGATCAACAATTGCCAACTGC
AAACTGACAGGAAGAAAGTCTGTGTCAAATTGATAACCGAAAAGTTATAA
TAATCAAATATTTGGTTTTTCTTACTCATATAATTTTTAC
back to top

protein sequence of SMED30007314-orf-1

>SMED30007314-orf-1 ID=SMED30007314-orf-1|Name=SMED30007314-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=651bp
MSSFFQVAIYAVQGINETLFILSKSLDVQTQKLNCTKLFPNGDSYFIIKS
GLLLVAILILMFNTKRLSFKINTCKGRPGLAIPMDMLKNNEHIIEYVVGF
LSLSEDIYQAIFESKYWTPTMLPIEKFLLKLTIIIYYSILSYPIFTGIYA
KRLTEYAIGFIYAVLLMIFGILDNYSKIDCLVGTIIIPKLIIFTFCTIID
GSLVVIFTWKIFEHIKENGLRNNGRSEFIHCIDEDSRKYVTRLLRRNIEK
VNEETNFFQKIKCNRINEELTQRVYVKIAGFRIPPLLAIGISVGLYFAYR
IFMDQIIDLTPQGWTVIYLINKGISNTNINMKSAFLIVSGNYSKYSEVKI
INAFSYLTLFYTNLFLGCLICGTVIGFFNSLIQSFLILRNFRLHFQKITK
KGFSSIIALRKAPDCAGLVSGLVRYSGYQAAYLLWGIIVVIFFMFLFLFF
LIGVILLPLIFLENSWIRKLFLQSLPVLIGSYVVVVIQSLLVRFVFVKER
GSLMEVNNRRAFMIYAHCAFFLNVMMGFFNSIKRMIIWMLNFVFCFSRID
FNALPVYLQKLDSGYMSYIGFLYTLQYHQNPIMKCFTDMLIENHKKKKSI
ANNSDMSLDFKNETKRKYKIKWHVALTLINNCQLQTDRKKVCVKLITEKL
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0034632retinol transporter activity
GO:0038023signaling receptor activity
Vocabulary: biological process
TermDefinition
GO:0034633retinol transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000421tail
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF14752RBP_receptorcoord: 49..640
e-value: 2.2E-65
score: 221.4
NoneNo IPR availablePANTHERPTHR21444:SF15coord: 113..641
NoneNo IPR availablePANTHERPTHR21444FAMILY NOT NAMEDcoord: 113..641
NoneNo IPR availableTMHMMTMhelixcoord: 190..212
NoneNo IPR availableTMHMMTMhelixcoord: 93..112
NoneNo IPR availableTMHMMTMhelixcoord: 127..149
NoneNo IPR availableTMHMMTMhelixcoord: 433..455
NoneNo IPR availableTMHMMTMhelixcoord: 510..532
NoneNo IPR availableTMHMMTMhelixcoord: 281..303
NoneNo IPR availableTMHMMTMhelixcoord: 156..175
NoneNo IPR availableTMHMMTMhelixcoord: 360..382
NoneNo IPR availableTMHMMTMhelixcoord: 45..62
NoneNo IPR availableTMHMMTMhelixcoord: 475..497