Histone deacetylase complex subunit SAP18

Overview
NameHistone deacetylase complex subunit SAP18
Smed IDSMED30007299
Length (bp)558
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone deacetylase complex subunit SAP18 (SMED30007299) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone deacetylase complex subunit SAP18 (SMED30007299) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone deacetylase complex subunit SAP18 (SMED30007299) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone deacetylase complex subunit SAP18 (SMED30007299) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007299

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30007299SMESG000042219.1 dd_Smed_v4_3735_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007299SMESG000042219.1 dd_Smed_v4_3735_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007299SMESG000042219.1 dd_Smed_v4_3735_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007299SMESG000042219.1 dd_Smed_v4_3735_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Human
Match: SAP18 (Sin3A associated protein 18 [Source:HGNC Symbol;Acc:HGNC:10530])

HSP 1 Score: 140.584 bits (353), Expect = 4.570e-42
Identity = 67/122 (54.92%), Postives = 91/122 (74.59%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F+F IV+ D+K   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   40 DREKTCPLLLRVFTTNNGRHHRMDEFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 159          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Human
Match: SAP18 (Sin3A associated protein 18 [Source:HGNC Symbol;Acc:HGNC:10530])

HSP 1 Score: 140.584 bits (353), Expect = 4.570e-42
Identity = 67/122 (54.92%), Postives = 91/122 (74.59%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F+F IV+ D+K   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   40 DREKTCPLLLRVFTTNNGRHHRMDEFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 159          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Human
Match: SAP18 (Sin3A associated protein 18 [Source:HGNC Symbol;Acc:HGNC:10530])

HSP 1 Score: 139.813 bits (351), Expect = 5.489e-42
Identity = 67/122 (54.92%), Postives = 91/122 (74.59%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F+F IV+ D+K   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   21 DREKTCPLLLRVFTTNNGRHHRMDEFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 140          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Human
Match: SAP18 (Sin3A associated protein 18 [Source:HGNC Symbol;Acc:HGNC:10530])

HSP 1 Score: 132.88 bits (333), Expect = 1.577e-39
Identity = 64/119 (53.78%), Postives = 88/119 (73.95%), Query Frame = 1
Query:   73 KTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +TCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F+F IV+ D+K   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   21 QTCPLLLRVFTTNNGRHHRMDEFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 137          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Human
Match: SAP18 (Sin3A associated protein 18 [Source:HGNC Symbol;Acc:HGNC:10530])

HSP 1 Score: 94.3597 bits (233), Expect = 3.031e-25
Identity = 46/80 (57.50%), Postives = 60/80 (75.00%), Query Frame = 1
Query:   76 TCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYR 312
            TCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F+F IV+ D+K   YR
Sbjct:    1 TCPLLLRVFTTNNGRHHRMDEFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYR 78          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Celegans
Match: C16C10.4 (Probable histone deacetylase complex subunit SAP18 [Source:UniProtKB/Swiss-Prot;Acc:Q09250])

HSP 1 Score: 117.857 bits (294), Expect = 9.508e-34
Identity = 59/130 (45.38%), Postives = 86/130 (66.15%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFIN---GSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNY 444
            +REK CP+LLR+F +N +H+   ++ +   GS P   SELQ++TWMD +L ELT+LI+EVNPD R +GT FDF IV  D  S RY ++ +G   +G    D++ TL+   F++GD++DVAI  P  G  +
Sbjct:   19 DREKVCPMLLRVFVANNRHNPMSEYNSRNGGSVP--PSELQMHTWMDCSLRELTSLIKEVNPDARRKGTTFDFAIVQADRGSPRYILRDVGNTTNGERGIDDNKTLQQCKFEVGDFVDVAISLPSQGRRF 146          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Celegans
Match: C16C10.4 (Probable histone deacetylase complex subunit SAP18 [Source:UniProtKB/Swiss-Prot;Acc:Q09250])

HSP 1 Score: 117.857 bits (294), Expect = 9.508e-34
Identity = 59/130 (45.38%), Postives = 86/130 (66.15%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFIN---GSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNY 444
            +REK CP+LLR+F +N +H+   ++ +   GS P   SELQ++TWMD +L ELT+LI+EVNPD R +GT FDF IV  D  S RY ++ +G   +G    D++ TL+   F++GD++DVAI  P  G  +
Sbjct:   19 DREKVCPMLLRVFVANNRHNPMSEYNSRNGGSVP--PSELQMHTWMDCSLRELTSLIKEVNPDARRKGTTFDFAIVQADRGSPRYILRDVGNTTNGERGIDDNKTLQQCKFEVGDFVDVAISLPSQGRRF 146          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Celegans
Match: C16C10.4 (Probable histone deacetylase complex subunit SAP18 [Source:UniProtKB/Swiss-Prot;Acc:Q09250])

HSP 1 Score: 117.857 bits (294), Expect = 9.508e-34
Identity = 59/130 (45.38%), Postives = 86/130 (66.15%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFIN---GSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNY 444
            +REK CP+LLR+F +N +H+   ++ +   GS P   SELQ++TWMD +L ELT+LI+EVNPD R +GT FDF IV  D  S RY ++ +G   +G    D++ TL+   F++GD++DVAI  P  G  +
Sbjct:   19 DREKVCPMLLRVFVANNRHNPMSEYNSRNGGSVP--PSELQMHTWMDCSLRELTSLIKEVNPDARRKGTTFDFAIVQADRGSPRYILRDVGNTTNGERGIDDNKTLQQCKFEVGDFVDVAISLPSQGRRF 146          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Fly
Match: Bin1 (gene:FBgn0024491 transcript:FBtr0347200)

HSP 1 Score: 137.117 bits (344), Expect = 2.094e-41
Identity = 63/134 (47.01%), Postives = 92/134 (68.66%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNYLADLANR 465
            +REKTCP+LLR+FCS G+HH   +++ G+ PT+  ELQIYTW DA L ELT+L+++VNPD R +GT FDF +VYP+ +S+ ++M+ +G   +G    D++ TL    F IGD++D++I  P    N L   A R
Sbjct:   19 DREKTCPMLLRVFCSTGRHHSVSEYMFGNVPTN--ELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPP----NRLPPTARR 146          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Fly
Match: Bin1 (gene:FBgn0024491 transcript:FBtr0347201)

HSP 1 Score: 137.117 bits (344), Expect = 2.094e-41
Identity = 63/134 (47.01%), Postives = 92/134 (68.66%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNYLADLANR 465
            +REKTCP+LLR+FCS G+HH   +++ G+ PT+  ELQIYTW DA L ELT+L+++VNPD R +GT FDF +VYP+ +S+ ++M+ +G   +G    D++ TL    F IGD++D++I  P    N L   A R
Sbjct:   19 DREKTCPMLLRVFCSTGRHHSVSEYMFGNVPTN--ELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPP----NRLPPTARR 146          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Fly
Match: Bin1 (gene:FBgn0024491 transcript:FBtr0083279)

HSP 1 Score: 137.117 bits (344), Expect = 2.094e-41
Identity = 63/134 (47.01%), Postives = 92/134 (68.66%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNYLADLANR 465
            +REKTCP+LLR+FCS G+HH   +++ G+ PT+  ELQIYTW DA L ELT+L+++VNPD R +GT FDF +VYP+ +S+ ++M+ +G   +G    D++ TL    F IGD++D++I  P    N L   A R
Sbjct:   19 DREKTCPMLLRVFCSTGRHHSVSEYMFGNVPTN--ELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPP----NRLPPTARR 146          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Zebrafish
Match: sap18 (Sin3A-associated protein [Source:ZFIN;Acc:ZDB-GENE-040426-1679])

HSP 1 Score: 143.665 bits (361), Expect = 9.625e-44
Identity = 70/122 (57.38%), Postives = 89/122 (72.95%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F F IVYPD K   YR+K +G  VSG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   21 DREKTCPLLLRVFTTNNGRHHRMDEFARGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFGFAIVYPDPKRQIYRVKEIGNTVSGRKGADDSMTLQSQSFQIGDYLDIAITPP 140          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Zebrafish
Match: sap18 (Sin3A-associated protein [Source:ZFIN;Acc:ZDB-GENE-040426-1679])

HSP 1 Score: 143.665 bits (361), Expect = 9.625e-44
Identity = 70/122 (57.38%), Postives = 89/122 (72.95%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F F IVYPD K   YR+K +G  VSG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   21 DREKTCPLLLRVFTTNNGRHHRMDEFARGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFGFAIVYPDPKRQIYRVKEIGNTVSGRKGADDSMTLQSQSFQIGDYLDIAITPP 140          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Xenopus
Match: xrcc6 (X-ray repair complementing defective repair in Chinese hamster cells 6 [Source:Xenbase;Acc:XB-GENE-970899])

HSP 1 Score: 146.362 bits (368), Expect = 1.146e-44
Identity = 70/122 (57.38%), Postives = 91/122 (74.59%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV PD R +GT F+F IVYPD K   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   21 DREKTCPLLLRVFTTNNGRHHRMDEFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPDARKKGTHFNFAIVYPDPKRSGYRVKEIGSTISGRKGSDDSMTLQSQRFQIGDYLDIAITPP 140          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Mouse
Match: Sap18 (Sin3-associated polypeptide 18 [Source:MGI Symbol;Acc:MGI:1277978])

HSP 1 Score: 140.969 bits (354), Expect = 1.783e-42
Identity = 68/122 (55.74%), Postives = 91/122 (74.59%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F+F IV+ DLK   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   40 DREKTCPLLLRVFTTNNGRHHRMDEFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 159          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Mouse
Match: Sap18b (Sin3-associated polypeptide 18B [Source:MGI Symbol;Acc:MGI:3704317])

HSP 1 Score: 140.969 bits (354), Expect = 1.783e-42
Identity = 68/122 (55.74%), Postives = 91/122 (74.59%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F+F IV+ DLK   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   40 DREKTCPLLLRVFTTNNGRHHRMDEFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 159          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Mouse
Match: Sap18 (Sin3-associated polypeptide 18 [Source:MGI Symbol;Acc:MGI:1277978])

HSP 1 Score: 110.923 bits (276), Expect = 2.022e-31
Identity = 53/98 (54.08%), Postives = 72/98 (73.47%), Query Frame = 1
Query:  133 DFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F+F IV+ DLK   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:    3 EFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 98          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Mouse
Match: Sap18 (Sin3-associated polypeptide 18 [Source:MGI Symbol;Acc:MGI:1277978])

HSP 1 Score: 88.9669 bits (219), Expect = 3.874e-23
Identity = 41/79 (51.90%), Postives = 58/79 (73.42%), Query Frame = 1
Query:  190 MDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            MDA L+ELT+L++EV P+ R +GT F+F IV+ DLK   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:    1 MDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 79          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Mouse
Match: Sap18 (Sin3-associated polypeptide 18 [Source:MGI Symbol;Acc:MGI:1277978])

HSP 1 Score: 88.9669 bits (219), Expect = 3.874e-23
Identity = 41/79 (51.90%), Postives = 58/79 (73.42%), Query Frame = 1
Query:  190 MDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            MDA L+ELT+L++EV P+ R +GT F+F IV+ DLK   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:    1 MDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 79          
BLAST of Histone deacetylase complex subunit SAP18 vs. UniProt/SwissProt
Match: sp|Q3T022|SAP18_BOVIN (Histone deacetylase complex subunit SAP18 OS=Bos taurus OX=9913 GN=SAP18 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 7.461e-42
Identity = 68/122 (55.74%), Postives = 91/122 (74.59%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F+F IV+ DLK   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   21 DREKTCPLLLRVFTTNNGRHHRMDEFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 140          
BLAST of Histone deacetylase complex subunit SAP18 vs. UniProt/SwissProt
Match: sp|O55128|SAP18_MOUSE (Histone deacetylase complex subunit SAP18 OS=Mus musculus OX=10090 GN=Sap18 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.343e-41
Identity = 68/122 (55.74%), Postives = 91/122 (74.59%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F+F IV+ DLK   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   21 DREKTCPLLLRVFTTNNGRHHRMDEFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 140          
BLAST of Histone deacetylase complex subunit SAP18 vs. UniProt/SwissProt
Match: sp|Q5RDT5|SAP18_PONAB (Histone deacetylase complex subunit SAP18 OS=Pongo abelii OX=9601 GN=SAP18 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.636e-41
Identity = 67/122 (54.92%), Postives = 91/122 (74.59%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F+F IV+ D+K   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   21 DREKTCPLLLRVFTTNNGRHHRMDEFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 140          
BLAST of Histone deacetylase complex subunit SAP18 vs. UniProt/SwissProt
Match: sp|O00422|SAP18_HUMAN (Histone deacetylase complex subunit SAP18 OS=Homo sapiens OX=9606 GN=SAP18 PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.636e-41
Identity = 67/122 (54.92%), Postives = 91/122 (74.59%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F+F IV+ D+K   YR+K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   21 DREKTCPLLLRVFTTNNGRHHRMDEFSRGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP 140          
BLAST of Histone deacetylase complex subunit SAP18 vs. UniProt/SwissProt
Match: sp|Q9VEX9|SAP18_DROME (Histone deacetylase complex subunit SAP18 OS=Drosophila melanogaster OX=7227 GN=Bin1 PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.099e-40
Identity = 63/134 (47.01%), Postives = 92/134 (68.66%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNYLADLANR 465
            +REKTCP+LLR+FCS G+HH   +++ G+ PT+  ELQIYTW DA L ELT+L+++VNPD R +GT FDF +VYP+ +S+ ++M+ +G   +G    D++ TL    F IGD++D++I  P    N L   A R
Sbjct:   19 DREKTCPMLLRVFCSTGRHHSVSEYMFGNVPTN--ELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPP----NRLPPTARR 146          
BLAST of Histone deacetylase complex subunit SAP18 vs. TrEMBL
Match: A0A0B7BRP6 (Histone deacetylase complex subunit SAP18 OS=Arion vulgaris OX=1028688 GN=ORF207577 PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 7.073e-46
Identity = 73/124 (58.87%), Postives = 92/124 (74.19%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGG 435
            +REKTCPLLLR+FCSN +HH   +F  GSTPT+  ELQIYTWMDA L+ELT L++EVNPD R +GT FDF IVYPD +S  +RM+ +GT  +G  + D++ TL  K F IGDY+D+AI  P  G
Sbjct:   21 DREKTCPLLLRVFCSNDRHHALMEFSRGSTPTN--ELQIYTWMDATLKELTGLVKEVNPDARRKGTFFDFAIVYPDSRSPTFRMREIGTTCAGRKSPDDTVTLAQKKFTIGDYLDIAICPPRAG 142          
BLAST of Histone deacetylase complex subunit SAP18 vs. TrEMBL
Match: A0A2C9JZ69 (Histone deacetylase complex subunit SAP18 OS=Biomphalaria glabrata OX=6526 GN=106073811 PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.078e-45
Identity = 72/124 (58.06%), Postives = 93/124 (75.00%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGG 435
            +REKTCPLLLR+FCSN +HH   +F  GSTPT+  ELQIYTWMDA L+ELT+L++EVNPD R +GT FDF IV+PD +S  +RM+ +GT  +G  + D++ TL  K F IGDY+D+AI  P  G
Sbjct:   20 DREKTCPLLLRVFCSNERHHALMEFSRGSTPTN--ELQIYTWMDATLKELTSLVKEVNPDARRKGTFFDFAIVFPDSRSPTFRMREIGTTCAGRKSPDDTVTLAQKKFSIGDYLDIAICAPRAG 141          
BLAST of Histone deacetylase complex subunit SAP18 vs. TrEMBL
Match: A0A433T2C5 (Histone deacetylase complex subunit SAP18 OS=Elysia chlorotica OX=188477 GN=EGW08_016548 PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.348e-45
Identity = 71/118 (60.17%), Postives = 93/118 (78.81%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAI 417
            +REKTCPLLLR+FCSN +HH   +F+ GSTPT+  ELQIYTWMDA L+ELT+L++EVNPD R +GT FDF IVYPD++S  +RM+ +GT  +G  + D++ TL  K F IGDY+D+AI
Sbjct:   19 DREKTCPLLLRVFCSNDRHHALMEFVRGSTPTN--ELQIYTWMDATLKELTSLVKEVNPDARRKGTFFDFAIVYPDVRSPTFRMREIGTTCAGRKSPDDAVTLASKKFTIGDYLDIAI 134          
BLAST of Histone deacetylase complex subunit SAP18 vs. TrEMBL
Match: V4A2F2 (Histone deacetylase complex subunit SAP18 OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_183100 PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 6.982e-45
Identity = 70/126 (55.56%), Postives = 94/126 (74.60%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSN 441
            +REKTCPLLLR+FCS G+HH   +F   +TP  ++ELQIYTWMDA L+ELT+L++EVNPD R +GT FDF IVYPD ++  YR++ +GT   G  + D++ TL  K FQIGDY+D++I  P GG +
Sbjct:   20 DREKTCPLLLRVFCSLGRHHQTMEFARANTP--ANELQIYTWMDATLKELTSLVKEVNPDARKKGTFFDFAIVYPDPRTPTYRLREIGTTCCGKKSTDDNVTLASKKFQIGDYLDISISPPRGGPS 143          
BLAST of Histone deacetylase complex subunit SAP18 vs. TrEMBL
Match: A0A210Q1W2 (Histone deacetylase complex subunit SAP18 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07224 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 8.567e-44
Identity = 68/118 (57.63%), Postives = 91/118 (77.12%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAI 417
            +REKTCPLLLR+FCS G+H+   +F  G TP  S+ELQIYTWMDA L+ELT+L++EVNPD R +GT FDF +VYPD ++  YRM+ +GT  +G    D+S++L  K FQIGDY+D+A+
Sbjct:   20 DREKTCPLLLRVFCSTGRHNTLSEFARGQTP--SNELQIYTWMDATLKELTSLVKEVNPDARRKGTFFDFAVVYPDPRTPVYRMREIGTTCAGHRGQDDSHSLTSKRFQIGDYLDIAV 135          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Cavefish
Match: sap18 (Sin3A associated protein 18 [Source:NCBI gene;Acc:103025825])

HSP 1 Score: 143.665 bits (361), Expect = 7.725e-44
Identity = 70/122 (57.38%), Postives = 89/122 (72.95%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F F IVYPD K   YR+K +G  VSG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   21 DREKTCPLLLRVFTTNNGRHHRMDEFARGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFGFAIVYPDPKRPGYRVKEIGNTVSGRKGADDSMTLQSQRFQIGDYLDIAITPP 140          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Sea Lamprey
Match: sap18 (Sin3A-associated protein [Source:ZFIN;Acc:ZDB-GENE-040426-1679])

HSP 1 Score: 132.494 bits (332), Expect = 2.383e-40
Identity = 62/117 (52.99%), Postives = 84/117 (71.79%), Query Frame = 1
Query:   70 EKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAI 417
             +TCPLLLR+F S  G HH   +F  GS PTS  ELQIYTW+DA L+ELT+L++EVNP+ R +GT F F IVYPD K   YR++ +G+ ++G    D+  TL+ + FQIGD++D+AI
Sbjct:    5 RQTCPLLLRVFTSKTGHHHRTDEFARGSAPTS--ELQIYTWLDATLKELTSLVKEVNPEARRKGTHFSFAIVYPDPKRPVYRVREIGSTIAGRKGADDIMTLQSQKFQIGDFLDIAI 119          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Nematostella
Match: EDO43580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY60])

HSP 1 Score: 134.42 bits (337), Expect = 9.542e-41
Identity = 62/118 (52.54%), Postives = 82/118 (69.49%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAI 417
            NR++TCPLLLR+FC+ G+HH   ++   S PT+  ELQ+YTW DA L+EL +L++EVNPD R +GT F F  V+PD +   Y MK +G   +G    D+  TL+ K FQIGDYIDVAI
Sbjct:   18 NRQRTCPLLLRVFCNQGRHHRVDEYSRNSLPTN--ELQVYTWKDATLKELMSLVKEVNPDARRKGTGFSFATVFPDQRRGGYIMKEIGVTTAGRKGPDDGVTLESKKFQIGDYIDVAI 133          
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Medaka
Match: sap18 (Sin3A associated protein 18 [Source:NCBI gene;Acc:101165955])

HSP 1 Score: 144.05 bits (362), Expect = 5.599e-44
Identity = 67/122 (54.92%), Postives = 90/122 (73.77%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSN-GKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEP 426
            +REKTCPLLLR+F +N G+HH   +F  G+ P  SSELQIYTWMDA L+ELT+L++EV P+ R +GT F F IV+PDL+   Y+ K +G+ +SG    D+S TL+ + FQIGDY+D+AI  P
Sbjct:   21 DREKTCPLLLRVFTTNSGRHHRVDEFARGNVP--SSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFSFAIVFPDLRGKMYKFKEIGSTISGRKGPDDSMTLQSQRFQIGDYLDIAITPP 140          
BLAST of Histone deacetylase complex subunit SAP18 vs. Planmine SMEST
Match: SMESG000042219.1 (SMESG000042219.1)

HSP 1 Score: 305.064 bits (780), Expect = 1.302e-107
Identity = 144/144 (100.00%), Postives = 144/144 (100.00%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNYLADLANRTGIRPNKTRR 495
            NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNYLADLANRTGIRPNKTRR
Sbjct:   13 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNYLADLANRTGIRPNKTRR 156          
BLAST of Histone deacetylase complex subunit SAP18 vs. Planmine SMEST
Match: SMESG000042219.1 (SMESG000042219.1)

HSP 1 Score: 280.411 bits (716), Expect = 3.415e-98
Identity = 133/133 (100.00%), Postives = 133/133 (100.00%), Query Frame = 1
Query:   97 MFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNYLADLANRTGIRPNKTRR 495
            MFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNYLADLANRTGIRPNKTRR
Sbjct:    1 MFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNYLADLANRTGIRPNKTRR 133          
BLAST of Histone deacetylase complex subunit SAP18 vs. Planmine SMEST
Match: SMESG000051680.1 (SMESG000051680.1)

HSP 1 Score: 75.485 bits (184), Expect = 3.053e-17
Identity = 48/137 (35.04%), Postives = 71/137 (51.82%), Query Frame = 1
Query:   64 NREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQIYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMGTVVSGVMN----------DDNSYTLKDKHFQIGDYIDVAII-EPVGGSN 441
            +R  TCP+L+  F S     +P      S      +++I TW+DA+L EL++ I++   + R  G    F IVYP+  S  YR + +G V+ G             DD+  TL  K FQIGD+++V+II EP  G N
Sbjct:   38 DRRLTCPILINCFISMSGRWNPLTAYKRSR-NELHKIEINTWIDASLRELSSEIRDTCIEARKPGLTLCFAIVYPEKHSSDYRRREIGKVIVGRNKRNIDGSFRSPDDSFVTLSSKKFQIGDFVEVSIIEEPRQGIN 173          
The following BLAST results are available for this feature:
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SAP184.570e-4254.92Sin3A associated protein 18 [Source:HGNC Symbol;Ac... [more]
SAP184.570e-4254.92Sin3A associated protein 18 [Source:HGNC Symbol;Ac... [more]
SAP185.489e-4254.92Sin3A associated protein 18 [Source:HGNC Symbol;Ac... [more]
SAP181.577e-3953.78Sin3A associated protein 18 [Source:HGNC Symbol;Ac... [more]
SAP183.031e-2557.50Sin3A associated protein 18 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C16C10.49.508e-3445.38Probable histone deacetylase complex subunit SAP18... [more]
C16C10.49.508e-3445.38Probable histone deacetylase complex subunit SAP18... [more]
C16C10.49.508e-3445.38Probable histone deacetylase complex subunit SAP18... [more]
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Bin12.094e-4147.01gene:FBgn0024491 transcript:FBtr0347200[more]
Bin12.094e-4147.01gene:FBgn0024491 transcript:FBtr0347201[more]
Bin12.094e-4147.01gene:FBgn0024491 transcript:FBtr0083279[more]
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sap189.625e-4457.38Sin3A-associated protein [Source:ZFIN;Acc:ZDB-GENE... [more]
sap189.625e-4457.38Sin3A-associated protein [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
xrcc61.146e-4457.38X-ray repair complementing defective repair in Chi... [more]
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sap181.783e-4255.74Sin3-associated polypeptide 18 [Source:MGI Symbol;... [more]
Sap18b1.783e-4255.74Sin3-associated polypeptide 18B [Source:MGI Symbol... [more]
Sap182.022e-3154.08Sin3-associated polypeptide 18 [Source:MGI Symbol;... [more]
Sap183.874e-2351.90Sin3-associated polypeptide 18 [Source:MGI Symbol;... [more]
Sap183.874e-2351.90Sin3-associated polypeptide 18 [Source:MGI Symbol;... [more]
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3T022|SAP18_BOVIN7.461e-4255.74Histone deacetylase complex subunit SAP18 OS=Bos t... [more]
sp|O55128|SAP18_MOUSE1.343e-4155.74Histone deacetylase complex subunit SAP18 OS=Mus m... [more]
sp|Q5RDT5|SAP18_PONAB2.636e-4154.92Histone deacetylase complex subunit SAP18 OS=Pongo... [more]
sp|O00422|SAP18_HUMAN2.636e-4154.92Histone deacetylase complex subunit SAP18 OS=Homo ... [more]
sp|Q9VEX9|SAP18_DROME2.099e-4047.01Histone deacetylase complex subunit SAP18 OS=Droso... [more]
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7BRP67.073e-4658.87Histone deacetylase complex subunit SAP18 OS=Arion... [more]
A0A2C9JZ691.078e-4558.06Histone deacetylase complex subunit SAP18 OS=Biomp... [more]
A0A433T2C51.348e-4560.17Histone deacetylase complex subunit SAP18 OS=Elysi... [more]
V4A2F26.982e-4555.56Histone deacetylase complex subunit SAP18 OS=Lotti... [more]
A0A210Q1W28.567e-4457.63Histone deacetylase complex subunit SAP18 OS=Mizuh... [more]
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sap187.725e-4457.38Sin3A associated protein 18 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sap182.383e-4052.99Sin3A-associated protein [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO435809.542e-4152.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sap185.599e-4454.92Sin3A associated protein 18 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Histone deacetylase complex subunit SAP18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000042219.11.302e-107100.00SMESG000042219.1[more]
SMESG000042219.13.415e-98100.00SMESG000042219.1[more]
SMESG000051680.13.053e-1735.04SMESG000051680.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007299 ID=SMED30007299|Name=Histone deacetylase complex subunit SAP18|organism=Schmidtea mediterranea sexual|type=transcript|length=558bp
TCTATATAAATCTTATATGACAAACTAATGAGTGATAAGAAGTCGGTAAA
AAAAGTTTCAGTAAATCGCGAAAAAACTTGTCCTCTTTTACTTCGTATGT
TTTGTAGCAATGGAAAGCATCACGATCCTCATGATTTTATTAATGGTTCC
ACACCTACTTCTTCATCAGAACTTCAAATCTATACATGGATGGATGCAAA
TCTTGAGGAACTCACTAATTTGATTCAAGAGGTCAATCCTGATTGTCGTA
CACGTGGTACTGTTTTTGATTTTCGTATCGTTTATCCAGATTTAAAATCT
GATCGCTACCGAATGAAAGTAATGGGGACTGTTGTTTCAGGCGTTATGAA
TGATGACAATTCTTATACGTTAAAAGACAAACATTTTCAAATTGGAGATT
ATATTGATGTTGCGATCATAGAACCAGTTGGCGGTTCAAATTATTTAGCA
GATTTGGCAAATAGAACTGGTATACGTCCTAATAAAACTAGGCGGTGATT
AATCTTATGCAAATAATAATTTACCCTGTTAATAAATATTTTTTACATTG
AAAAAAAA
back to top

protein sequence of SMED30007299-orf-1

>SMED30007299-orf-1 ID=SMED30007299-orf-1|Name=SMED30007299-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp
MSDKKSVKKVSVNREKTCPLLLRMFCSNGKHHDPHDFINGSTPTSSSELQ
IYTWMDANLEELTNLIQEVNPDCRTRGTVFDFRIVYPDLKSDRYRMKVMG
TVVSGVMNDDNSYTLKDKHFQIGDYIDVAIIEPVGGSNYLADLANRTGIR
PNKTRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005829cytosol
GO:0016604nuclear body
GO:0035145exon-exon junction complex
GO:0005634nucleus
GO:0005737cytoplasm
GO:0016607nuclear speck
GO:0061574ASAP complex
Vocabulary: INTERPRO
TermDefinition
IPR010516SAP18
Vocabulary: biological process
TermDefinition
GO:0000381regulation of alternative mRNA splicing, via spliceosome
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006397mRNA processing
GO:0008380RNA splicing
GO:0043065positive regulation of apoptotic process
GO:0048025negative regulation of mRNA splicing, via spliceosome