Otopetrin

Overview
NameOtopetrin
Smed IDSMED30007292
Length (bp)1999
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Otopetrin (SMED30007292) t-SNE clustered cells

Violin plots show distribution of expression levels for Otopetrin (SMED30007292) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Otopetrin (SMED30007292) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Otopetrin (SMED30007292) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007292

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30007292SMESG000018670.1 Contig3509newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007292SMESG000018670.1 Contig3509uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007292SMESG000020475.1 Contig3509newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30007292SMESG000020475.1 Contig3509uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30007292SMESG000018670.1 dd_Smed_v4_13612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007292SMESG000018670.1 dd_Smed_v4_13612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007292SMESG000018672.1 OX_Smed_1.0.11107ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
glial cellSMED30007292SMESG000018672.1 SMESG000018670.1 dd_Smed_v6_13612_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007292SMESG000018670.1 dd_Smed_v4_13612_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30007292SMESG000018670.1 dd_Smed_v4_13612_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Otopetrin vs. Ensembl Human
Match: OTOP1 (otopetrin 1 [Source:HGNC Symbol;Acc:HGNC:19656])

HSP 1 Score: 50.8322 bits (120), Expect = 8.326e-6
Identity = 41/189 (21.69%), Postives = 83/189 (43.92%), Query Frame = 1
Query:  805 HLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDFHNKTVCADE---------------LSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMV 1326
            H  +  +Q +F++ + + I    K + RF + H   +N+  W   V+ E  H+L EH  + I    F N T   D+               +SH +  YL+P  IEY ++++ + Y +++ +G             ++S +H     +      G  +GL    AT+  +  +L+    +KT++ + ++
Sbjct:  173 HSVHTLLQVYFLWGHAKDIIQSFKTLERFGVIHSVFTNLLLWANGVLNESKHQLNEHKERLITLG-FGNITTVLDDHTPQCNCTPPTLCTAISHGIY-YLYPFNIEYQILASTMLYVLWKNIGR-----------KVDSHQHQKMQFKSDGVMVGAVLGLTVLAATIAVVVVYLIHIGRSKTKSESALI 348          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-8 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:G5EDX5])

HSP 1 Score: 120.939 bits (302), Expect = 2.025e-28
Identity = 122/452 (26.99%), Postives = 216/452 (47.79%), Query Frame = 1
Query:  670 NLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVV----------------------------YEINHELIEHNIKFIDKSDFHNKTV-------CADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYS-ECHRSHKGLFIGLLFFMATLVGLATFLMFK--RNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTY---NLFLFIS---TIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRAD---EHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
             LYLRLGA+ FG   +V  G ++   + ++N  C  ++   K  + + + FIQ  FIF   +      + ++ F + HL   N+  WF+ V+                             E  HELI   +     +    KT+        A E    VA +L  C +EYSLI AA+ + +++ +G  N+Q++       NS K  +K   +C  S  GLF G++F + +LV +  + +F+  RN+    L   V+ + ++ L + ++ + I+   +MR L +R     E  D+ L+++ L G   Y    + +FI+   + D TV      ++L   +F+ +    +IQ ++Q  F+L +SR R +++     KPG+ ++TFL+++N+ L+    FE  ++         TQY        I + + PL++F+RFHSS CL  IW+ +Y
Sbjct:  158 TLYLRLGALFFGSVGIVLFGLELF--LCIENVAC-KKVAIAKMIVAIVFTFIQMHFIFCNSKITVNSSRKIVAFGMMHLISVNLWTWFRFVLAKQEAKAHKKAQLKQTFRKYYSSSSSSSSEEIHELISAVLNSTLNNTPATKTMEPVASRLFALEHFGDVATFLTTCIVEYSLIGAAIMFILWKSIGQNNHQQS-------NSGKRKVKMRIDCSSSSTGLFAGIIFLIGSLVSMGMYTIFESLRNSSGAQL---VFGIVDLSLFSIALGACIIGLWRMRHLQYRLHAHGEVIDEILLIIGLIGEILYCAVGIDVFITCRRSADLTV------SALPAFVFVIR----MIQVVVQAAFILTTSRLRCLSKYSMKYKPGKEIITFLLVSNVTLFVFHTFEGMKSSFGFSSKAATQY------NYIIYAVGPLLVFYRFHSSACLAEIWKHTY 580          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-3 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL0])

HSP 1 Score: 109.383 bits (272), Expect = 7.880e-25
Identity = 118/439 (26.88%), Postives = 203/439 (46.24%), Query Frame = 1
Query:  646 VIKETNGINLYLRLGAVGFGF-GVMVHDG-FKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVY-------EINHELIEHNIKFIDKSDFHNKTV----CADELS--HSVAPYLFPCAIEYSLISAA---VFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGF------RQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKR--AINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            V+  T+  +LYLRLG V FG  GV+ +   F +       N    + +      +   +IF+Q +F++   + IF     + RF L HLT +N+  W + ++Y       EI H  ++H    + K+  H+  V    C   L   +    +++ C +EYSLI A    VF+   +++     +K +K        K +I   +C R+ +GLF G    + T++ +A   +F   +  + +A  ++  + +     S   ++ AF +MR L F       +    E  D  L++V L G   +++   +S I+      N    L L +F    L  +IQ   Q   ++ +SR R    NQ     KPG+ V+T L++ N A + +++FEA++A  +      Y    W I+     PL IF+RFHSS C   IW+K++
Sbjct:  134 VLANTSTGSLYLRLGCVVFGIIGVVYYLLIFVICLLGWSSNEGECSVISDVLNVMAAVFIFVQMWFVYCNGKIIFTGDGNLARFGLMHLTGTNLWMWLRYILYEEVETVKEIRH--VQH--ANLSKASAHHHEVHEEACKGVLCIFNGYNEFMYTCVVEYSLICAGVAFVFWANLERLKREQMEKKMK--------KRSILKIDCSRTAEGLFAGFACIIVTIIAIA---LFNAYSSDKNVAQWIFSCTNMSFFLVSTFLVVFAFWRMRYLKFLMEDDDEEDDNAELLDRILLVVGLIGELIFSIGGILSFIN------NMTIGLPLIIFTTNVL-RLIQVTFQSCLLMVASRLRIEESNQHMLRYKPGKQVITMLLMMNCAQFMMNVFEAQKAGINDEMIHMYGSYYWAIVVRGCSPLTIFYRFHSSACFAEIWKKTF 550          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-3 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL0])

HSP 1 Score: 109.383 bits (272), Expect = 7.880e-25
Identity = 118/439 (26.88%), Postives = 203/439 (46.24%), Query Frame = 1
Query:  646 VIKETNGINLYLRLGAVGFGF-GVMVHDG-FKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVY-------EINHELIEHNIKFIDKSDFHNKTV----CADELS--HSVAPYLFPCAIEYSLISAA---VFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGF------RQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKR--AINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            V+  T+  +LYLRLG V FG  GV+ +   F +       N    + +      +   +IF+Q +F++   + IF     + RF L HLT +N+  W + ++Y       EI H  ++H    + K+  H+  V    C   L   +    +++ C +EYSLI A    VF+   +++     +K +K        K +I   +C R+ +GLF G    + T++ +A   +F   +  + +A  ++  + +     S   ++ AF +MR L F       +    E  D  L++V L G   +++   +S I+      N    L L +F    L  +IQ   Q   ++ +SR R    NQ     KPG+ V+T L++ N A + +++FEA++A  +      Y    W I+     PL IF+RFHSS C   IW+K++
Sbjct:  134 VLANTSTGSLYLRLGCVVFGIIGVVYYLLIFVICLLGWSSNEGECSVISDVLNVMAAVFIFVQMWFVYCNGKIIFTGDGNLARFGLMHLTGTNLWMWLRYILYEEVETVKEIRH--VQH--ANLSKASAHHHEVHEEACKGVLCIFNGYNEFMYTCVVEYSLICAGVAFVFWANLERLKREQMEKKMK--------KRSILKIDCSRTAEGLFAGFACIIVTIIAIA---LFNAYSSDKNVAQWIFSCTNMSFFLVSTFLVVFAFWRMRYLKFLMEDDDEEDDNAELLDRILLVVGLIGELIFSIGGILSFIN------NMTIGLPLIIFTTNVL-RLIQVTFQSCLLMVASRLRIEESNQHMLRYKPGKQVITMLLMMNCAQFMMNVFEAQKAGINDEMIHMYGSYYWAIVVRGCSPLTIFYRFHSSACFAEIWKKTF 550          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-1 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O45067])

HSP 1 Score: 109.768 bits (273), Expect = 9.365e-25
Identity = 117/449 (26.06%), Postives = 196/449 (43.65%), Query Frame = 1
Query:  670 NLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYE-----------INHELIEHNI---------------------------KFIDKSDFHNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGF------RQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            +L+LRLG+V FG   +V+  F V       N    + L T      + +IFIQ  FIF   +        V R    HL  +N+  W + V+ E            NH    HN                            +  +K          + +  S++  +F   +EYSLI+AAV Y +++ +G    Q    ++      KH I+  +C ++  GLF+GL F   T   +  +  F   NK+Q+ A  VY  +++     S I ++ A  QMR L +       Q +++E  D  L+ + L G   Y+    ++ +      K   N   + LF+   +  +IQ   Q F +L  +R   +  +    +PG+  +TFL+  NLA++ +++FE+++A    +  +YY K  W  +  +  PL IF+RFHSS+C   IW+  Y
Sbjct:  181 SLFLRLGSVVFGVTGVVYYAFLVFLCELDPNC---SALSTSLDVCAILFIFIQMHFIFCNWKLSITGSHMVARVGTMHLVAANLWTWIRYVLMEEGVMEKEIREVFNHRPPGHNYMRSNSSDSSSSAENSMEQFLGDGSHEDEHFEKKIMPGSCQAVECILGSMSEIMFTSIVEYSLIAAAVMYIVWRNIG---RQDQGSTYVK---RKHQIRV-DCSKTTTGLFLGLAFLAVTFTSMVVYYGFTMMNKSQS-AAFVYAFTDMFQYVLSTIGVLTAIYQMRALKYFNKKTKLQNSDQELLDQILLSIGLVGELIYS----VAGLVGLTGEKQWTNFSFILLFV--HIFRLIQVGTQTF-LLHVARSVRMGCEHREAQPGKQAITFLLTANLAIFFMNLFESEKAGVSEMIIEYYGKRSWVFLVRSFSPLTIFYRFHSSVCFAEIWKNVY 611          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-1 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O45067])

HSP 1 Score: 108.997 bits (271), Expect = 1.491e-24
Identity = 119/449 (26.50%), Postives = 199/449 (44.32%), Query Frame = 1
Query:  670 NLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYE-----------INHELIEHNI-----------------KFIDKSD-----FHNKTV-----CADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGF------RQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            +L+LRLG+V FG   +V+  F V       N    + L T      + +IFIQ  FIF   +        V R    HL  +N+  W + V+ E            NH    HN                  +F+         F  K +       + +  S++  +F   +EYSLI+AAV Y +++ +G    Q    ++      KH I+  +C ++  GLF+GL F   T   +  +  F   NK+Q+ A  VY  +++     S I ++ A  QMR L +       Q +++E  D  L+ + L G   Y+    ++ +      K   N   + LF+   +  +IQ   Q F +L  +R   +  +    +PG+  +TFL+  NLA++ +++FE+++A    +  +YY K  W  +  +  PL IF+RFHSS+C   IW+  Y
Sbjct:  165 SLFLRLGSVVFGVTGVVYYAFLVFLCELDPNC---SALSTSLDVCAILFIFIQMHFIFCNWKLSITGSHMVARVGTMHLVAANLWTWIRYVLMEEGVMEKEIREVFNHRPPGHNYMRSNSSDSSSSAENSMEQFLGDGSHEDEHFEKKIMPGSCQAVECILGSMSEIMFTSIVEYSLIAAAVMYIVWRNIG---RQDQGSTYVK---RKHQIRV-DCSKTTTGLFLGLAFLAVTFTSMVVYYGFTMMNKSQS-AAFVYAFTDMFQYVLSTIGVLTAIYQMRALKYFNKKTKLQNSDQELLDQILLSIGLVGELIYS----VAGLVGLTGEKQWTNFSFILLFV--HIFRLIQVGTQTF-LLHVARSVRMGCEHREAQPGKQAITFLLTANLAIFFMNLFESEKAGVSEMIIEYYGKRSWVFLVRSFSPLTIFYRFHSSVCFAEIWKNVY 595          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0331167)

HSP 1 Score: 196.052 bits (497), Expect = 3.466e-52
Identity = 140/446 (31.39%), Postives = 226/446 (50.67%), Query Frame = 1
Query:  676 YLRLGAVGFGFGVMVHDGFKVADQVRL-QNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFL-KHKAVIRFILYHLTISNICQWFKTVVYEINHEL------------IEHNIKFIDKSDF---HNKTV----------------CA-----DELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKS-FCSLNSEKHTIKYS-ECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKL---GFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            YLR+GAV FG G M++ G +      L  ++ CHN L        +A+IFIQ +FIF  +  I + ++K + RF L H+  +N+  W   ++ E  HE+            I H I    +      H+ T                 C        L    +P+LFPC IEYSLI AA+ Y M++ +         +    S   ++    YS +C R+HKGLF+G+L  + T++ L  F +     +   +A+    + E+++  ++ I+ +V  IQ+R L    +R  +     DD L++ +  G F YN+F  I+    T+R  +        L    +L  I+Q+  Q  F+L++SR++A++ +   +KPGR +VTF+++ NLA+W IS  E  RA+ H I   +Y    WTIITH  +PL IF+RFHS++CL  IW+++Y
Sbjct: 1015 YLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAYRSFS----LDDILLVGAQTGSFLYNIFTVIAG-HFTLRSDD-------MLVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAY 1448          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0346834)

HSP 1 Score: 195.667 bits (496), Expect = 3.756e-52
Identity = 140/448 (31.25%), Postives = 227/448 (50.67%), Query Frame = 1
Query:  670 NLYLRLGAVGFGFGVMVHDGFKVADQVRL-QNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFL-KHKAVIRFILYHLTISNICQWFKTVVYEINHEL------------IEHNIKFIDKSDF---HNKTV----------------CA-----DELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKS-FCSLNSEKHTIKYS-ECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKL---GFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            + YLR+GAV FG G M++ G +      L  ++ CHN L        +A+IFIQ +FIF  +  I + ++K + RF L H+  +N+  W   ++ E  HE+            I H I    +      H+ T                 C        L    +P+LFPC IEYSLI AA+ Y M++ +         +    S   ++    YS +C R+HKGLF+G+L  + T++ L  F +     +   +A+    + E+++  ++ I+ +V  IQ+R L    +R  +     DD L++ +  G F YN+F  I+    T+R  +        L    +L  I+Q+  Q  F+L++SR++A++ +   +KPGR +VTF+++ NLA+W IS  E  RA+ H I   +Y    WTIITH  +PL IF+RFHS++CL  IW+++Y
Sbjct: 1013 SFYLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAYRSFS----LDDILLVGAQTGSFLYNIFTVIAG-HFTLRSDD-------MLVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAY 1448          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0331168)

HSP 1 Score: 195.667 bits (496), Expect = 3.870e-52
Identity = 140/446 (31.39%), Postives = 226/446 (50.67%), Query Frame = 1
Query:  676 YLRLGAVGFGFGVMVHDGFKVADQVRL-QNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFL-KHKAVIRFILYHLTISNICQWFKTVVYEINHEL------------IEHNIKFIDKSDF---HNKTV----------------CA-----DELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKS-FCSLNSEKHTIKYS-ECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKL---GFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            YLR+GAV FG G M++ G +      L  ++ CHN L        +A+IFIQ +FIF  +  I + ++K + RF L H+  +N+  W   ++ E  HE+            I H I    +      H+ T                 C        L    +P+LFPC IEYSLI AA+ Y M++ +         +    S   ++    YS +C R+HKGLF+G+L  + T++ L  F +     +   +A+    + E+++  ++ I+ +V  IQ+R L    +R  +     DD L++ +  G F YN+F  I+    T+R  +        L    +L  I+Q+  Q  F+L++SR++A++ +   +KPGR +VTF+++ NLA+W IS  E  RA+ H I   +Y    WTIITH  +PL IF+RFHS++CL  IW+++Y
Sbjct: 1015 YLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAYRSFS----LDDILLVGAQTGSFLYNIFTVIAG-HFTLRSDD-------MLVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAY 1448          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLb (gene:FBgn0031514 transcript:FBtr0077608)

HSP 1 Score: 142.895 bits (359), Expect = 2.057e-35
Identity = 124/481 (25.78%), Postives = 213/481 (44.28%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQN-SFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAI-FLKHKAVIRFILYHLTISNICQWFKTVVYEINH--------------ELIEHNIKFIDKSDFH--------------------------------------------NKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKV-GLANYQKNLKSFCSLNSEKHTIKYS-ECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEE----TFDDNLILVSLAGVFTYNLF-LFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRA---DEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            K T+  + YLR+GA+ F  G MV+ G +      L     C +          +     Q  FIF     +   +HK   RF L H+  +N+C+W   +V E  H              +L+ HN   + ++D+                                             ++T     L   ++P+LFPC IEYSLI A + ++M++ V  + +  K  K+     + K    +S +C +SHKGLF G+L  + T++ +  + +       + +A     + E  +      ++I   I MR L + + T +E      D+ L++V+  GV+ Y +F +  S       + +R   +   +F       ++Q+ +Q  F+L SS +R     Q   KPGR ++TFL++ N+A+W ++     RA   + HL   +++    WTIITH  +PL IF+RFHS+ICL  +W+ +Y
Sbjct:  154 KVTHFGSFYLRVGAIAFAIGTMVYSGLEFGQFFELNGHPGCRDVFVAITPICRMVLCIAQVQFIFLNTTYMDMARHKVTSRFGLMHMVATNLCEWLYVLVEETKHEIFHISQHEVDPAHDLVIHNSS-MSRTDWAAVNESLHQHHHHHALNNTLVANVSSVIVNMTITPSPTPAAFSGCSRTTIMGALVQQLSPFLFPCTIEYSLICAVILFEMWKTVKSIPDIDKTRKNSVKPAAAKPAHHFSVDCSQSHKGLFFGILIIVMTIISMIMYFVLYTQPGYELVATQEVTLWETFMYFMCAAAVITGMILMRDLRYIKNTSDEHHSMDLDNLLLIVAQTGVYLYGMFSILGSYFAKWDTVPDRVEGIIAEVF------GVVQTSLQTMFILHSSHRRCRGTNQVRRKPGREIITFLLVANIAIWFVNTLIKGRAVFRESHL---EFFGVWGWTIITHISMPLAIFYRFHSTICLFEVWKITY 624          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLb (gene:FBgn0031514 transcript:FBtr0344796)

HSP 1 Score: 142.51 bits (358), Expect = 3.061e-35
Identity = 124/481 (25.78%), Postives = 213/481 (44.28%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQN-SFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAI-FLKHKAVIRFILYHLTISNICQWFKTVVYEINH--------------ELIEHNIKFIDKSDFH--------------------------------------------NKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKV-GLANYQKNLKSFCSLNSEKHTIKYS-ECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEE----TFDDNLILVSLAGVFTYNLF-LFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRA---DEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            K T+  + YLR+GA+ F  G MV+ G +      L     C +          +     Q  FIF     +   +HK   RF L H+  +N+C+W   +V E  H              +L+ HN   + ++D+                                             ++T     L   ++P+LFPC IEYSLI A + ++M++ V  + +  K  K+     + K    +S +C +SHKGLF G+L  + T++ +  + +       + +A     + E  +      ++I   I MR L + + T +E      D+ L++V+  GV+ Y +F +  S       + +R   +   +F       ++Q+ +Q  F+L SS +R     Q   KPGR ++TFL++ N+A+W ++     RA   + HL   +++    WTIITH  +PL IF+RFHS+ICL  +W+ +Y
Sbjct:  172 KVTHFGSFYLRVGAIAFAIGTMVYSGLEFGQFFELNGHPGCRDVFVAITPICRMVLCIAQVQFIFLNTTYMDMARHKVTSRFGLMHMVATNLCEWLYVLVEETKHEIFHISQHEVDPAHDLVIHN-SSMSRTDWAAVNESLHQHHHHHALNNTLVANVSSVIVNMTITPSPTPAAFSGCSRTTIMGALVQQLSPFLFPCTIEYSLICAVILFEMWKTVKSIPDIDKTRKNSVKPAAAKPAHHFSVDCSQSHKGLFFGILIIVMTIISMIMYFVLYTQPGYELVATQEVTLWETFMYFMCAAAVITGMILMRDLRYIKNTSDEHHSMDLDNLLLIVAQTGVYLYGMFSILGSYFAKWDTVPDRVEGIIAEVF------GVVQTSLQTMFILHSSHRRCRGTNQVRRKPGREIITFLLVANIAIWFVNTLIKGRAVFRESHL---EFFGVWGWTIITHISMPLAIFYRFHSTICLFEVWKITY 642          
BLAST of Otopetrin vs. Ensembl Zebrafish
Match: otop2 (otopetrin 2 [Source:ZFIN;Acc:ZDB-GENE-050104-2])

HSP 1 Score: 56.9954 bits (136), Expect = 6.174e-8
Identity = 107/479 (22.34%), Postives = 186/479 (38.83%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIE-------HNIKFIDKSDFHNKTVCADELSHSVAP-------YLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHK----------GLFIGLLFFMATLVGLATFLMF-----KRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEE---ETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTL-------------FLCKSL-------TEIIQSLIQVFFVLESSRKR---AINQKQALEKP-----GR---------SVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHS-----SICLTA 1866
            K+++   ++LR G V FG   ++ D FK+   V   N  C + +      +   ++ +QT+ ++ + +      + + R  L     +N+  W   V  E  H+ +        +NI     S     + C  E  H++         YL+P  IEYSL ++A+ Y M++ VG                     +  + H SHK          G   GL+  +A   GLATF+++     K + K +  A++++ +  IV +     S +   I  R     Q++ +    + D  L++ +  G F    F  ++ + S V  +   N L L               FL K L       TE+      V  V E   +R   +I     L  P     GR          +  FL++ N+ LW I  F A+   ++ +    Y+   W  + +  +P  IF+R HS      +CL A
Sbjct:  106 KDSHAGPVWLRTGLVLFGICSVIMDIFKIIFYVGRMN--CESPVKIAFPVVQAVFVIVQTYVLWIHAKDCVQIKQNITRCGLMLTLSTNLMVWMMAVTEESLHQTVAPVKPPTNNNIGSAVASQQGGPSEC--ECLHNMCDLFEKAYYYLYPFNIEYSLFASAMTYVMWKNVG---------------------RKMDDHHSHKLHFSLWDVLVGPLAGLIVLVA---GLATFVVYEVDVSKDDPKKKEEALIMHYIMNIVAVLLMSSSALAGCILFRMDKREQVSGKNPTRSLDVGLLVGASLGQFLICYFTIVAVLASGV--QGHTNGLNLACAMLTVIELCIQNAFLIKGLHREPFKETEVATVFANVMAVKERDPERRSSSIVPAHTLPIPLTLLQGRMSWKRRVLKEICAFLLLCNVTLWIIPAFGARPQFDNTVGPDVYEFQTWAAVVNIGMPFGIFYRMHSVASLFEVCLAA 554          
BLAST of Otopetrin vs. Ensembl Zebrafish
Match: otop2 (otopetrin 2 [Source:ZFIN;Acc:ZDB-GENE-050104-2])

HSP 1 Score: 56.6102 bits (135), Expect = 7.864e-8
Identity = 106/478 (22.18%), Postives = 188/478 (39.33%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDFHNKTVCAD------ELSHSVAP-------YLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHK----------GLFIGLLFFMATLVGLATFLMF-----KRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEE---ETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTL-------------FLCKSL-------TEIIQSLIQVFFVLESSRKR---AINQKQALEKP-----GR---------SVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHS-----SICLTA 1866
            K+++   ++LR G V FG   ++ D FK+   V   N  C + +      +   ++ +QT+ ++ + +      + + R  L     +N+  W   V  E  H+ +   +K    ++ +N T+         E  H++         YL+P  IEYSL ++A+ Y M++ VG                     +  + H SHK          G   GL+  +A   GLATF+++     K + K +  A++++ +  IV +     S +   I  R     Q++ +    + D  L++ +  G F    F  ++ + S V  +   N L L               FL K L       TE+      V  V E   +R   +I     L  P     GR          +  FL++ N+ LW I  F A+   ++ +    Y+   W  + +  +P  IF+R HS      +CL A
Sbjct:  106 KDSHAGPVWLRTGLVLFGICSVIMDIFKIIFYVGRMN--CESPVKIAFPVVQAVFVIVQTYVLWIHAKDCVQIKQNITRCGLMLTLSTNLMVWMMAVTEESLHQTVA-PVKPPTNNNSYNDTLDGRAAASECECLHNMCDLFEKAYYYLYPFNIEYSLFASAMTYVMWKNVG---------------------RKMDDHHSHKLHFSLWDVLVGPLAGLIVLVA---GLATFVVYEVDVSKDDPKKKEEALIMHYIMNIVAVLLMSSSALAGCILFRMDKREQVSGKNPTRSLDVGLLVGASLGQFLICYFTIVAVLASGV--QGHTNGLNLACAMLTVIELCIQNAFLIKGLHREPFKETEVATVFANVMAVKERDPERRSSSIVPAHTLPIPLTLLQGRMSWKRRVLKEICAFLLLCNVTLWIIPAFGARPQFDNTVGPDVYEFQTWAAVVNIGMPFGIFYRMHSVASLFEVCLAA 554          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: crp.1 (C-reactive protein, pentraxin-related, gene 1 [Source:Xenbase;Acc:XB-GENE-1018603])

HSP 1 Score: 57.7658 bits (138), Expect = 5.208e-8
Identity = 54/252 (21.43%), Postives = 103/252 (40.87%), Query Frame = 1
Query:  613 LFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKS------DFHNK------TVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSH-------KGLFIGLLFFMATLVGLATFLMFKRNNKTQT 1311
            +F SQ      + K+T+    +LR G   F    ++ D FK+   +         +   P    H  +  +Q +F++ + + I    K + RF L H   +N+  W   ++ E  HEL EH  + I         D H        +VC+   S  +  YL+P  IEY ++++ + Y +++ +G                   T+K+ +  + H        G  +GL+    T+  L  +L+    +K+++
Sbjct:   97 IFRSQSIRRSIIEKDTDAGARWLRCGITLFAVITLILDSFKIGYYIGYSECLSITEGIFPVT--HTIHTLLQVYFLWFHAKDIIQSFKTLERFGLIHAVFTNLLLWANGILTESKHELNEHKERLITLGFSNITMDHHTPECNCTSSVCSI-FSQGIY-YLYPFTIEYHILASTMLYVLWKNIG------------------RTVKHHQQQKIHFKFHGITIGTILGLIVLTTTVAVLVVYLIQIGRSKSKS 326          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: crp.1 (C-reactive protein, pentraxin-related, gene 1 [Source:Xenbase;Acc:XB-GENE-1018603])

HSP 1 Score: 57.7658 bits (138), Expect = 5.362e-8
Identity = 56/259 (21.62%), Postives = 105/259 (40.54%), Query Frame = 1
Query:  613 LFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKS------DFHNK------TVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSH-------KGLFIGLLFFMATLVGLATFLM-FKRNNKTQTLAIMVY 1329
            +F SQ      + K+T+    +LR G   F    ++ D FK+   +         +   P    H  +  +Q +F++ + + I    K + RF L H   +N+  W   ++ E  HEL EH  + I         D H        +VC+   S  +  YL+P  IEY ++++ + Y +++ +G                   T+K+ +  + H        G  +GL+    T+  L  +L+   R+     LA+ ++
Sbjct:  109 IFRSQSIRRSIIEKDTDAGARWLRCGITLFAVITLILDSFKIGYYIGYSECLSITEGIFPVT--HTIHTLLQVYFLWFHAKDIIQSFKTLERFGLIHAVFTNLLLWANGILTESKHELNEHKERLITLGFSNITMDHHTPECNCTSSVCSI-FSQGIY-YLYPFTIEYHILASTMLYVLWKNIG------------------RTVKHHQQQKIHFKFHGITIGTILGLIVLTTTVAVLVVYLIQIGRSKSKSELALNMF 345          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: slc46a2 (solute carrier family 46 member 2 [Source:Xenbase;Acc:XB-GENE-988711])

HSP 1 Score: 55.4546 bits (132), Expect = 2.791e-7
Identity = 48/181 (26.52%), Postives = 84/181 (46.41%), Query Frame = 1
Query:  637 NYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHEL--IEHNIKFIDKSDF-----------HNKTV-CADELSHSVAP---YLFPCAIEYSLISAAVFYKMFQKVG 1128
            N  + K+++   ++LR G V FG   +V D FK+   +   +  C + +      +  A+I +QT+F++   +     H  + R+ L  + I+N+  W   V  E  H+   +E + K +  S             H  T  C++ L H       YL+P  IEYSL ++A+ Y M++ VG
Sbjct:  189 NAVLYKDSHAGPVWLRGGLVFFGICSLVMDVFKIGYYISYID--CESPIKLIHPMVQSAFIIMQTYFLWVSSKHCVQIHTNISRYGLMLILITNLSIWMAAVTDESVHQTRDLEDDHKIVHSSPAGSHDHKEVGGAHEHTCQCSNHLCHIFQTGYYYLYPFNIEYSLFASAMTYVMWKNVG 367          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: ENSXETT00000044547.1 (otopetrin 2 [Source:NCBI gene;Acc:100496174])

HSP 1 Score: 50.447 bits (119), Expect = 8.882e-6
Identity = 58/245 (23.67%), Postives = 103/245 (42.04%), Query Frame = 1
Query:  613 LFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYE---INHELIEHNIKFIDKSDFHNKTVCADELSHSVAP-----------YLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHK----GLFIGLLFFMATLV-GLATFLMFK 1290
            L+TS+   + Y +K+++   ++LR G V FG   +V D  K+   V L +  C + +      +   ++ IQT+F++   +     H  + R  L     +N+  W   V  E   + HEL   ++ +   +    +    +      A            YL+P  IEYSL ++A+ Y M++ VG             ++   H       H  HK     LF+GL+  +   V GL  F+++K
Sbjct:  115 LWTSK---HKYNLKDSHAGPIWLRGGLVLFGVCTLVLDVMKIGKSVTLIH--CESPVKIVHPVIQGVFVVIQTYFLWVSCKDCAQIHMNLTRCGLMITLSTNLAVWMAAVTDESLHLTHEL-NMDVNYTVSATVGPRAAGGESHGCECATHVCKTFQNGYYYLYPFNIEYSLFASAMSYVMWKNVGRV-----------MSGHHH-------HTQHKFKTRNLFVGLICGIGVFVAGLGVFIVYK 335          
BLAST of Otopetrin vs. Ensembl Mouse
Match: Otop1 (otopetrin 1 [Source:MGI Symbol;Acc:MGI:2388363])

HSP 1 Score: 55.0694 bits (131), Expect = 2.233e-7
Identity = 54/243 (22.22%), Postives = 103/243 (42.39%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDFHNKTVCADE---------------LSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMF--KRNNKTQTLAIMVY 1329
            K+T+    +LR     F F  +V    KVA  +         +   P    H  +  +Q +F++ + + I +  K + RF + H   +N+  W  +V+ E  H+L EH  + I    F N T+  D+               LSH +  YL+P  IEY ++++ + Y +++ +G             ++S +H            G  +GL    AT+  +  +++   +  +K+++  IM Y
Sbjct:  119 KDTHAGARWLRGSITLFAFITVVLGCLKVAYFIGFSECLSATEGVFPVT--HAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLNEHKERLITLG-FGNITIVLDDHTPQCNCTPPALCSALSHGIY-YLYPFNIEYQILASTMLYVLWKNIGR-----------RVDSSQHQKMQCRFDGVLVGSVLGLTVLAATIAVVVVYMIHIGRSKSKSESALIMFY 346          
BLAST of Otopetrin vs. Ensembl Mouse
Match: Otop1 (otopetrin 1 [Source:MGI Symbol;Acc:MGI:2388363])

HSP 1 Score: 55.0694 bits (131), Expect = 2.595e-7
Identity = 43/192 (22.40%), Postives = 86/192 (44.79%), Query Frame = 1
Query:  805 HLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDFHNKTVCADE---------------LSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMF--KRNNKTQTLAIMVY 1329
            H  +  +Q +F++ + + I +  K + RF + H   +N+  W  +V+ E  H+L EH  + I    F N T+  D+               LSH +  YL+P  IEY ++++ + Y +++ +G             ++S +H            G  +GL    AT+  +  +++   +  +K+++  IM Y
Sbjct:  171 HAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLNEHKERLITLG-FGNITIVLDDHTPQCNCTPPALCSALSHGIY-YLYPFNIEYQILASTMLYVLWKNIGR-----------RVDSSQHQKMQCRFDGVLVGSVLGLTVLAATIAVVVVYMIHIGRSKSKSESALIMFY 349          
BLAST of Otopetrin vs. UniProt/SwissProt
Match: sp|B7Z0W9|OTOP_DROME (Proton channel OtopLc OS=Drosophila melanogaster OX=7227 GN=OtopLc PE=3 SV=2)

HSP 1 Score: 196.052 bits (497), Expect = 3.474e-51
Identity = 140/446 (31.39%), Postives = 226/446 (50.67%), Query Frame = 1
Query:  676 YLRLGAVGFGFGVMVHDGFKVADQVRL-QNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFL-KHKAVIRFILYHLTISNICQWFKTVVYEINHEL------------IEHNIKFIDKSDF---HNKTV----------------CA-----DELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKS-FCSLNSEKHTIKYS-ECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKL---GFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            YLR+GAV FG G M++ G +      L  ++ CHN L        +A+IFIQ +FIF  +  I + ++K + RF L H+  +N+  W   ++ E  HE+            I H I    +      H+ T                 C        L    +P+LFPC IEYSLI AA+ Y M++ +         +    S   ++    YS +C R+HKGLF+G+L  + T++ L  F +     +   +A+    + E+++  ++ I+ +V  IQ+R L    +R  +     DD L++ +  G F YN+F  I+    T+R  +        L    +L  I+Q+  Q  F+L++SR++A++ +   +KPGR +VTF+++ NLA+W IS  E  RA+ H I   +Y    WTIITH  +PL IF+RFHS++CL  IW+++Y
Sbjct: 1015 YLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAYRSFS----LDDILLVGAQTGSFLYNIFTVIAG-HFTLRSDD-------MLVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAY 1448          
BLAST of Otopetrin vs. UniProt/SwissProt
Match: sp|Q7M734|OTOP1_RAT (Proton channel OTOP1 OS=Rattus norvegicus OX=10116 GN=Otop1 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 7.469e-7
Identity = 54/243 (22.22%), Postives = 103/243 (42.39%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDFHNKTVCADE---------------LSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMF--KRNNKTQTLAIMVY 1329
            K+T+    +LR     F F  +V    KVA  +         +   P    H  +  +Q +F++ + + I +  K + RF + H   +N+  W  +V+ E  H+L EH  + I    F N T+  D+               LSH +  YL+P  IEY ++++ + Y +++ +G             ++S +H            G  +GL    AT+  +  +++   +  +K+++  IM Y
Sbjct:  122 KDTHAGARWLRGSITLFAFITIVLGCLKVAYFIGFSECLSATEGVFPVT--HAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLNEHKERLITLG-FGNITIVLDDHTPQCNCTPPALCSALSHGIY-YLYPFNIEYQILASTMLYVLWKNIGR-----------RVDSSRHQKMQCRFDGVLVGSVLGLTVLAATIAVVVVYMIHIGRSKSKSESALIMFY 349          
BLAST of Otopetrin vs. UniProt/SwissProt
Match: sp|Q80VM9|OTOP1_MOUSE (Proton channel OTOP1 OS=Mus musculus OX=10090 GN=Otop1 PE=1 SV=3)

HSP 1 Score: 55.0694 bits (131), Expect = 1.815e-6
Identity = 43/192 (22.40%), Postives = 86/192 (44.79%), Query Frame = 1
Query:  805 HLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDFHNKTVCADE---------------LSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMF--KRNNKTQTLAIMVY 1329
            H  +  +Q +F++ + + I +  K + RF + H   +N+  W  +V+ E  H+L EH  + I    F N T+  D+               LSH +  YL+P  IEY ++++ + Y +++ +G             ++S +H            G  +GL    AT+  +  +++   +  +K+++  IM Y
Sbjct:  171 HAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLNEHKERLITLG-FGNITIVLDDHTPQCNCTPPALCSALSHGIY-YLYPFNIEYQILASTMLYVLWKNIGR-----------RVDSSQHQKMQCRFDGVLVGSVLGLTVLAATIAVVVVYMIHIGRSKSKSESALIMFY 349          
BLAST of Otopetrin vs. TrEMBL
Match: A0A504YZQ1 (Otopetrin (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_06924 PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 1.730e-101
Identity = 201/469 (42.86%), Postives = 279/469 (59.49%), Query Frame = 1
Query:  643 YVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQ---NSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDF-------------HNKT-------VCADE---------LSHSV----------------------APYLFPCAIEYSLISAAVFYKMFQKVG-LANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            Y+ +++ G+NLYLRLGAVGFGFGVM+ DGFK+A+           CH+ LW P   LH  Y+F QT+F+FK+H+ +F   K  +RF+L HL ++N+CQW KT+V EI++E    +   ++ SD              H+ T       V +DE         L+H+V                      AP+LFPCAIEYSLI+ A+FYKMFQKVG +    + L      N+   T +++ECHRSHKGLFIGLL FMATLV +  F +F      +  AI +YQ +E+VLLA S+ + +   IQ R L   +L+EE  FDDNL+LV L G+  Y+LFL +  I++          +   LF  K+L EI+QS++QVFF+LE+SR+ A +      KPGR+++TFL+I NLA+W ++ FE KRAD   I   YY    W IITH  LP+I+FFRFHS++CL+ IW  +Y
Sbjct:  302 YLSRDSEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEADITGAGPCHSTLWIPIHVLHFVYVFWQTYFLFKHHQVVFNVQKFALRFLLCHLAVANLCQWLKTIVDEISNEPAHESPTHVNTSDTREDRVDLLWEAFSHSITRRDGSLNVSSDEIYGTYSTERLNHTVPHTVGVEISSHFGSCRSTAKYLAPFLFPCAIEYSLIAGAIFYKMFQKVGHVREESERLARMRKANT--MTRRFAECHRSHKGLFIGLLLFMATLVTMCLFFIFFTKENKKNTAITLYQSTELVLLALSLFTCVAIMIQFRVLKLSELSEEGAFDDNLLLVGLIGMIFYDLFLLVPAIEAI-----NTGMIVARLFAAKALLEIVQSMLQVFFILEASRRCAGSLAHVRNKPGRTLITFLLILNLAMWFVNTFEVKRADNQSIHIDYYTGMAWKIITHIALPMIVFFRFHSTVCLSDIWANAY 763          
BLAST of Otopetrin vs. TrEMBL
Match: A0A4E0RHX6 (Otopetrin OS=Fasciola hepatica OX=6192 GN=D915_000863 PE=4 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 6.055e-101
Identity = 197/469 (42.00%), Postives = 275/469 (58.64%), Query Frame = 1
Query:  643 YVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQ---NSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDFHN-----------------------------KTVCADELSHSV----------------------APYLFPCAIEYSLISAAVFYKMFQKVG-LANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            Y+ +++ G+NLYLRLGAVGFGFGVM+ DGFK+A+           CH+ LW P   LH  Y+F QT+F+FK+H+ +F   K  +RF+L HL ++N+CQW KT+V EI++E    +   ++ SD                                +T   + L+H+V                      AP+LFPCAIEYSLI+ A+FYKMFQKVG +    + L      N+   T +++ECHRSHKGLFIGLL FMATLV +  F +F      +  AI +YQ +E+VLLA S+ + +   IQ R L   +L+EE  FDDNL+LV L G+  Y+LFL +  I++          +   LF  K+L EI+QS++QVFF+LE+SR+ A +      KPGR+++TFL+I NLA+W ++ FE KRAD   I   YY    W IITH  LP+I+FFRFHS++CL+ IW  +Y
Sbjct:  363 YLSRDSEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEADITGAGPCHSTLWIPIHVLHFVYVFWQTYFLFKHHQVVFNVQKFALRFLLCHLAVANLCQWLKTIVDEISNEPAHESPTHVNTSDTSEDHVDLLWEAFSHSITRRDGSLNLSSDEIYETYSTERLNHTVPHTVGVEVSSHFGSCRSTAKYLAPFLFPCAIEYSLIAGAIFYKMFQKVGHVREESERLARMRKANT--MTRRFAECHRSHKGLFIGLLLFMATLVTMCLFFIFFTKENKKNTAITLYQSTELVLLALSLFTCVAIMIQFRVLKLSELSEEGAFDDNLLLVGLIGMIFYDLFLLVPAIEAI-----NTGMIVARLFAAKALLEIVQSMLQVFFILEASRRCAGSLAHVRNKPGRTLITFLLILNLAMWFVNTFEVKRADNQSIHIDYYTGMAWKIITHIALPMIVFFRFHSTVCLSDIWANAY 824          
BLAST of Otopetrin vs. TrEMBL
Match: A0A4Z2D9Y9 (Otopetrin isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_003030 PE=4 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 1.190e-98
Identity = 195/467 (41.76%), Postives = 277/467 (59.31%), Query Frame = 1
Query:  643 YVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSF---CHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHE-------------------LIEHNIKFIDKSDF----------HNKTVCADELSHS--------------------VAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTI-KYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            Y  ++T G+NLYLRLGAVGFGFGVM+ DGFK+A+      S    CH  LW P   LH  Y+F QT+F+FK+HR +F   K V+RF+L HL ++N+CQW KT+V EI  E                   L++ NI   + S F          HN       ++H                     +APYLFPCAIEYSLI+ A+FYKMF+KVG  + +K  +    L      I ++SECHRSHKGLF+GLL FMATLV ++ F +F      +  AI +YQ +E+VLL+ S ++ +++  +++ L    L+EE  FDDNL+L+ L G+  Y+LFL +  +++          +   L+  K++ E+IQS++QVFF+LE+SR+ A   +   +KPGR+++TFL++ NLA+W ++ FE K AD H I   YY    W IITH  LPLI+FFRFHS++CL+ IW  +Y
Sbjct:  466 YFSRDTEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEEGASSVVSCHGHLWIPLHLLHFIYVFWQTYFLFKHHRVVFNVQKFVLRFLLCHLAVANLCQWLKTIVDEIGSEPGHDEEPTSKWNIVSPSEYLMDSNITHGNTSIFKYASSVNRTKHNVATVPHRMNHDNATVNAVEQAVLGCGVTVKYLAPYLFPCAIEYSLIAGAIFYKMFEKVG--HVRKESERLEKLRKANPKISQFSECHRSHKGLFVGLLLFMATLVAMSLFFIFIVKRDRRNTAITLYQGTELVLLSVSTLTCLISLFRLQALKLSDLSEEVAFDDNLLLIGLVGMLFYDLFLLVPALEAIP-----NGVIAAKLYAAKAIMEMIQSMLQVFFILEASRRCAGTLEHIQKKPGRTMITFLLVLNLAMWFVNTFEVKHADNHSIHINYYSSMAWKIITHIALPLIVFFRFHSTVCLSDIWANAY 925          
BLAST of Otopetrin vs. TrEMBL
Match: A0A4Z2D9Z2 (Otopetrin isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_003030 PE=4 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 1.604e-98
Identity = 195/467 (41.76%), Postives = 277/467 (59.31%), Query Frame = 1
Query:  643 YVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSF---CHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHE-------------------LIEHNIKFIDKSDF----------HNKTVCADELSHS--------------------VAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTI-KYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            Y  ++T G+NLYLRLGAVGFGFGVM+ DGFK+A+      S    CH  LW P   LH  Y+F QT+F+FK+HR +F   K V+RF+L HL ++N+CQW KT+V EI  E                   L++ NI   + S F          HN       ++H                     +APYLFPCAIEYSLI+ A+FYKMF+KVG  + +K  +    L      I ++SECHRSHKGLF+GLL FMATLV ++ F +F      +  AI +YQ +E+VLL+ S ++ +++  +++ L    L+EE  FDDNL+L+ L G+  Y+LFL +  +++          +   L+  K++ E+IQS++QVFF+LE+SR+ A   +   +KPGR+++TFL++ NLA+W ++ FE K AD H I   YY    W IITH  LPLI+FFRFHS++CL+ IW  +Y
Sbjct:  509 YFSRDTEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEEGASSVVSCHGHLWIPLHLLHFIYVFWQTYFLFKHHRVVFNVQKFVLRFLLCHLAVANLCQWLKTIVDEIGSEPGHDEEPTSKWNIVSPSEYLMDSNITHGNTSIFKYASSVNRTKHNVATVPHRMNHDNATVNAVEQAVLGCGVTVKYLAPYLFPCAIEYSLIAGAIFYKMFEKVG--HVRKESERLEKLRKANPKISQFSECHRSHKGLFVGLLLFMATLVAMSLFFIFIVKRDRRNTAITLYQGTELVLLSVSTLTCLISLFRLQALKLSDLSEEVAFDDNLLLIGLVGMLFYDLFLLVPALEAIP-----NGVIAAKLYAAKAIMEMIQSMLQVFFILEASRRCAGTLEHIQKKPGRTMITFLLVLNLAMWFVNTFEVKHADNHSIHINYYSSMAWKIITHIALPLIVFFRFHSTVCLSDIWANAY 968          
BLAST of Otopetrin vs. TrEMBL
Match: A0A4S2LBS8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008757 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 3.808e-98
Identity = 202/453 (44.59%), Postives = 278/453 (61.37%), Query Frame = 1
Query:  637 NYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVAD--QVRLQN-SFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIE--------------HNIKFI------DKSDFHNKTVCADELSHS-------------VAPYLFPCAIEYSLISAAVFYKMFQKVG-LANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
             +Y  ++T G+NLYLRLGAVGFGFGVM+ DGFK+A+  + RL +   CHN  W P   LH  Y+F QT+F+FK+H+ +F   K V+RF+L HL ++N+CQW KTVV EI+ E  E              HN+K +        S  H  T     ++HS             +AP+LFPCAIEYSLI+ A+FYKMFQKVG +    + L+     N+   +  ++ECHRSHKGLFIGLL FM TLV +  F +F      +  AI +YQ +E+VLL  S+++ +   I++R L    L+EE  FDDNL+LV L G+  Y+LFL +  +++    K     +   LF  K+L EI QS++QVFF+LE SR+ A +      KPGR+++TFL+I NLA+W ++ FE KRAD H I   YY    W IITH  LP+I+FFRFHS++CL+ IW  +Y
Sbjct:  307 GWYFSRDTEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEARLNDQESCHNHFWIPIHILHFIYVFWQTYFLFKHHQVVFNVQKFVLRFLLCHLAVANLCQWLKTVVDEISVEPHETTTSTLPLTLHETTHNLKNLSLPQTSSMSTVHT-TTDPHMITHSRSSGHGCRSTAKYLAPFLFPCAIEYSLIAGAMFYKMFQKVGHVRQESERLERIRQANNV--SGHFAECHRSHKGLFIGLLLFMVTLVSMCLFFIFFTRLDKRNTAITLYQCTELVLLGLSMLTCVFTMIRLRVLHLSNLSEEGAFDDNLLLVGLVGMIFYDLFLLVPALEAIPSGK-----IAAKLFAAKALMEIAQSMVQVFFILEGSRRCAGSVAHVHNKPGRTLITFLLILNLAMWFVNTFEVKRADNHSIHIDYYTGMAWKIITHISLPMIVFFRFHSTVCLSDIWANAY 751          
BLAST of Otopetrin vs. Ensembl Nematostella
Match: EDO48113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK62])

HSP 1 Score: 55.8398 bits (133), Expect = 3.947e-8
Identity = 43/158 (27.22%), Postives = 70/158 (44.30%), Query Frame = 1
Query:  679 LRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPK---QCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDFHNKTVC------ADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKV 1125
            L  GA  FG G  V D   +A  V      C + L  P          +IF Q  F+ K+  A   K  + IR +L+H+  +N+C WF+ +    +H     +++     D   +T C        ++  +  PYL+P  +EYSLI+  + Y M+  +
Sbjct:  164 LMAGAYVFGAGSCVMDLLHIAFYVE-----CSSNL--PSLFFSVFKAVFIFSQILFLRKFATATLHKSPS-IRLVLFHILGTNVCIWFRAL---FSHSRSIFSVRGTTTLDSAAETECIALHYSMSKIWEASEPYLYPFTMEYSLIAGGILYNMWSGM 310          

HSP 2 Score: 50.8322 bits (120), Expect = 1.335e-6
Identity = 46/146 (31.51%), Postives = 72/146 (49.32%), Query Frame = 1
Query: 1438 DDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWT-ISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIW 1872
            DD L++ S +G+F Y      + I      KN++  L  +  + KS   + Q+++Q   V+++ R + I++  A     R    FL+  N ALW   S FE +      + T +Y +  W  IT    PL IFFRFHS+ CL  +W
Sbjct:  469 DDTLLIASFSGLFLYAGLCLTAGI---AEYKNKQ--LISSFSIAKSTLILFQAMLQASAVIKALRFKPIDEIGA--NVIRQGALFLLTTNFALWAQDSFFELRNFATTPVQTVFYGEKSWRAITTLAYPLCIFFRFHSAACLFEVW 607          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 68.5514 bits (166), Expect = 1.086e-11
Identity = 101/453 (22.30%), Postives = 190/453 (41.94%), Query Frame = 1
Query:  625 QQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVV-----------YEINHELIEHNIKFIDKSDFHNKTVCADELSHSVAP----YLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKT--------QTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEE----TFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPG------------------RSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHS 1848
            ++  N  + K+ +   ++LR G V FG   ++ D FK+A  V   +  C + +      + L ++ +QT+F++ + +      K +    L     +N+  W   V            YE+N   +     +I K+ + + +      S  V      YL+P  IEYSL ++A+ + M++ VG    + +          KH  K++       G  +G+L  +A   GLATF++++   KT           A+M++     +++ + +    V    + K+  R+   E+    + D  L++ +  G F  + F  I+TI +    K   N L L       +  + Q  +Q FF++E   +   ++ +  EK                    R V  FL++ N+ LW +  F A+   +H    ++Y+   W  I +  LP  IF+R HS
Sbjct:  120 RRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYLH--CDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCVQLQKNISCCGLMLTLSTNLALWMAAVTEESLHQTVLPDYEVNVTKLSARSLYISKAGYGDDSCKCSHTSCGVFKEAYYYLYPFNIEYSLFASAMSFVMWKNVGRVASEHS----------KHNFKFT-LKDIVIGPVVGILLVIA---GLATFIVYEIEMKTYRSDDDDINDHAVMMH-FIMNIVIVTMMSVSTVIGCAIFKVDHREHVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGA--KGHLNRLNLAW----GVLMVFQLGLQNFFIIEGLHREPFHEVEDNEKSEESCFEGHKHKLLWKRRVLREVCVFLLLGNIILWIMPAFGARPQFDHDTEVEFYKFNMWAAIVNVGLPFGIFYRMHS 549          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 62.7734 bits (151), Expect = 6.723e-10
Identity = 103/469 (21.96%), Postives = 193/469 (41.15%), Query Frame = 1
Query:  625 QQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHE--LIEHNIKFIDKSDFHNKTVCADELSHSVAP-------YLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKT--------QTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEE----TFDDNLILVSLAGVFTYNLFLFISTIDSTVRMK-NRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEK------------------PG---------------------RSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHS 1848
            ++  N  + K+ +   ++LR G V FG   ++ D FK+A  V   +  C + +      + L ++ +QT+F++ + +      K +    L     +N+  W   V  E  H+  L ++ +     S  ++   C    SH+          YL+P  IEYSL ++A+ + M++ VG    + +          KH  K++       G  +G+L  +A   GLATF++++   KT           A+M++     +++ + +    V    + K+  R+   E+    + D  L++ +  G F  + F  I+TI +  +   NR N       L   +  + Q  +Q FF++E   +   ++ + LEK                  P                      R V  FL++ N+ LW +  F A+   +H    ++Y+   W  I +  LP  IF+R HS
Sbjct:  119 RRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYLH--CDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCVQLQKNISCCGLMLTLSTNLALWMAAVTEESLHQTVLPDYEVNVTKLSARNDSCKC----SHTSCGVFKEAYYYLYPFNIEYSLFASAMSFVMWKNVGRVASEHS----------KHNFKFT-LKDIVIGPVVGILLVIA---GLATFIVYEIEMKTYRSDDDDINDHAVMMH-FIMNIVIVTMMSVSTVIGCAIFKVDHREHVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGAKGHLNRLN-------LAWGVLMVFQLGLQNFFIIEGLHREPFHEVEELEKTNASTFERGEGAAKPNLVPATLNYSSATEHKHKLLWKRRVLREVCVFLLLGNIILWIMPAFGARPQFDHDTEVEFYKFNMWAAIVNVGLPFGIFYRMHS 559          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 55.0694 bits (131), Expect = 1.967e-7
Identity = 56/242 (23.14%), Postives = 106/242 (43.80%), Query Frame = 1
Query:  625 QQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVV-----------YEINHELIEHNIKFIDKSDFHNKTVCADELSHSVAP----YLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKT 1305
            ++  N  + K+ +   ++LR G V FG   ++ D FK+A  V   +  C + +      + L ++ +QT+F++ + +      K +    L     +N+  W   V            YE+N   +     +I K+ + + +      S  V      YL+P  IEYSL ++A+ + M++ VG    + +          KH  K++       G  +G+L  +A   GLATF++++   KT
Sbjct:  123 RRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYLH--CDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCVQLQKNISCCGLMLTLSTNLALWMAAVTEESLHQTVLPDYEVNVTKLSARSLYISKAGYGDDSCKCSHTSCGVFKEAYYYLYPFNIEYSLFASAMSFVMWKNVGRVASEHS----------KHNFKFT-LKDIVIGPVVGILLVIA---GLATFIVYEIEMKT 348          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 54.6842 bits (130), Expect = 2.410e-7
Identity = 103/489 (21.06%), Postives = 194/489 (39.67%), Query Frame = 1
Query:  625 QQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTIS-NICQWFKTVV-----------YEINHELIEHNIKFIDKSDFHNKTVCADELSHSVAP----YLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKT--------QTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEE----TFDDNLILVSLAGVFTYNLFLFISTIDSTVRMK-NRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQ---------------------------KQALEKPG-------------------------RSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHS 1848
            ++  N  + K+ +   ++LR G V FG   ++ D FK+A  V   +  C + +      + L ++ +QT+F++ + +     H  ++      LT+S N+  W   V            YE+N   +     +I K+ + + +      S  V      YL+P  IEYSL ++A+ + M++ VG    + +          KH  K++       G  +G+L  +A   GLATF++++   KT           A+M++     +++ + +    V    + K+  R+   E+    + D  L++ +  G F  + F  I+TI +  +   NR N       L   +  + Q  +Q FF++E   +   ++                            +   KP                          R V  FL++ N+ LW +  F A+   +H    ++Y+   W  I +  LP  IF+R HS
Sbjct:   83 RRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYLH--CDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCV--HCGLM------LTLSTNLALWMAAVTEESLHQTVLPDYEVNVTKLSARSLYISKAGYGDDSCKCSHTSCGVFKEAYYYLYPFNIEYSLFASAMSFVMWKNVGRVASEHS----------KHNFKFT-LKDIVIGPVVGILLVIA---GLATFIVYEIEMKTYRSDDDDINDHAVMMH-FIMNIVIVTMMSVSTVIGCAIFKVDHREHVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGAKGHLNRLN-------LAWGVLMVFQLGLQNFFIIEGLHREPFHEVEEPITVVENPYVLELLEKTNASTFERGEGAAKPNLVPATLNYSSATEHKHKLLWKRRVLREVCVFLLLGNIILWIMPAFGARPQFDHDTEVEFYKFNMWAAIVNVGLPFGIFYRMHS 539          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018672.1 (SMESG000018672.1)

HSP 1 Score: 964.526 bits (2492), Expect = 0.000e+0
Identity = 511/616 (82.95%), Postives = 546/616 (88.64%), Query Frame = 1
Query:   61 MNEKELLKNEILDKSYSRSGRRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKNNKKDDPCQDEITRELVDLDSQKVTFKLSHQNTEDVELENISNDDTTHLSTNNLQINNLSNAFNTDDKSSHLENKLFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEH------NIKFIDKSDFHNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSE--KHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            MNEKELLKNEILDKSYSRS RRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKNNKKDDPCQDEITRELVDLDSQKVTFKLSHQNTEDVELENISNDDTTHLST     NNLSNAFNTDDKSSHLENKLFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHEL++H      NI         NKT C D+LS+SV+PYLFPCAIEYSLISAA+FYKM Q+VG  N      S   L ++     IKYSECHRSHKGLF+GLLFFM TLVGLA FL+FK+ +KTQTLA+MVYQVSEI+LL SS I+L+ AFI+MR L F QL+EEE  DDNL+LV LAGVF YNLFLFISTIDS+ ++ N K+SL++ LFLCKS+TEIIQSL+QV FVLESSRK A +      KPGRS+VTFLI+ NLALWT+SIFEAKRADEHLIFT+YYQKTPW+IITHTLLPLIIFFRFHSSICLT IW K+Y
Sbjct:    1 MNEKELLKNEILDKSYSRSDRRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKNNKKDDPCQDEITRELVDLDSQKVTFKLSHQNTEDVELENISNDDTTHLST-----NNLSNAFNTDDKSSHLENKLFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKT-CTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVG-GNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQVSEIILLVSSSIALVCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAY 609          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018670.1 (SMESG000018670.1)

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 461/597 (77.22%), Postives = 508/597 (85.09%), Query Frame = 1
Query:  115 SGRRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKNNKKDDPCQDEITRELVDL-----DSQKVTFKLSHQNTEDVELENISNDDTTHLSTNNL--QINNLSNAFNTDDKSSHLENKLFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDFHNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            S R+ S+   +F INN RSS +VS T+L+AMSQLF GIV+PLSDSFV+ S+ E +H YYLE +L+IQY+ A+ S+F+LQGY+YI++ +L +   K+   ++E     V L     D+     +    N  ++E+    +++ T L   N   +IN +S +           + L  S+  +N ++  + +GIN+YLRLGAVGFGFGVMVHDGFK+ADQVR QNS CHN LWTPKQCLHLAYIF QTFFIFKYHR I+LKHK +IRFILYHLTISNIC+WFKTVVYEINHELIEHNIKFIDKSDFHNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQVSEIVLLASSIISLIVAFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRK AINQKQALEK GRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKTPWTIITHTLLPLIIFFRFHSSICLTAIWRKSY
Sbjct:   19 STRKQSIGLMEFRINNSRSSTSVSITILYAMSQLFLGIVLPLSDSFVSNSDYEADHTYYLEIYLMIQYILAVISIFYLQGYIYIYEKFLSRKRNKNAEIKEEDKEIEVILANNFFDNNNKIDESYIINQNEIEVSAKEDEERTSLENTNFISKINQISVS----------NSNLADSENIDNKFIFHDNDGINVYLRLGAVGFGFGVMVHDGFKIADQVRAQNSSCHNHLWTPKQCLHLAYIFSQTFFIFKYHRIIYLKHKIIIRFILYHLTISNICEWFKTVVYEINHELIEHNIKFIDKSDFHNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQVSEIVLLASSIISLIVAFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKHAINQKQALEKSGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKTPWTIITHTLLPLIIFFRFHSSICLTAIWRKSY 605          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018670.1 (SMESG000018670.1)

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 461/597 (77.22%), Postives = 508/597 (85.09%), Query Frame = 1
Query:  115 SGRRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKNNKKDDPCQDEITRELVDL-----DSQKVTFKLSHQNTEDVELENISNDDTTHLSTNNL--QINNLSNAFNTDDKSSHLENKLFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDFHNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            S R+ S+   +F INN RSS +VS T+L+AMSQLF GIV+PLSDSFV+ S+ E +H YYLE +L+IQY+ A+ S+F+LQGY+YI++ +L +   K+   ++E     V L     D+     +    N  ++E+    +++ T L   N   +IN +S +           + L  S+  +N ++  + +GIN+YLRLGAVGFGFGVMVHDGFK+ADQVR QNS CHN LWTPKQCLHLAYIF QTFFIFKYHR I+LKHK +IRFILYHLTISNIC+WFKTVVYEINHELIEHNIKFIDKSDFHNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQVSEIVLLASSIISLIVAFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRK AINQKQALEK GRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKTPWTIITHTLLPLIIFFRFHSSICLTAIWRKSY
Sbjct:   21 STRKQSIGLMEFRINNSRSSTSVSITILYAMSQLFLGIVLPLSDSFVSNSDYEADHTYYLEIYLMIQYILAVISIFYLQGYIYIYEKFLSRKRNKNAEIKEEDKEIEVILANNFFDNNNKIDESYIINQNEIEVSAKEDEERTSLENTNFISKINQISVS----------NSNLADSENIDNKFIFHDNDGINVYLRLGAVGFGFGVMVHDGFKIADQVRAQNSSCHNHLWTPKQCLHLAYIFSQTFFIFKYHRIIYLKHKIIIRFILYHLTISNICEWFKTVVYEINHELIEHNIKFIDKSDFHNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQVSEIVLLASSIISLIVAFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKHAINQKQALEKSGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKTPWTIITHTLLPLIIFFRFHSSICLTAIWRKSY 607          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018671.1 (SMESG000018671.1)

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 363/611 (59.41%), Postives = 449/611 (73.49%), Query Frame = 1
Query:  112 RSGRRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKN-----------NKKDDPCQDEITRELVDL-DSQKVTFKL-----SHQNTEDVELENISNDDTTHLSTNNLQINNLSNAFNTDDKSSHLENKL--FTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDF-HNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            +  RRH+VAFADFAI + R+SI VSCTLLFAM QLF GIVIPLSDSFVTIS+    HAYYLEAFLIIQY +AI  VF+LQGY+++ +   K+N            KK     D I  + +D+ +S KVTF L     +HQ + ++ + ++  DD                 F T  K+SH  +++    SQ      ++++  GINLYLRLGAVGFGFGVMVHDGFK+AD+ RL+   CHN+LWTPK CLHL+YIF+QTFFIFKYHR IFLKHK ++RFILY+L  SNICQWFKTVVYEINHEL+EH  K   KS+   N + C+ +LS++V+P+LFPCAIEYSLISAA+FYKM QKVG  +   + +       E+   KYSECHRSH+GLF+GLLFFM TLVG+A F +FK+   TQ+ +++VYQ+SEI+LL SSII+L+ AFI+MR L FRQLTEE+  DDNL+L+ L+GVF+YNLFLFISTIDS +R+   + SL + LF+CKSLTE++QS IQV FVLE SRK    +     KPGRS+VTFLII NLALW +SIFEAKR+DEHLIFT+YYQKTPW+IITHTLLPLIIFFRFHSSICL  IW KSY
Sbjct:   17 KKNRRHNVAFADFAIPDTRASIRVSCTLLFAMCQLFCGIVIPLSDSFVTISDSGMGHAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQRSNEISITSMQEDDI----------------FLTSFKNSHPSSEVSSIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISMKSNLSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSY 611          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018671.1 (SMESG000018671.1)

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 323/555 (58.20%), Postives = 404/555 (72.79%), Query Frame = 1
Query:  280 HAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKN-----------NKKDDPCQDEITRELVDL-DSQKVTFKL-----SHQNTEDVELENISNDDTTHLSTNNLQINNLSNAFNTDDKSSHLENKL--FTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELIEHNIKFIDKSDF-HNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQXXXXXXXXXXXXXXXXXFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKXXXXXXXXXXXXXXXFFRFHSSICLTAIWRKSY 1884
            HAYYLEAFLIIQY +AI  VF+LQGY+++ +   K+N            KK     D I  + +D+ +S KVTF L     +HQ + ++ + ++  DD                 F T  K+SH  +++    SQ      ++++  GINLYLRLGAVGFGFGVMVHDGFK+AD+ RL+   CHN+LWTPK CLHL+YIF+QTFFIFKYHR IFLKHK ++RFILY+L  SNICQWFKTVVYEINHEL+EH  K   KS+   N + C+ +LS++V+P+LFPCAIEYSLISAA+FYKM QKVG  +   + +       E+   KYSECHRSH+GLF+GLLFFM TLVG+A F +FK+   TQ+ +++VYQ+SEI+LL SSII+L+ AFI+MR L FRQLTEE+  DDNL+L+ L+GVF+YNLFLFISTIDS +R+   + SL + LF+CKSLTE++QS IQV FVLE SRK    +     KPGRS+VTFLII NLALW +SIFEAKR+DEHLIFT+YYQKTPW+IITHTLLPLIIFFRFHSSICL  IW KSY
Sbjct:   46 HAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQRSNEISITSMQEDDI----------------FLTSFKNSHPSSEVSSIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISMKSNLSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSY 584          
The following BLAST results are available for this feature:
BLAST of Otopetrin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
OTOP18.326e-621.69otopetrin 1 [Source:HGNC Symbol;Acc:HGNC:19656][more]
back to top
BLAST of Otopetrin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otpl-82.025e-2826.99OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:G5EDX... [more]
otpl-37.880e-2526.88OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL... [more]
otpl-37.880e-2526.88OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL... [more]
otpl-19.365e-2526.06OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O4506... [more]
otpl-11.491e-2426.50OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O4506... [more]
back to top
BLAST of Otopetrin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OtopLc3.466e-5231.39gene:FBgn0259150 transcript:FBtr0331167[more]
OtopLc3.756e-5231.25gene:FBgn0259150 transcript:FBtr0346834[more]
OtopLc3.870e-5231.39gene:FBgn0259150 transcript:FBtr0331168[more]
OtopLb2.057e-3525.78gene:FBgn0031514 transcript:FBtr0077608[more]
OtopLb3.061e-3525.78gene:FBgn0031514 transcript:FBtr0344796[more]
back to top
BLAST of Otopetrin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
otop26.174e-822.34otopetrin 2 [Source:ZFIN;Acc:ZDB-GENE-050104-2][more]
otop27.864e-822.18otopetrin 2 [Source:ZFIN;Acc:ZDB-GENE-050104-2][more]
back to top
BLAST of Otopetrin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
crp.15.208e-821.43C-reactive protein, pentraxin-related, gene 1 [Sou... [more]
crp.15.362e-821.62C-reactive protein, pentraxin-related, gene 1 [Sou... [more]
slc46a22.791e-726.52solute carrier family 46 member 2 [Source:Xenbase;... [more]
ENSXETT00000044547.18.882e-623.67otopetrin 2 [Source:NCBI gene;Acc:100496174][more]
back to top
BLAST of Otopetrin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Otop12.233e-722.22otopetrin 1 [Source:MGI Symbol;Acc:MGI:2388363][more]
Otop12.595e-722.40otopetrin 1 [Source:MGI Symbol;Acc:MGI:2388363][more]
back to top
BLAST of Otopetrin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|B7Z0W9|OTOP_DROME3.474e-5131.39Proton channel OtopLc OS=Drosophila melanogaster O... [more]
sp|Q7M734|OTOP1_RAT7.469e-722.22Proton channel OTOP1 OS=Rattus norvegicus OX=10116... [more]
sp|Q80VM9|OTOP1_MOUSE1.815e-622.40Proton channel OTOP1 OS=Mus musculus OX=10090 GN=O... [more]
back to top
BLAST of Otopetrin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YZQ11.730e-10142.86Otopetrin (Fragment) OS=Fasciola gigantica OX=4683... [more]
A0A4E0RHX66.055e-10142.00Otopetrin OS=Fasciola hepatica OX=6192 GN=D915_000... [more]
A0A4Z2D9Y91.190e-9841.76Otopetrin isoform 2 OS=Schistosoma japonicum OX=61... [more]
A0A4Z2D9Z21.604e-9841.76Otopetrin isoform 1 OS=Schistosoma japonicum OX=61... [more]
A0A4S2LBS83.808e-9844.59Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Otopetrin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO481133.947e-827.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Otopetrin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
otop21.086e-1122.30otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
otop26.723e-1021.96otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
otop21.967e-723.14otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
otop22.410e-721.06otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
back to top
BLAST of Otopetrin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018672.10.000e+082.95SMESG000018672.1[more]
SMESG000018670.10.000e+077.22SMESG000018670.1[more]
SMESG000018670.10.000e+077.22SMESG000018670.1[more]
SMESG000018671.10.000e+059.41SMESG000018671.1[more]
SMESG000018671.10.000e+058.20SMESG000018671.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007292 ID=SMED30007292|Name=Otopetrin|organism=Schmidtea mediterranea sexual|type=transcript|length=1999bp
CAACAAATTAGTTCAAACACAATGGCATGTTTATAAAGATAAATGATTTT
ATAGTTCAACATGAATGAAAAGGAACTTTTGAAAAACGAAATTTTGGATA
AATCTTATTCTAGAAGTGGCAGAAGACATAGCGTGGCCTTCGCAGATTTT
GCAATTAACAATCCACGAAGTTCAATTGCTGTGTCATGCACTCTTTTATT
TGCCATGAGCCAGTTGTTTTTTGGAATTGTCATTCCATTATCAGATTCTT
TTGTGACGATTTCGGAAAAAGAAACAGAACATGCATATTATTTAGAGGCA
TTTTTAATTATCCAGTACGTGACAGCTATTGCTAGCGTATTTTTCTTGCA
AGGATATGTTTATATACACGATTGCTATTTGAAGAAAAATAATAAAAAAG
ACGATCCATGCCAAGACGAAATTACTCGCGAGCTTGTAGATTTGGATTCA
CAAAAGGTCACATTCAAGCTATCTCATCAAAACACTGAAGACGTAGAGCT
GGAAAATATTTCAAATGATGACACAACTCATTTGTCAACAAATAATTTGC
AAATAAATAATTTGTCAAATGCTTTTAACACCGATGACAAGTCAAGTCAC
TTAGAAAACAAATTATTTACATCTCAACAATTTAATAACTATTACGTTAT
AAAAGAAACTAATGGAATAAATCTTTACTTGAGACTTGGAGCTGTTGGAT
TTGGGTTTGGAGTTATGGTCCATGACGGCTTTAAAGTTGCTGATCAAGTT
AGGCTGCAAAATAGTTTTTGCCACAACCAACTATGGACTCCAAAGCAATG
TTTACATCTAGCTTATATTTTCATTCAAACATTTTTTATTTTCAAATATC
ACAGAGCAATTTTCCTCAAGCACAAAGCTGTCATTCGGTTCATTTTGTAT
CACTTAACTATTTCCAATATTTGCCAGTGGTTCAAAACTGTTGTTTATGA
AATAAATCATGAATTAATAGAACATAACATCAAATTCATAGATAAATCAG
ATTTTCACAATAAAACAGTTTGTGCAGACGAATTGTCTCATTCTGTAGCA
CCATACTTGTTCCCGTGTGCCATTGAGTACAGCTTGATAAGTGCCGCAGT
ATTTTATAAAATGTTCCAAAAGGTTGGCTTAGCTAACTATCAGAAAAATC
TCAAAAGCTTTTGCTCGTTAAATTCAGAAAAGCACACGATAAAGTATTCA
GAATGCCATAGATCTCATAAAGGTCTTTTTATTGGACTTTTGTTTTTTAT
GGCAACTTTAGTTGGATTGGCAACATTTTTGATGTTTAAACGAAACAATA
AAACACAAACTTTAGCAATTATGGTTTATCAAGTTTCAGAAATAGTACTT
TTAGCGTCCAGCATAATATCACTTATTGTCGCTTTTATCCAAATGAGAAA
ACTCGGATTTCGTCAACTAACGGAAGAGGAGACATTTGATGATAATTTAA
TTTTGGTGAGCTTGGCTGGTGTATTTACATATAATCTATTTTTATTTATT
TCAACAATTGACTCGACTGTGAGAATGAAAAATAGAAAAAATTCTTTAAC
TTTGACATTATTTTTGTGCAAATCATTAACGGAAATTATTCAGTCCTTAA
TTCAAGTGTTTTTTGTACTGGAAAGTTCCAGGAAGCGTGCTATAAATCAA
AAACAAGCTTTGGAAAAGCCAGGAAGATCTGTGGTGACGTTTTTAATTAT
TAATAATCTGGCTCTTTGGACTATCAGTATTTTTGAAGCGAAGAGAGCAG
ATGAACATTTAATTTTTACTCAATATTATCAAAAAACTCCTTGGACTATA
ATTACTCATACTCTTTTACCCTTGATCATTTTCTTCAGATTTCATTCGTC
AATTTGTCTGACTGCGATTTGGAGAAAATCATATTAAAATTTTGATTTGA
GGTTTTAAGACGTTTTAGGAATTAATTATTGAAAGACATTTTGAAATTGC
AGAAAATCTGTACCAAATTCTTTTAGTTTTATAATTTTCAAAATAAGCA
back to top

protein sequence of SMED30007292-orf-1

>SMED30007292-orf-1 ID=SMED30007292-orf-1|Name=SMED30007292-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=609bp
MNEKELLKNEILDKSYSRSGRRHSVAFADFAINNPRSSIAVSCTLLFAMS
QLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYV
YIHDCYLKKNNKKDDPCQDEITRELVDLDSQKVTFKLSHQNTEDVELENI
SNDDTTHLSTNNLQINNLSNAFNTDDKSSHLENKLFTSQQFNNYYVIKET
NGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHL
AYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINH
ELIEHNIKFIDKSDFHNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYK
MFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATL
VGLATFLMFKRNNKTQTLAIMVYQVSEIVLLASSIISLIVAFIQMRKLGF
RQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTL
FLCKSLTEIIQSLIQVFFVLESSRKRAINQKQALEKPGRSVVTFLIINNL
ALWTISIFEAKRADEHLIFTQYYQKTPWTIITHTLLPLIIFFRFHSSICL
TAIWRKSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR004878Otopetrin
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 39..61