GATA456

Overview
NameGATA456 (AFF18488.1)
Smed IDSMED30007290
Uniprot Best hitTranscription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 (E=1.58034e-32)
Length (bp)2033
Expression

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Definitive gut progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and gata456a (green). Definitive gut progenitors, coexpressing piwi-1 and gata456a, are dispersed in the embryonic wall. As definitive gut progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of gata456a. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

Homology
BLAST of GATA456 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 130.183 bits (326), Expect = 3.923e-33
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P++ S SE
Sbjct:    8 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAAPSGSE 132          
BLAST of GATA456 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 128.257 bits (321), Expect = 5.221e-33
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P++ S SE
Sbjct:    8 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAAPSGSE 132          
BLAST of GATA456 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 134.035 bits (336), Expect = 6.663e-33
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P++ S SE
Sbjct:  215 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAAPSGSE 339          
BLAST of GATA456 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 134.035 bits (336), Expect = 6.782e-33
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P++ S SE
Sbjct:  214 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAAPSGSE 338          
BLAST of GATA456 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 132.109 bits (331), Expect = 2.623e-32
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P++ S SE
Sbjct:  213 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAAPSGSE 337          
BLAST of GATA456 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 127.102 bits (318), Expect = 4.027e-31
Identity = 62/121 (51.24%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCG  NT LW RD SG YLC+ C  + + N  +R L K               KK   N Q   KR+ +EC NC+   T+LWRRN EG PVCNACGLY+KLHK  RP++M+K+GIQT
Sbjct:  215 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKP--------------KKRQQNAQ---KRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 318          
BLAST of GATA456 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 127.102 bits (318), Expect = 7.538e-31
Identity = 62/121 (51.24%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCG  NT LW RD SG YLC+ C  + + N  +R L K               KK   N Q   KR+ +EC NC+   T+LWRRN EG PVCNACGLY+KLHK  RP++M+K+GIQT
Sbjct:  287 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKP--------------KKRQQNAQ---KRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 390          
BLAST of GATA456 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 127.102 bits (318), Expect = 7.607e-31
Identity = 62/121 (51.24%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCG  NT LW RD SG YLC+ C  + + N  +R L K               KK   N Q   KR+ +EC NC+   T+LWRRN EG PVCNACGLY+KLHK  RP++M+K+GIQT
Sbjct:  286 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKP--------------KKRQQNAQ---KRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 389          
BLAST of GATA456 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 125.946 bits (315), Expect = 8.870e-31
Identity = 61/121 (50.41%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCG  NT LW RD SG YLC+ C  + + N  +R L K               K+ NA      KR+ +EC NC+   T+LWRRN EG PVCNACGLY+KLHK  RP++M+K+GIQT
Sbjct:  215 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPK-------------KRQNAQ-----KRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 317          
BLAST of GATA456 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 125.946 bits (315), Expect = 1.664e-30
Identity = 61/121 (50.41%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCG  NT LW RD SG YLC+ C  + + N  +R L K               K+ NA      KR+ +EC NC+   T+LWRRN EG PVCNACGLY+KLHK  RP++M+K+GIQT
Sbjct:  287 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPK-------------KRQNAQ-----KRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 389          
BLAST of GATA456 vs. Ensembl Fly
Match: grn (grain [Source:FlyBase gene name;Acc:FBgn0001138])

HSP 1 Score: 131.724 bits (330), Expect = 2.891e-32
Identity = 59/120 (49.17%), Postives = 77/120 (64.17%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA++T LW RD +G+YLC+ C  + + N +N   +   +          + +  + Q   KR+   C+NCK T T+LWRRN  GEPVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  258 GRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKR----------RLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 367          
BLAST of GATA456 vs. Ensembl Fly
Match: grn (grain [Source:FlyBase gene name;Acc:FBgn0001138])

HSP 1 Score: 134.035 bits (336), Expect = 3.109e-32
Identity = 61/135 (45.19%), Postives = 82/135 (60.74%), Query Frame = 1
Query:  973 LNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            L++ P+          RECVNCGA++T LW RD +G+YLC+ C  + + N +N   +   +          + +  + Q   KR+   C+NCK T T+LWRRN  GEPVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  456 LDVKPVRTKPRTSAEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKR----------RLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 580          
BLAST of GATA456 vs. Ensembl Fly
Match: grn (grain [Source:FlyBase gene name;Acc:FBgn0001138])

HSP 1 Score: 133.65 bits (335), Expect = 3.392e-32
Identity = 61/135 (45.19%), Postives = 82/135 (60.74%), Query Frame = 1
Query:  973 LNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            L++ P+          RECVNCGA++T LW RD +G+YLC+ C  + + N +N   +   +          + +  + Q   KR+   C+NCK T T+LWRRN  GEPVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  456 LDVKPVRTKPRTSAEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKR----------RLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 580          
BLAST of GATA456 vs. Ensembl Fly
Match: pnr (pannier [Source:FlyBase gene name;Acc:FBgn0003117])

HSP 1 Score: 130.568 bits (327), Expect = 7.320e-32
Identity = 60/121 (49.59%), Postives = 77/121 (63.64%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P+ ++ S+T                +R  L C+NC    T+LWRRNN+GEPVCNACGLYYKLH   RPL+MRK+GIQT
Sbjct:  114 GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKRLVSATAT--------------RRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQT 220          
BLAST of GATA456 vs. Ensembl Fly
Match: pnr (pannier [Source:FlyBase gene name;Acc:FBgn0003117])

HSP 1 Score: 130.568 bits (327), Expect = 7.320e-32
Identity = 60/121 (49.59%), Postives = 77/121 (63.64%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P+ ++ S+T                +R  L C+NC    T+LWRRNN+GEPVCNACGLYYKLH   RPL+MRK+GIQT
Sbjct:  114 GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKRLVSATAT--------------RRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQT 220          
BLAST of GATA456 vs. Ensembl Zebrafish
Match: gata6 (GATA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-000622-1])

HSP 1 Score: 130.183 bits (326), Expect = 4.196e-32
Identity = 67/139 (48.20%), Postives = 86/139 (61.87%), Query Frame = 1
Query:  985 PINEFGSNCDV------SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            P+   G N D+      SRECVNCG+ +T LW RD +G++LC+ C  +S+ N  SR L K P  ++SSS                 +R  L C+NC+ + T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  182 PLAIRGPNGDLLEEMVESRECVNCGSMSTPLWRRDGTGHFLCNACGLYSKMNGLSRPLIK-PQKRMSSS-----------------RRIGLSCANCQTSTTTLWRRNAEGEPVCNACGLYTKLHGVPRPLAMKKEGIQT 302          
BLAST of GATA456 vs. Ensembl Zebrafish
Match: gata6 (GATA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-000622-1])

HSP 1 Score: 129.413 bits (324), Expect = 6.887e-32
Identity = 67/139 (48.20%), Postives = 86/139 (61.87%), Query Frame = 1
Query:  985 PINEFGSNCDV------SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            P+   G N D+      SRECVNCG+ +T LW RD +G++LC+ C  +S+ N  SR L K P  ++SSS                 +R  L C+NC+ + T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  163 PLAIRGPNGDLLEEMVESRECVNCGSMSTPLWRRDGTGHFLCNACGLYSKMNGLSRPLIK-PQKRMSSS-----------------RRIGLSCANCQTSTTTLWRRNAEGEPVCNACGLYTKLHGVPRPLAMKKEGIQT 283          
BLAST of GATA456 vs. Ensembl Zebrafish
Match: gata2a (GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-980526-260])

HSP 1 Score: 129.798 bits (325), Expect = 1.186e-31
Identity = 70/176 (39.77%), Postives = 95/176 (53.98%), Query Frame = 1
Query:  865 PTYPIQNLPD----STINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            PTYP  +LP         +     +  S   F P  CKS            +C   RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  223 PTYPTYSLPAPHDYGGGLFHPGTLLSGSASSFTP-KCKSKTR---------SCSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 371          
BLAST of GATA456 vs. Ensembl Zebrafish
Match: gata2a (GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-980526-260])

HSP 1 Score: 129.798 bits (325), Expect = 1.186e-31
Identity = 70/176 (39.77%), Postives = 95/176 (53.98%), Query Frame = 1
Query:  865 PTYPIQNLPD----STINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            PTYP  +LP         +     +  S   F P  CKS            +C   RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  223 PTYPTYSLPAPHDYGGGLFHPGTLLSGSASSFTP-KCKSKTR---------SCSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 371          
BLAST of GATA456 vs. Ensembl Zebrafish
Match: gata6 (GATA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-000622-1])

HSP 1 Score: 130.183 bits (326), Expect = 1.379e-31
Identity = 67/139 (48.20%), Postives = 86/139 (61.87%), Query Frame = 1
Query:  985 PINEFGSNCDV------SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            P+   G N D+      SRECVNCG+ +T LW RD +G++LC+ C  +S+ N  SR L K P  ++SSS                 +R  L C+NC+ + T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  277 PLAIRGPNGDLLEEMVESRECVNCGSMSTPLWRRDGTGHFLCNACGLYSKMNGLSRPLIK-PQKRMSSS-----------------RRIGLSCANCQTSTTTLWRRNAEGEPVCNACGLYTKLHGVPRPLAMKKEGIQT 397          
BLAST of GATA456 vs. Ensembl Xenopus
Match: gata6 (GATA binding protein 6 [Source:Xenbase;Acc:XB-GENE-485063])

HSP 1 Score: 134.806 bits (338), Expect = 2.135e-33
Identity = 71/139 (51.08%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  985 PINEFGSNCDV------SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            PIN  G+  DV      SRECVNCG+  T LW RD +G+YLC+ C  +S+ N  SR L K P  +V SS                 +R  L C+NC  T T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  296 PINVRGAPGDVLDELPESRECVNCGSVQTPLWRRDGTGHYLCNACGLYSKMNGLSRPLIK-PQKRVPSS-----------------RRIGLACANCHTTTTTLWRRNTEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT 416          
BLAST of GATA456 vs. Ensembl Xenopus
Match: gata4 (GATA binding protein 4 [Source:Xenbase;Acc:XB-GENE-487458])

HSP 1 Score: 131.339 bits (329), Expect = 7.890e-33
Identity = 62/129 (48.06%), Postives = 78/129 (60.47%), Query Frame = 1
Query:  994 EFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            EF  +    RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC  T T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  175 EFFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT 286          
BLAST of GATA456 vs. Ensembl Xenopus
Match: gata2 (GATA binding protein 2 [Source:Xenbase;Acc:XB-GENE-478165])

HSP 1 Score: 128.642 bits (322), Expect = 1.526e-31
Identity = 58/125 (46.40%), Postives = 79/125 (63.20%), Query Frame = 1
Query: 1006 NCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            +C   RECVNCGA+ T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  259 SCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 366          
BLAST of GATA456 vs. Ensembl Xenopus
Match: gata3 (GATA binding protein 3 [Source:Xenbase;Acc:XB-GENE-485930])

HSP 1 Score: 127.872 bits (320), Expect = 1.974e-31
Identity = 57/121 (47.11%), Postives = 78/121 (64.46%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  254 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 357          
BLAST of GATA456 vs. Ensembl Xenopus
Match: gata5 (GATA binding protein 5 [Source:Xenbase;Acc:XB-GENE-484906])

HSP 1 Score: 122.865 bits (307), Expect = 3.514e-31
Identity = 82/208 (39.42%), Postives = 114/208 (54.81%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQ-PFNHILNSSQYQFQSTENPINQSY 1635
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++SSS                 +R+ L C+NC  + T+LWRRN+EGEPVCNACGLY KLH   RPL+M+KE IQTR      + KP      N  K  +S  S+      ++V +S+    + +E      PNI+ Q P   I+  SQ Q Q T++ +N S+
Sbjct:   11 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQKRLSSS-----------------RRAGLCCTNCHTSTTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTR------KRKP-----KNVSKGKTSTGSTSATNSPSSVTNSDPTPVLKTE------PNIASQYPGQAIVAVSQGQSQ-TDDLVNGSH 183          
BLAST of GATA456 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 128.642 bits (322), Expect = 8.719e-33
Identity = 61/121 (50.41%), Postives = 76/121 (62.81%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQT
Sbjct:    8 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 111          
BLAST of GATA456 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 132.109 bits (331), Expect = 1.668e-32
Identity = 61/121 (50.41%), Postives = 76/121 (62.81%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQT
Sbjct:  214 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 317          
BLAST of GATA456 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 132.109 bits (331), Expect = 1.730e-32
Identity = 61/121 (50.41%), Postives = 76/121 (62.81%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQT
Sbjct:  213 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 316          
BLAST of GATA456 vs. Ensembl Mouse
Match: Gata3 (GATA binding protein 3 [Source:MGI Symbol;Acc:MGI:95663])

HSP 1 Score: 129.028 bits (323), Expect = 1.661e-31
Identity = 69/172 (40.12%), Postives = 95/172 (55.23%), Query Frame = 1
Query:  871 YPIQNLPDSTINWTTNNQIPSSNLVFDP--WSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            +PI   P     +++    PSS L   P  + CKS        E        RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  216 HPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTE-------GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 363          
BLAST of GATA456 vs. Ensembl Mouse
Match: Gata6 (GATA binding protein 6 [Source:MGI Symbol;Acc:MGI:107516])

HSP 1 Score: 130.183 bits (326), Expect = 2.990e-31
Identity = 65/122 (53.28%), Postives = 77/122 (63.11%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            SRECVNCG+  T LW RD +G+YLC+ C  +S+ N  SR L K P  +V SS                 +R  L C+NC  T T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  381 SRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKMNGLSRPLIK-PQKRVPSS-----------------RRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT 484          
BLAST of GATA456 vs. UniProt
Match: sp|Q91677|GATA4_XENLA (Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.580e-32
Identity = 88/255 (34.51%), Postives = 130/255 (50.98%), Query Frame = 1
Query:  871 YPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXX--TQMKPVSTHIANNQKVPSSESSSEQNQFINTVK---------------SSENCYNMISENSPTY--MPNISVQPFNH 1575
            YP    PD    WT +   P  + +      ++  +  P  EF  +    RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC  T T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQTRKRK K  ++ K ++    ++   PS+ S++   + +  +K               S  +  + I+ +  +Y  MP++ + P NH
Sbjct:  135 YPAYMSPDMGAAWTAS---PFDSSMLHNLQNRAVTSRHPNIEFFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNLSKSKTLTGQSGSDSLTPSTSSTNSMGEEMRPIKIEPGLSPPYDHSNSISQASALSTITSHGSSYYPMPSLKLSPQNH 369          
BLAST of GATA456 vs. UniProt
Match: sp|P70005|GAT6B_XENLA (GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.000e-32
Identity = 70/139 (50.36%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  985 PINEFGSNCDV------SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            PI+  G+  DV      SRECVNCG+  T LW RD +G+YLC+ C  +S+ N  SR L K P  +V SS                 +R  L C+NC  T T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  162 PISVRGAPGDVLDELPESRECVNCGSVQTPLWRRDGTGHYLCNACGLYSKMNGLSRPLIK-PQKRVPSS-----------------RRIGLACANCHTTTTTLWRRNTEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT 282          
BLAST of GATA456 vs. UniProt
Match: sp|P43694|GATA4_HUMAN (Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 3.485e-32
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P++ S SE
Sbjct:  214 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAAPSGSE 338          
BLAST of GATA456 vs. UniProt
Match: sp|P43691|GATA4_CHICK (Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 9.451e-32
Identity = 65/130 (50.00%), Postives = 79/130 (60.77%), Query Frame = 1
Query:  994 EFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNS--RNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            EF  +    RECVNCGA +T LW RD +G+YLC+ C  + + N   R L K P  ++S+S                 +R  L C+NC  T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQT
Sbjct:  146 EFFDDYSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLFK-PQRRLSAS-----------------RRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 257          
BLAST of GATA456 vs. UniProt
Match: sp|Q0Q0E4|GATA4_CANLF (Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.183e-31
Identity = 61/121 (50.41%), Postives = 76/121 (62.81%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQT
Sbjct:  214 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 317          
BLAST of GATA456 vs. TrEMBL
Match: tr|H8YS98|H8YS98_SCHMD (GATA456 OS=Schmidtea mediterranea GN=gata456 PE=2 SV=1)

HSP 1 Score: 1023.46 bits (2645), Expect = 0.000e+0
Identity = 513/513 (100.00%), Postives = 513/513 (100.00%), Query Frame = 1
Query:  250 MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV 1788
            MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTRKRKRKTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV
Sbjct:    1 MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTRKRKRKTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV 513          
BLAST of GATA456 vs. TrEMBL
Match: tr|F1CDE4|F1CDE4_SCHPL (GATA456a OS=Schmidtea polychroa PE=2 SV=1)

HSP 1 Score: 934.48 bits (2414), Expect = 0.000e+0
Identity = 479/513 (93.37%), Postives = 490/513 (95.52%), Query Frame = 1
Query:  250 MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV 1788
            MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLN FPYLAQSNLTDCTTDI+GDLKNPNS +       F  F K  + NIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVK TAGGF  ESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPES SFYNTAWNNYPFQISP YPIQNLPDSTINWTTN+QIP+SNLVF+PWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDN+GYYLCDECDRFSQNNSRN+EKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTR+RKRKTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFN ILNS+QYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEP LSMDNE KPYSSIN+KIDV
Sbjct:    1 MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNPFPYLAQSNLTDCTTDITGDLKNPNSQITMETEYRFLNFPKCLKNNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKPTAGGFNAESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESTSFYNTAWNNYPFQISPNYPIQNLPDSTINWTTNSQIPNSNLVFEPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNTGYYLCDECDRFSQNNSRNIEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTRRRKRKTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNRILNSNQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEP-LSMDNEQKPYSSINDKIDV 512          
BLAST of GATA456 vs. TrEMBL
Match: tr|A0A0P4VRZ8|A0A0P4VRZ8_9EUCA (Uncharacterized protein OS=Scylla olivacea PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.082e-32
Identity = 68/131 (51.91%), Postives = 84/131 (64.12%), Query Frame = 1
Query:  985 PINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            P +EF   C  SRECVNCGA  T LW RD +G+YLC+ C  +++ N  N   +  ++   S E+ F      +FQ   +R  L CSNC  T T+LWRRNNEGEPVCNACGLYYKLH   RPL MRK+ IQ+
Sbjct:  126 PGSEF---CSESRECVNCGAVQTPLWRRDATGHYLCNACGLYTKMNGINRPLIKHSRRLVSVEDGF------SFQTSARRMGLMCSNCGTTTTTLWRRNNEGEPVCNACGLYYKLHGVNRPLQMRKDSIQS 247          
BLAST of GATA456 vs. TrEMBL
Match: tr|T1JB54|T1JB54_STRMM (Uncharacterized protein OS=Strigamia maritima PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.750e-31
Identity = 88/243 (36.21%), Postives = 128/243 (52.67%), Query Frame = 1
Query:  877 IQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSN------CDV---SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNS--RNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSS--ENCYNMISENSPTYMPNISVQP 1566
            +Q  P  T+     NQ   +N+++D  +      L      G         D+    RECVNCGA +T LW RD +G+YLC+ C  + + N   R L++ P  ++   T+N  +  SN       +R  L C+NC+ T T+LWRRNN+GEPVCNACGLY+KLH   RP++M+K+GIQTRKRK K+     ST     + +P        N+    + SS   + Y +  E S  Y P+++  P
Sbjct:  255 LQTYPTYTVRAEAANQWAGANMLYDNSASAMTHGLHAPELMGRRLTPEEEVDLYAEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGTNRPLQR-PIKRMPCVTQNGGVGGSN-------RRMGLSCANCQTTNTTLWRRNNQGEPVCNACGLYFKLHNVNRPMAMKKDGIQTRKRKPKSASVSSSTADTKPKIIPKHSYEKASNRGSPNISSSMYHHHYEIKQEPSTIYTPSVATIP 489          
BLAST of GATA456 vs. TrEMBL
Match: tr|W5UMM1|W5UMM1_ICTPU (GATA-binding factor 2 OS=Ictalurus punctatus GN=GATA2 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.005e-31
Identity = 73/179 (40.78%), Postives = 101/179 (56.42%), Query Frame = 1
Query:  844 NYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            ++P    PTYP+ +  D        N +  S+  F P  CKS       +EF   C   RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  220 HHPIPTYPTYPLPSAHDYGAGLFHPNLLSGSSSSFAP-KCKSKARS--SSEF---CTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 375          
The following BLAST results are available for this feature:
BLAST of GATA456 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
GATA43.923e-3346.36GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
GATA45.221e-3346.36GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
GATA46.663e-3346.36GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
GATA46.782e-3346.36GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
GATA42.623e-3246.36GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of GATA456 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
elt-14.027e-3151.24Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-17.538e-3151.24Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-17.607e-3151.24Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-18.870e-3150.41Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-11.664e-3050.41Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of GATA456 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
grn2.891e-3249.17grain [Source:FlyBase gene name;Acc:FBgn0001138][more]
grn3.109e-3245.19grain [Source:FlyBase gene name;Acc:FBgn0001138][more]
grn3.392e-3245.19grain [Source:FlyBase gene name;Acc:FBgn0001138][more]
pnr7.320e-3249.59pannier [Source:FlyBase gene name;Acc:FBgn0003117][more]
pnr7.320e-3249.59pannier [Source:FlyBase gene name;Acc:FBgn0003117][more]
back to top
BLAST of GATA456 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
gata64.196e-3248.20GATA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
gata66.887e-3248.20GATA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
gata2a1.186e-3139.77GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata2a1.186e-3139.77GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata61.379e-3148.20GATA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of GATA456 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
gata62.135e-3351.08GATA binding protein 6 [Source:Xenbase;Acc:XB-GENE... [more]
gata47.890e-3348.06GATA binding protein 4 [Source:Xenbase;Acc:XB-GENE... [more]
gata21.526e-3146.40GATA binding protein 2 [Source:Xenbase;Acc:XB-GENE... [more]
gata31.974e-3147.11GATA binding protein 3 [Source:Xenbase;Acc:XB-GENE... [more]
gata53.514e-3139.42GATA binding protein 5 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of GATA456 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Gata48.719e-3350.41GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Gata41.668e-3250.41GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Gata41.730e-3250.41GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Gata31.661e-3140.12GATA binding protein 3 [Source:MGI Symbol;Acc:MGI:... [more]
Gata62.990e-3153.28GATA binding protein 6 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of GATA456 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91677|GATA4_XENLA1.580e-3234.51Transcription factor GATA-4 OS=Xenopus laevis GN=g... [more]
sp|P70005|GAT6B_XENLA2.000e-3250.36GATA-binding factor 6-B OS=Xenopus laevis GN=gata6... [more]
sp|P43694|GATA4_HUMAN3.485e-3246.36Transcription factor GATA-4 OS=Homo sapiens GN=GAT... [more]
sp|P43691|GATA4_CHICK9.451e-3250.00Transcription factor GATA-4 (Fragment) OS=Gallus g... [more]
sp|Q0Q0E4|GATA4_CANLF1.183e-3150.41Transcription factor GATA-4 OS=Canis lupus familia... [more]
back to top
BLAST of GATA456 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|H8YS98|H8YS98_SCHMD0.000e+0100.00GATA456 OS=Schmidtea mediterranea GN=gata456 PE=2 ... [more]
tr|F1CDE4|F1CDE4_SCHPL0.000e+093.37GATA456a OS=Schmidtea polychroa PE=2 SV=1[more]
tr|A0A0P4VRZ8|A0A0P4VRZ8_9EUCA1.082e-3251.91Uncharacterized protein OS=Scylla olivacea PE=4 SV... [more]
tr|T1JB54|T1JB54_STRMM3.750e-3136.21Uncharacterized protein OS=Strigamia maritima PE=4... [more]
tr|W5UMM1|W5UMM1_ICTPU4.005e-3140.78GATA-binding factor 2 OS=Ictalurus punctatus GN=GA... [more]
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000005Stage 5
PLANA:0000006Stage 6
PLANA:0000007Stage 7
PLANA:0000002Stage 2
PLANA:0000008Stage 8
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000049digestive system
PLANA:0000058embryonic digestive system
PLANA:0000026definitive gut
PLANA:0000039gamma neoblast
PLANA:0000023temporary embryonic pharynx
Vocabulary: cellular component
TermDefinition
GO:0090575RNA polymerase II transcription factor complex
GO:0016604nuclear body
GO:0005667transcription factor complex
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0086004regulation of cardiac muscle cell contraction
GO:0071333cellular response to glucose stimulus
GO:0061049cell growth involved in cardiac muscle cell development
GO:0060575intestinal epithelial cell differentiation
GO:0060413atrial septum morphogenesis
GO:0060290transdifferentiation
GO:0055007cardiac muscle cell differentiation
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0045893positive regulation of transcription, DNA-templated
GO:0042493response to drug
GO:0033189response to vitamin A
GO:0030513positive regulation of BMP signaling pathway
GO:0010507negative regulation of autophagy
GO:0009612response to mechanical stimulus
GO:0008584male gonad development
GO:0007507heart development
GO:0006366transcription from RNA polymerase II promoter
GO:0006351transcription, DNA-templated
GO:0003290atrial septum secundum morphogenesis
GO:0003197endocardial cushion development
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0070410co-SMAD binding
GO:0051525NFAT protein binding
GO:0046872metal ion binding
GO:0044212transcription regulatory region DNA binding
GO:0033613activating transcription factor binding
GO:0019901protein kinase binding
GO:0008134transcription factor binding
GO:0003713transcription coactivator activity
GO:0003682chromatin binding
GO:0003677DNA binding
GO:0001228transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0001158enhancer sequence-specific DNA binding
GO:0001085RNA polymerase II transcription factor binding
GO:0001076transcription factor activity, RNA polymerase II transcription factor binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0008270zinc ion binding
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR000679Znf_GATA
IPR013088Znf_NHR/GATA
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007290 ID=SMED30007290|Name=GATA456|organism=Schmidtea mediterranea sexual|type=transcript|length=2033bp
AGGTAAGTGTCGTCATCACAAGTGGCTTTATTATTATCATTTAAATTTTT
TATCATATTATCATTGATTGCTTGTTTTCCTCATTCAAAATTTAACTGAT
TGTTATCAAGCTCATTTGATAACTCCAAATCTAATTGACACTCATGTAAA
TATCCCATTCGAATTTCCGTTCCCGTCCGTAAGATCCACGATCCGACAAT
GTTTCTCCCATCGGTATTGTCGAATTCTCACCAGAGAAACTCACCAATAA
TGGACATTGTATCACCAAAATCCAACACCAGCAATCTGAATGCGTTGATC
ACGTATTCGAATTGTCCCAACATAGATCTACAGTCGAATGATCTGTCAGT
GAACTTGACGAATTCTCAAAACTTCCACGAATTGGATCACAAAACCAATT
ACGGATACAAAGTTTCAAACAACGAGACAAAACTGAATGCTTTTCCATAT
TTAGCTCAATCGAACTTAACAGATTGCACAACAGACATCAGTGGAGATCT
GAAAAATCCAAATTCACATCTCAACTATGGAAACGGAATTTCGTTCTCGG
AATTTTCGAAAATGTCCGAAACCAACATCCACGGATATCCGCCATATTGT
TTCTCCACTAAACTGTTTCCCATTCCAAATCTACAAGAGAAATCAATTAT
CAACGACAACTATTCCGTGAAATCCACCGCCGGAGGCTTTATCACCGAAT
CGAATGAGCATCAAAACTCTGTAAATACTGGAAATTCCTACAATTCCAAT
TTAAGCTCATACAGAACGGTAATTCCCGCTCATTTTCATCTCTTCAATCA
GAATTCACCAGAATCGAACTCGTTTTACAATACGGCTTGGAACAACTATC
CGTTTCAAATATCCCCAACTTATCCCATACAAAATCTACCGGATTCAACA
ATCAACTGGACAACAAACAATCAAATTCCAAGCAGCAATTTAGTTTTTGA
TCCCTGGAGCTGTAAATCAAATCTTAATCTTCCTCCGATTAATGAATTCG
GTTCCAATTGCGATGTCAGCAGAGAGTGTGTGAACTGTGGAGCTAGCAAT
ACTCAGTTGTGGTCCCGGGATAATTCTGGCTATTATTTGTGTGATGAATG
CGACAGGTTCTCTCAAAACAACAGTAGAAACCTCGAAAAACTACCAACGA
ATCAAGTCTCATCAAGTACCGAAAATGAGTTCATGAAAAAATCCAATGCC
AACTTTCAACAATATGGAAAAAGATCCGACCTCGAATGCAGCAATTGTAA
AATTACCAAGACTTCTTTATGGAGAAGAAACAACGAAGGAGAACCTGTCT
GCAATGCTTGCGGCTTGTATTATAAATTACATAAGTCTCTAAGACCTCTT
TCAATGAGGAAAGAAGGAATACAAACAAGGAAAAGAAAACGGAAAACACA
AATGAAACCGGTTTCCACTCATATTGCCAATAATCAAAAGGTGCCGTCTT
CAGAATCGTCATCAGAACAAAATCAGTTTATAAACACTGTGAAATCAAGT
GAAAATTGCTATAACATGATTTCTGAAAATTCTCCAACATATATGCCAAA
TATATCAGTCCAGCCCTTCAATCACATTCTGAACTCCAGCCAATATCAAT
TCCAATCTACAGAAAATCCCATTAATCAATCATATTTAAATTCCTCAATC
AAAAACAGCAATCCCTTTTACGATTCCGAAAGTATACTTTATTCCTACAA
CAATTCAAACAAAATCAAAGATGAGCCCCTATTATCCATGGACAACGAAC
CGAAGCCCTATTCCTCAATCAACGAGAAAATTGACGTCAACTCCATAGTG
AGAATTAATGAAATCTCAAACAATTCGAATTCGAGTTAATTATTCTGATC
TACTTTTTAATTATATATTTAAGAACCGTATATACTTCGAAATATAATTT
TAATGATAAAATTTTATATCTAAAAAATGTAATTTTTAAGTGCGAATTAT
TAAGTATGCATTTAAATAGTGCAATTATTGTGGTAGTTATTTTTATTACT
AAATAAATGTTGTTTGTAAATTCGAGAATTTGT
back to top

protein sequence of SMED30007290-orf-1

>SMED30007290-orf-1 ID=SMED30007290-orf-1|Name=SMED30007290-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=547bp
MFLPSVLSNSHQRNSPIMDIVSPKSNTSNLNALITYSNCPNIDLQSNDLS
VNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGD
LKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSI
INDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFN
QNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVF
DPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDE
CDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNC
KITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTRKRKRKT
QMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMP
NISVQPFNHILNSSQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSY
NNSNKIKDEPLLSMDNEPKPYSSINEKIDVNSIVRINEISNNSNSS*
back to top
Aliases
The feature 'GATA456' has the following synonyms
Synonym
gata456a
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007290
GenBankAFF18488.1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.609
NoneNo IPR availableTMHMMTMhelixcoord: 13..32
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 5..22
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 291..328
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 359..418
NoneNo IPR availableTMHMMTMhelixcoord: 7..25
NoneNo IPR availableTMHMMTMhelixcoord: 40..62
NoneNo IPR availableTMHMMTMhelixcoord: 24..46
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
IPR027417P-loop containing nucleoside triphosphate hydrolaseGENE3DG3DSA:3.40.50.300coord: 21..52
e-value: 9.9E-4
score: 17.8
IPR000679Zinc finger, GATA-typePRINTSPR00619GATAZNFINGERcoord: 381..398
score: 57.38
coord: 363..380
score: 51.48
IPR000679Zinc finger, GATA-typeSMARTSM00401GATA_3coord: 361..411
e-value: 4.2E-22
score: 89.4
IPR000679Zinc finger, GATA-typePFAMPF00320GATAcoord: 367..400
e-value: 4.5E-14
score: 51.6
IPR000679Zinc finger, GATA-typePROSITEPS00344GATA_ZN_FINGER_1coord: 367..391
IPR000679Zinc finger, GATA-typePROSITEPS50114GATA_ZN_FINGER_2coord: 361..414
score: 26.297
IPR000679Zinc finger, GATA-typePROSITEPS50114GATA_ZN_FINGER_2coord: 291..331
score: 14.022
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 292..331
e-value: 1.1E-8
score: 33.9
coord: 361..419
e-value: 1.5E-25
score: 88.0