GATA456

Overview
NameGATA456 (AFF18488.1)
Smed IDSMED30007290
Uniprot Best hitTranscription factor GATA-4 OS=Xenopus laevis OX=8355 GN=gata4 PE=2 SV=1 (E=9.63321e-33)
Length (bp)2033
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GATA456 (SMED30007290) t-SNE clustered cells

Violin plots show distribution of expression levels for GATA456 (SMED30007290) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GATA456 (SMED30007290) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GATA456 (SMED30007290) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: dLnsaIW6

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Definitive gut progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and gata456a (green). Definitive gut progenitors, coexpressing piwi-1 and gata456a, are dispersed in the embryonic wall. As definitive gut progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of gata456a. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

Anatomical Expression

PAGE et. al., 2020




SMED30007290

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 30

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 dd_Smed_v4_4075_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
neuronSMED30007290SMESG000039559.1 SMESG000037031.1 dd_Smed_v4_4075_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
neoblastSMED30007290SMESG000039559.1 SMESG000037031.1 dd_Smed_v4_4075_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
gastrodermal cellSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198.1smed_ncbi_20200123PMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198.1smed_ncbi_20200123PMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198.1smed_ncbi_20200123PMID:25254346whole organismasexual adultcolorimetric in situ hybridization evidence
embryonic pharynxSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198.1smed_ncbi_20200123PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
gamma neoblastSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198.1smed_ncbi_20200123PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 SMED30007290smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 SMED30007290smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
gamma neoblastSMED30007290SMESG000039559.1 SMESG000037031.1 SMED30007290smed_20140614PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
embryonic pharynxSMED30007290SMESG000039559.1 SMESG000037031.1 SMED30007290smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 SMED30007290smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 SMED30007290smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
gamma neoblastSMED30007290SMESG000039559.1 SMESG000037031.1 SMED30007290smed_20140614PMID:29906446FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
gastrodermal cellSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198smed_ncbi_20200123PMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198smed_ncbi_20200123PMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198smed_ncbi_20200123PMID:27542689whole organismasexual adultcolorimetric in situ hybridization evidence
gamma neoblastSMED30007290SMESG000039559.1 SMESG000037031.1 JF802198smed_ncbi_20200123PMID:25017721FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
gamma neoblastSMED30007290SMESG000039559.1 SMESG000037031.1 dd_Smed_v6_4075_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 AFF18488.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 AFF18488.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 AFF18488.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
gamma neoblastSMED30007290SMESG000039559.1 SMESG000037031.1 AFF18488.1smed_ncbi_20200123PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
gutSMED30007290SMESG000039559.1 SMESG000037031.1 AFF18488.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
embryonic pharynxSMED30007290SMESG000039559.1 SMESG000037031.1 AFF18488.1smed_ncbi_20200123PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
Homology
BLAST of GATA456 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 130.183 bits (326), Expect = 1.393e-33
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P++ S SE
Sbjct:    8 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAAPSGSE 132          
BLAST of GATA456 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 130.183 bits (326), Expect = 1.393e-33
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P++ S SE
Sbjct:    8 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAAPSGSE 132          
BLAST of GATA456 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 128.257 bits (321), Expect = 1.528e-33
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P++ S SE
Sbjct:    8 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAAPSGSE 132          
BLAST of GATA456 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 128.257 bits (321), Expect = 1.528e-33
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P++ S SE
Sbjct:    8 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAAPSGSE 132          
BLAST of GATA456 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 134.035 bits (336), Expect = 5.522e-33
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P++ S SE
Sbjct:  215 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAAPSGSE 339          
BLAST of GATA456 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 127.102 bits (318), Expect = 3.074e-31
Identity = 62/121 (51.24%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCG  NT LW RD SG YLC+ C  + + N  +R L K               KK   N Q   KR+ +EC NC+   T+LWRRN EG PVCNACGLY+KLHK  RP++M+K+GIQT
Sbjct:  215 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKP--------------KKRQQNAQ---KRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 318          
BLAST of GATA456 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 125.946 bits (315), Expect = 6.811e-31
Identity = 61/121 (50.41%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCG  NT LW RD SG YLC+ C  + + N  +R L K               K+ NA      KR+ +EC NC+   T+LWRRN EG PVCNACGLY+KLHK  RP++M+K+GIQT
Sbjct:  215 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPK-------------KRQNAQ-----KRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 317          
BLAST of GATA456 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 127.102 bits (318), Expect = 7.712e-31
Identity = 62/121 (51.24%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCG  NT LW RD SG YLC+ C  + + N  +R L K               KK   N Q   KR+ +EC NC+   T+LWRRN EG PVCNACGLY+KLHK  RP++M+K+GIQT
Sbjct:  287 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKP--------------KKRQQNAQ---KRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 390          
BLAST of GATA456 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 127.102 bits (318), Expect = 7.766e-31
Identity = 62/121 (51.24%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCG  NT LW RD SG YLC+ C  + + N  +R L K               KK   N Q   KR+ +EC NC+   T+LWRRN EG PVCNACGLY+KLHK  RP++M+K+GIQT
Sbjct:  286 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKP--------------KKRQQNAQ---KRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 389          
BLAST of GATA456 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 125.946 bits (315), Expect = 1.709e-30
Identity = 61/121 (50.41%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCG  NT LW RD SG YLC+ C  + + N  +R L K               K+ NA      KR+ +EC NC+   T+LWRRN EG PVCNACGLY+KLHK  RP++M+K+GIQT
Sbjct:  287 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPK-------------KRQNAQ-----KRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 389          
BLAST of GATA456 vs. Ensembl Fly
Match: grn (gene:FBgn0001138 transcript:FBtr0081808)

HSP 1 Score: 131.724 bits (330), Expect = 2.646e-32
Identity = 59/120 (49.17%), Postives = 77/120 (64.17%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA++T LW RD +G+YLC+ C  + + N +N   +   +          + +  + Q   KR+   C+NCK T T+LWRRN  GEPVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  258 GRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKR----------RLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 367          
BLAST of GATA456 vs. Ensembl Fly
Match: grn (gene:FBgn0001138 transcript:FBtr0300040)

HSP 1 Score: 134.035 bits (336), Expect = 2.671e-32
Identity = 61/135 (45.19%), Postives = 82/135 (60.74%), Query Frame = 1
Query:  973 LNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            L++ P+          RECVNCGA++T LW RD +G+YLC+ C  + + N +N   +   +          + +  + Q   KR+   C+NCK T T+LWRRN  GEPVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  456 LDVKPVRTKPRTSAEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKR----------RLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 580          
BLAST of GATA456 vs. Ensembl Fly
Match: grn (gene:FBgn0001138 transcript:FBtr0330188)

HSP 1 Score: 133.65 bits (335), Expect = 2.917e-32
Identity = 61/135 (45.19%), Postives = 82/135 (60.74%), Query Frame = 1
Query:  973 LNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            L++ P+          RECVNCGA++T LW RD +G+YLC+ C  + + N +N   +   +          + +  + Q   KR+   C+NCK T T+LWRRN  GEPVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  456 LDVKPVRTKPRTSAEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKR----------RLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 580          
BLAST of GATA456 vs. Ensembl Fly
Match: pnr (gene:FBgn0003117 transcript:FBtr0335427)

HSP 1 Score: 130.568 bits (327), Expect = 6.771e-32
Identity = 60/121 (49.59%), Postives = 77/121 (63.64%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P+ ++ S+T                +R  L C+NC    T+LWRRNN+GEPVCNACGLYYKLH   RPL+MRK+GIQT
Sbjct:  114 GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKRLVSATAT--------------RRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQT 220          
BLAST of GATA456 vs. Ensembl Fly
Match: pnr (gene:FBgn0003117 transcript:FBtr0083220)

HSP 1 Score: 130.568 bits (327), Expect = 6.771e-32
Identity = 60/121 (49.59%), Postives = 77/121 (63.64%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P+ ++ S+T                +R  L C+NC    T+LWRRNN+GEPVCNACGLYYKLH   RPL+MRK+GIQT
Sbjct:  114 GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKRLVSATAT--------------RRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQT 220          
BLAST of GATA456 vs. Ensembl Zebrafish
Match: gata6 (GATA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-000622-1])

HSP 1 Score: 130.183 bits (326), Expect = 3.126e-32
Identity = 67/139 (48.20%), Postives = 86/139 (61.87%), Query Frame = 1
Query:  985 PINEFGSNCDV------SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            P+   G N D+      SRECVNCG+ +T LW RD +G++LC+ C  +S+ N  SR L K P  ++SSS                 +R  L C+NC+ + T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  182 PLAIRGPNGDLLEEMVESRECVNCGSMSTPLWRRDGTGHFLCNACGLYSKMNGLSRPLIK-PQKRMSSS-----------------RRIGLSCANCQTSTTTLWRRNAEGEPVCNACGLYTKLHGVPRPLAMKKEGIQT 302          
BLAST of GATA456 vs. Ensembl Zebrafish
Match: gata2a (GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-980526-260])

HSP 1 Score: 130.183 bits (326), Expect = 7.574e-32
Identity = 72/176 (40.91%), Postives = 97/176 (55.11%), Query Frame = 1
Query:  865 PTYPIQNLPD----STINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            PTYP  +LP         +     +  S   F P  CKS       +EF   C   RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  223 PTYPTYSLPAPHDYGGGLFHPGTLLSGSASSFTP-KCKSKTRS--CSEF---CTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 375          
BLAST of GATA456 vs. Ensembl Zebrafish
Match: gata4 (GATA binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-980526-476])

HSP 1 Score: 127.487 bits (319), Expect = 1.116e-31
Identity = 64/130 (49.23%), Postives = 80/130 (61.54%), Query Frame = 1
Query:  994 EFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNS--RNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            EF  +    RECVNCGA +T LW RD +G+YLC+ C  + + N   R L K P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  159 EFFDDLGEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLVK-PQRRLSAS-----------------RRVGLSCTNCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT 270          
BLAST of GATA456 vs. Ensembl Zebrafish
Match: gata2a (GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-980526-260])

HSP 1 Score: 129.798 bits (325), Expect = 1.158e-31
Identity = 70/176 (39.77%), Postives = 95/176 (53.98%), Query Frame = 1
Query:  865 PTYPIQNLPD----STINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            PTYP  +LP         +     +  S   F P  CKS            +C   RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  223 PTYPTYSLPAPHDYGGGLFHPGTLLSGSASSFTP-KCKSKTR---------SCSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 371          
BLAST of GATA456 vs. Ensembl Zebrafish
Match: gata6 (GATA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-000622-1])

HSP 1 Score: 130.183 bits (326), Expect = 1.548e-31
Identity = 67/139 (48.20%), Postives = 86/139 (61.87%), Query Frame = 1
Query:  985 PINEFGSNCDV------SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            P+   G N D+      SRECVNCG+ +T LW RD +G++LC+ C  +S+ N  SR L K P  ++SSS                 +R  L C+NC+ + T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  277 PLAIRGPNGDLLEEMVESRECVNCGSMSTPLWRRDGTGHFLCNACGLYSKMNGLSRPLIK-PQKRMSSS-----------------RRIGLSCANCQTSTTTLWRRNAEGEPVCNACGLYTKLHGVPRPLAMKKEGIQT 397          
BLAST of GATA456 vs. Ensembl Xenopus
Match: gata6 (GATA binding protein 6 [Source:NCBI gene;Acc:395062])

HSP 1 Score: 134.806 bits (338), Expect = 6.588e-33
Identity = 71/139 (51.08%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  985 PINEFGSNCDV------SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            PIN  G+  DV      SRECVNCG+  T LW RD +G+YLC+ C  +S+ N  SR L K P  +V SS                 +R  L C+NC  T T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  296 PINVRGAPGDVLDELPESRECVNCGSVQTPLWRRDGTGHYLCNACGLYSKMNGLSRPLIK-PQKRVPSS-----------------RRIGLACANCHTTTTTLWRRNTEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT 416          
BLAST of GATA456 vs. Ensembl Xenopus
Match: mcm4 (minichromosome maintenance complex component 4 [Source:Xenbase;Acc:XB-GENE-1011481])

HSP 1 Score: 131.339 bits (329), Expect = 1.497e-32
Identity = 62/129 (48.06%), Postives = 78/129 (60.47%), Query Frame = 1
Query:  994 EFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            EF  +    RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC  T T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  175 EFFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT 286          
BLAST of GATA456 vs. Ensembl Xenopus
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:448391])

HSP 1 Score: 127.872 bits (320), Expect = 4.752e-31
Identity = 57/121 (47.11%), Postives = 78/121 (64.46%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  254 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 357          
BLAST of GATA456 vs. Ensembl Xenopus
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:448391])

HSP 1 Score: 128.257 bits (321), Expect = 5.183e-31
Identity = 57/121 (47.11%), Postives = 78/121 (64.46%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  254 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 357          
BLAST of GATA456 vs. Ensembl Xenopus
Match: gata5 (GATA binding protein 5 [Source:NCBI gene;Acc:496852])

HSP 1 Score: 125.561 bits (314), Expect = 1.459e-30
Identity = 82/208 (39.42%), Postives = 114/208 (54.81%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQ-PFNHILNSSQYQFQSTENPINQSY 1635
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++SSS                 +R+ L C+NC  + T+LWRRN+EGEPVCNACGLY KLH   RPL+M+KE IQTR      + KP      N  K  +S  S+      ++V +S+    + +E      PNI+ Q P   I+  SQ Q Q T++ +N S+
Sbjct:  181 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQKRLSSS-----------------RRAGLCCTNCHTSTTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTR------KRKP-----KNVSKGKTSTGSTSATNSPSSVTNSDPTPVLKTE------PNIASQYPGQAIVAVSQGQSQ-TDDLVNGSH 353          

HSP 2 Score: 53.5286 bits (127), Expect = 8.162e-7
Identity = 26/70 (37.14%), Postives = 37/70 (52.86%), Query Frame = 1
Query: 1186 KKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPL--------SMRKEGI 1371
            ++S+  F +       EC NC    T LWRR+  G  +CNACGLY+K++   RPL        S R+ G+
Sbjct:  167 RRSSLEFLEEFHGEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQKRLSSSRRAGL 236          
BLAST of GATA456 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 128.642 bits (322), Expect = 3.179e-33
Identity = 61/121 (50.41%), Postives = 76/121 (62.81%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQT
Sbjct:    8 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 111          
BLAST of GATA456 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 132.109 bits (331), Expect = 1.444e-32
Identity = 61/121 (50.41%), Postives = 76/121 (62.81%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQT
Sbjct:  214 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 317          
BLAST of GATA456 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 132.109 bits (331), Expect = 1.491e-32
Identity = 61/121 (50.41%), Postives = 76/121 (62.81%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQT
Sbjct:  213 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 316          
BLAST of GATA456 vs. Ensembl Mouse
Match: Gata3 (GATA binding protein 3 [Source:MGI Symbol;Acc:MGI:95663])

HSP 1 Score: 129.028 bits (323), Expect = 1.475e-31
Identity = 69/172 (40.12%), Postives = 95/172 (55.23%), Query Frame = 1
Query:  871 YPIQNLPDSTINWTTNNQIPSSNLVFDP--WSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            +PI   P     +++    PSS L   P  + CKS        E        RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  216 HPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTE-------GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 363          
BLAST of GATA456 vs. Ensembl Mouse
Match: Gata6 (GATA binding protein 6 [Source:MGI Symbol;Acc:MGI:107516])

HSP 1 Score: 130.183 bits (326), Expect = 3.143e-31
Identity = 65/122 (53.28%), Postives = 77/122 (63.11%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            SRECVNCG+  T LW RD +G+YLC+ C  +S+ N  SR L K P  +V SS                 +R  L C+NC  T T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  381 SRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKMNGLSRPLIK-PQKRVPSS-----------------RRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT 484          
BLAST of GATA456 vs. UniProt
Match: sp|Q91677|GATA4_XENLA (Transcription factor GATA-4 OS=Xenopus laevis OX=8355 GN=gata4 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 9.633e-33
Identity = 88/255 (34.51%), Postives = 130/255 (50.98%), Query Frame = 1
Query:  871 YPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXX--TQMKPVSTHIANNQKVPSSESSSEQNQFINTVK---------------SSENCYNMISENSPTY--MPNISVQPFNH 1575
            YP    PD    WT +   P  + +      ++  +  P  EF  +    RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC  T T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQTRKRK K  ++ K ++    ++   PS+ S++   + +  +K               S  +  + I+ +  +Y  MP++ + P NH
Sbjct:  135 YPAYMSPDMGAAWTAS---PFDSSMLHNLQNRAVTSRHPNIEFFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNLSKSKTLTGQSGSDSLTPSTSSTNSMGEEMRPIKIEPGLSPPYDHSNSISQASALSTITSHGSSYYPMPSLKLSPQNH 369          
BLAST of GATA456 vs. UniProt
Match: sp|P70005|GAT6B_XENLA (GATA-binding factor 6-B OS=Xenopus laevis OX=8355 GN=gata6-b PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.213e-32
Identity = 70/139 (50.36%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  985 PINEFGSNCDV------SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            PI+  G+  DV      SRECVNCG+  T LW RD +G+YLC+ C  +S+ N  SR L K P  +V SS                 +R  L C+NC  T T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  162 PISVRGAPGDVLDELPESRECVNCGSVQTPLWRRDGTGHYLCNACGLYSKMNGLSRPLIK-PQKRVPSS-----------------RRIGLACANCHTTTTTLWRRNTEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT 282          
BLAST of GATA456 vs. UniProt
Match: sp|P43694|GATA4_HUMAN (Transcription factor GATA-4 OS=Homo sapiens OX=9606 GN=GATA4 PE=1 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 2.687e-32
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P++ S SE
Sbjct:  214 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAAPSGSE 338          
BLAST of GATA456 vs. UniProt
Match: sp|P43691|GATA4_CHICK (Transcription factor GATA-4 (Fragment) OS=Gallus gallus OX=9031 GN=GATA4 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 5.457e-32
Identity = 65/130 (50.00%), Postives = 79/130 (60.77%), Query Frame = 1
Query:  994 EFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNS--RNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            EF  +    RECVNCGA +T LW RD +G+YLC+ C  + + N   R L K P  ++S+S                 +R  L C+NC  T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQT
Sbjct:  146 EFFDDYSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLFK-PQRRLSAS-----------------RRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 257          
BLAST of GATA456 vs. UniProt
Match: sp|Q0Q0E4|GATA4_CANLF (Transcription factor GATA-4 OS=Canis lupus familiaris OX=9615 GN=GATA4 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 9.190e-32
Identity = 61/121 (50.41%), Postives = 76/121 (62.81%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQT
Sbjct:  214 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 317          
BLAST of GATA456 vs. TrEMBL
Match: gnl|BL_ORD_ID|20343939 (tr|H8YS98|H8YS98_SCHMD GATA456 OS=Schmidtea mediterranea OX=79327 GN=gata456 PE=2 SV=1)

HSP 1 Score: 1023.46 bits (2645), Expect = 0.000e+0
Identity = 513/513 (100.00%), Postives = 513/513 (100.00%), Query Frame = 1
Query:  250 MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV 1788
            MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTRKRKRKTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV
Sbjct:    1 MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTRKRKRKTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV 513          
BLAST of GATA456 vs. TrEMBL
Match: gnl|BL_ORD_ID|20912142 (tr|F1CDE4|F1CDE4_SCHPL GATA456a OS=Schmidtea polychroa OX=50054 PE=2 SV=1)

HSP 1 Score: 934.48 bits (2414), Expect = 0.000e+0
Identity = 479/513 (93.37%), Postives = 490/513 (95.52%), Query Frame = 1
Query:  250 MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV 1788
            MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLN FPYLAQSNLTDCTTDI+GDLKNPNS +       F  F K  + NIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVK TAGGF  ESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPES SFYNTAWNNYPFQISP YPIQNLPDSTINWTTN+QIP+SNLVF+PWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDN+GYYLCDECDRFSQNNSRN+EKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTR+RKRKTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFN ILNS+QYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEP LSMDNE KPYSSIN+KIDV
Sbjct:    1 MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNPFPYLAQSNLTDCTTDITGDLKNPNSQITMETEYRFLNFPKCLKNNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKPTAGGFNAESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESTSFYNTAWNNYPFQISPNYPIQNLPDSTINWTTNSQIPNSNLVFEPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNTGYYLCDECDRFSQNNSRNIEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTRRRKRKTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNRILNSNQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEP-LSMDNEQKPYSSINDKIDV 512          
BLAST of GATA456 vs. TrEMBL
Match: gnl|BL_ORD_ID|21338844 (tr|A0A0P4VRZ8|A0A0P4VRZ8_9EUCA Uncharacterized protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.563e-32
Identity = 68/131 (51.91%), Postives = 84/131 (64.12%), Query Frame = 1
Query:  985 PINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            P +EF   C  SRECVNCGA  T LW RD +G+YLC+ C  +++ N  N   +  ++   S E+ F      +FQ   +R  L CSNC  T T+LWRRNNEGEPVCNACGLYYKLH   RPL MRK+ IQ+
Sbjct:  126 PGSEF---CSESRECVNCGAVQTPLWRRDATGHYLCNACGLYTKMNGINRPLIKHSRRLVSVEDGF------SFQTSARRMGLMCSNCGTTTTTLWRRNNEGEPVCNACGLYYKLHGVNRPLQMRKDSIQS 247          
BLAST of GATA456 vs. TrEMBL
Match: gnl|BL_ORD_ID|17003677 (tr|A0A1S3HKG8|A0A1S3HKG8_LINUN transcription factor GATA-4-like OS=Lingula unguis OX=7574 GN=LOC106156007 PE=4 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 6.933e-31
Identity = 85/199 (42.71%), Postives = 106/199 (53.27%), Query Frame = 1
Query:  991 NEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRN---------------LEKLPTNQVSSSTE-NEFMKKS--------NANFQQYGK--------RSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSEQNQFINTV 1491
            +E+       RECVNCGA  T LW RD +G+YLC+ C  + +  + N               L  LP+  ++ +T+    M  S          N Q Y K        R+ L C+NC  T T+LWRRNNEGEPVCNACGLYYKLH+  RP+SMRK+GIQTRKRK KT   P S    NN    SSE  + Q   + TV
Sbjct:  329 DEYAEYSTEPRECVNCGAIQTPLWRRDGTGHYLCNACGLYHKMRTVNNGLTSPMLKSSSPSQLHTLPSGYLTPTTQPGGVMPNSLPSTVDDMGQNSQAYNKGGGGGGSRRAGLSCANCSTTTTTLWRRNNEGEPVCNACGLYYKLHQVSRPISMRKDGIQTRKRKPKTLRSPKSPSTGNN----SSEMKAMQAASLPTV 523          
BLAST of GATA456 vs. TrEMBL
Match: gnl|BL_ORD_ID|26533877 (tr|W5Q0U8|W5Q0U8_SHEEP GATA binding protein 4 OS=Ovis aries OX=9940 GN=GATA4 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 7.708e-31
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSE 1467
             RECVNCGA +T LW RD +G+YLC+ C  + + N +N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+MRKEGIQTR      + KP +    N  K P+  S SE
Sbjct:  118 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAS-----------------RRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTR------KRKPKNL---NKSKTPAGPSGSE 242          
BLAST of GATA456 vs. Ensembl Cavefish
Match: gata4 (GATA binding protein 4 [Source:NCBI gene;Acc:103031262])

HSP 1 Score: 129.413 bits (324), Expect = 4.254e-32
Identity = 73/172 (42.44%), Postives = 98/172 (56.98%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISEN 1530
             RECVNCGA +T LW RD +G+YLC+ C  + + N  N   + P  ++S+S                 +R  L C+NC+ T T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQTRKRK K   KP       +   PS+ S+S     +  +K+  +   + S +
Sbjct:  187 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSAS-----------------RRVGLSCTNCQTTTTTLWRRNTEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNLNKPKPEPARADGHTPSNASTSGTAAELRPIKTEPDTPTLYSHH 341          
BLAST of GATA456 vs. Ensembl Cavefish
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:103042823])

HSP 1 Score: 130.183 bits (326), Expect = 5.848e-32
Identity = 58/125 (46.40%), Postives = 80/125 (64.00%), Query Frame = 1
Query: 1006 NCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            +C   RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  251 SCSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 358          
BLAST of GATA456 vs. Ensembl Cavefish
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:103042823])

HSP 1 Score: 130.183 bits (326), Expect = 5.853e-32
Identity = 58/125 (46.40%), Postives = 80/125 (64.00%), Query Frame = 1
Query: 1006 NCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            +C   RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  253 SCSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 360          
BLAST of GATA456 vs. Ensembl Cavefish
Match: gata2a (GATA-binding factor 2-like [Source:NCBI gene;Acc:103037830])

HSP 1 Score: 127.487 bits (319), Expect = 5.763e-31
Identity = 72/176 (40.91%), Postives = 101/176 (57.39%), Query Frame = 1
Query:  865 PTYPIQNLPDSTINWTTNNQIPSSNLVFDPWS----CKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            PTYP  +LP +  ++  +   P S L   P S    CKS       +EF +     RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLY+KLH   RPL+M+KEGIQT
Sbjct:  233 PTYPAYSLP-APHDYGASLFHPGSLLGGSPSSFTPKCKSKTRS--SSEFYTE---GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYFKLHNVNRPLTMKKEGIQT 385          
BLAST of GATA456 vs. Ensembl Cavefish
Match: gata6 (GATA binding protein 6 [Source:NCBI gene;Acc:103028246])

HSP 1 Score: 127.872 bits (320), Expect = 7.676e-31
Identity = 61/122 (50.00%), Postives = 80/122 (65.57%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            +RECVNCG+ +T LW RD +G++LC+ C  +S+ N  SR L K P  +++SS                 +R  L C+NC+ + T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQT
Sbjct:  292 ARECVNCGSVSTPLWRRDGTGHFLCNACGLYSKMNGLSRPLIK-PQKRMASS-----------------RRLGLSCANCQTSTTTLWRRNAEGEPVCNACGLYTKLHGVPRPLAMKKEGIQT 395          
BLAST of GATA456 vs. Ensembl Sea Lamprey
Match: gata2b (GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040718-440])

HSP 1 Score: 126.331 bits (316), Expect = 7.716e-34
Identity = 59/121 (48.76%), Postives = 78/121 (64.46%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S+S                 +R+   C+NC+ T T+LWRRN  GEPVCNACGLYYKLH   RP+SM+KEGIQT
Sbjct:   59 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAS-----------------RRAGTACANCQTTTTTLWRRNPNGEPVCNACGLYYKLHNVNRPMSMKKEGIQT 162          
BLAST of GATA456 vs. Ensembl Sea Lamprey
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:30458])

HSP 1 Score: 123.635 bits (309), Expect = 1.139e-32
Identity = 57/121 (47.11%), Postives = 78/121 (64.46%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:    2 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTSCANCQTTITTLWRRNASGDPVCNACGLYYKLHNINRPLTMKKEGIQT 105          
BLAST of GATA456 vs. Ensembl Sea Lamprey
Match: gata2b (GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040718-440])

HSP 1 Score: 124.79 bits (312), Expect = 1.261e-32
Identity = 59/121 (48.76%), Postives = 78/121 (64.46%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S+S                 +R+   C+NC+ T T+LWRRN  GEPVCNACGLYYKLH   RP+SM+KEGIQT
Sbjct:   27 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAS-----------------RRAGTACANCQTTTTTLWRRNPNGEPVCNACGLYYKLHNVNRPMSMKKEGIQT 130          
BLAST of GATA456 vs. Ensembl Sea Lamprey
Match: gata4 (GATA binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-980526-476])

HSP 1 Score: 95.1301 bits (235), Expect = 1.559e-23
Identity = 59/134 (44.03%), Postives = 78/134 (58.21%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVST 1419
            RECVNCGA +T LW RD +G+YLC+ C  +++ N  N   + P  ++S S                 +R  L CSNC+ + T+LWRRN EGEP   ACG+   +    RPL+M+K+GIQTRKRK K   K  ST
Sbjct:   14 RECVNCGAMSTPLWRRDGTGHYLCNACGLYNKMNGINRPLIKPQRRMSGS-----------------RRVGLSCSNCQTSTTTLWRRNAEGEPGYIACGIIV-IEGVPRPLAMKKDGIQTRKRKPKGACKSKST 129          
BLAST of GATA456 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000698.1 (pep scaffold:Pmarinus_7.0:GL479144:20133:30389:-1 gene:ENSPMAG00000000635.1 transcript:ENSPMAT00000000698.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 7.760e-10
Identity = 28/52 (53.85%), Postives = 34/52 (65.38%), Query Frame = 1
Query: 1210 QYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKE 1365
            Q  +   L C NC  T T+LWR+N  G  VCNACGLY KLH + RPLS+ K+
Sbjct:    1 QRKRGQGLFCVNCLTTTTTLWRKNAGGVYVCNACGLYEKLHSAPRPLSIIKQ 52          
BLAST of GATA456 vs. Ensembl Yeast
Match: GLN3 (Transcriptional activator of genes regulated by nitrogen catabolite repression; localization and activity regulated by quality of nitrogen source and Ure2p [Source:SGD;Acc:S000000842])

HSP 1 Score: 69.707 bits (169), Expect = 6.999e-13
Identity = 27/52 (51.92%), Postives = 39/52 (75.00%), Query Frame = 1
Query: 1219 KRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQ 1374
            K+  ++C NCK  KT LWRR+ EG  +CNACGL+ KLH ++RPLS++ + I+
Sbjct:  300 KKPLIQCFNCKTFKTPLWRRSPEGNTLCNACGLFQKLHGTMRPLSLKSDVIK 351          
BLAST of GATA456 vs. Ensembl Yeast
Match: GAT1 (Transcriptional activator of nitrogen catabolite repression genes; contains a GATA-1-type zinc finger DNA-binding motif; activity and localization regulated by nitrogen limitation and Ure2p; different translational starts produce two major and two minor isoforms that are differentially regulated and localized [Source:SGD;Acc:S000001873])

HSP 1 Score: 68.1662 bits (165), Expect = 1.712e-12
Identity = 33/77 (42.86%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 1228 DLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSES 1458
            D++CSNC  + T LWR++ +G P+CNACGL+ KLH   RPLS++ + I+        + +  ST I NN   P S S
Sbjct:  307 DIKCSNCTTSTTPLWRKDPKGLPLCNACGLFLKLHGVTRPLSLKTDIIK--------KRQRSSTKINNNITPPPSSS 375          
BLAST of GATA456 vs. Ensembl Yeast
Match: DAL80 (Negative regulator of genes in multiple nitrogen degradation pathways; expression is regulated by nitrogen levels and by Gln3p; member of the GATA-binding family, forms homodimers and heterodimers with Gzf3p; DAL80 has a paralog, GZF3, that arose from the whole genome duplication [Source:SGD;Acc:S000001742])

HSP 1 Score: 60.077 bits (144), Expect = 2.120e-10
Identity = 23/47 (48.94%), Postives = 32/47 (68.09%), Query Frame = 1
Query: 1237 CSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            C NC   KT LWRR+  G  +CNACGL+ KLH   RP+S++ + I++
Sbjct:   31 CQNCFTVKTPLWRRDEHGTVLCNACGLFLKLHGEPRPISLKTDTIKS 77          
BLAST of GATA456 vs. Ensembl Yeast
Match: GZF3 (GATA zinc finger protein; negatively regulates nitrogen catabolic gene expression by competing with Gat1p for GATA site binding; function requires a repressive carbon source; dimerizes with Dal80p and binds to Tor1p; GZF3 has a paralog, DAL80, that arose from the whole genome duplication [Source:SGD;Acc:S000003646])

HSP 1 Score: 58.9214 bits (141), Expect = 1.408e-9
Identity = 22/47 (46.81%), Postives = 32/47 (68.09%), Query Frame = 1
Query: 1237 CSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            C NC  + T LWRR+  G  +CNACGL+ KLH   RP+S++ + I++
Sbjct:  131 CKNCLTSTTPLWRRDEHGAMLCNACGLFLKLHGKPRPISLKTDVIKS 177          
BLAST of GATA456 vs. Ensembl Nematostella
Match: GATA (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY2])

HSP 1 Score: 125.176 bits (313), Expect = 6.719e-31
Identity = 60/122 (49.18%), Postives = 79/122 (64.75%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA++T LW RD SG+YLC+ C  + + N  SR L K P  ++S++                 +R+   C+NC  T+T+LWRRN  G+PVCNACGLY+KLH   RPLSM+K+GIQT
Sbjct:  215 GRECVNCGATSTPLWRRDGSGHYLCNACGLYHKMNGSSRPLIK-PKRRLSAA-----------------RRAGTSCANCHTTQTTLWRRNQNGDPVCNACGLYWKLHAVNRPLSMKKDGIQT 318          
BLAST of GATA456 vs. Ensembl Nematostella
Match: EDO38343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD91])

HSP 1 Score: 49.2914 bits (116), Expect = 2.243e-6
Identity = 17/34 (50.00%), Postives = 25/34 (73.53%), Query Frame = 1
Query: 1234 ECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHK 1335
            EC++C + KT LWR   +G P+CNACG+ YK ++
Sbjct:  222 ECASCGVAKTPLWRDAEDGTPLCNACGIRYKKYR 255          
BLAST of GATA456 vs. Ensembl Medaka
Match: gata2 (GATA binding protein 2 [Source:NCBI gene;Acc:100125427])

HSP 1 Score: 129.028 bits (323), Expect = 1.361e-31
Identity = 58/125 (46.40%), Postives = 81/125 (64.80%), Query Frame = 1
Query: 1006 NCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            +C   RECVNCGA++T LW RD++G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLYYKLH   RPL+M+KEGIQT
Sbjct:  268 SCTEGRECVNCGATSTPLWRRDSTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTCCANCQTTTTTLWRRNASGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 375          
BLAST of GATA456 vs. Ensembl Medaka
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:100049296])

HSP 1 Score: 128.642 bits (322), Expect = 1.716e-31
Identity = 57/125 (45.60%), Postives = 80/125 (64.00%), Query Frame = 1
Query: 1006 NCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            +C   RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLY+KLH   RPL+M+KEGIQT
Sbjct:  251 SCSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYFKLHNINRPLTMKKEGIQT 358          
BLAST of GATA456 vs. Ensembl Medaka
Match: gata6 (GATA binding protein 6 [Source:NCBI gene;Acc:101159296])

HSP 1 Score: 126.331 bits (316), Expect = 1.896e-30
Identity = 69/132 (52.27%), Postives = 86/132 (65.15%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNN--SRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMK 1407
            SRECVNCG+ +T LW RD +G++LC+ C  +S+ N  SR L K P  + S+S                 +R  L C+NC+ + T+LWRRN EGEPVCNACGLY KLH   RPL+M+KEGIQTRKRK KT  K
Sbjct:  289 SRECVNCGSISTPLWRRDGTGHFLCNACGLYSKMNGLSRPLIK-PQKRTSTS-----------------RRIGLSCANCQTSTTTLWRRNAEGEPVCNACGLYTKLHGVPRPLAMKKEGIQTRKRKPKTLSK 402          
BLAST of GATA456 vs. Ensembl Medaka
Match: gata-1 (hematopietic transcription factor GATA-1 [Source:NCBI gene;Acc:100125425])

HSP 1 Score: 124.79 bits (312), Expect = 2.303e-30
Identity = 58/130 (44.62%), Postives = 79/130 (60.77%), Query Frame = 1
Query:  991 NEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            N+  +    +RECVNCGA+ T LW RD +G+YLC+ C  + + N +N   + P  ++  S                 KR+  +C+NC  + T+LWRRN  GEPVCNACGLY+KLH   RPL+M+KEGIQT
Sbjct:  226 NKMRATTPEARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVS-----------------KRAGTQCANCHTSTTTLWRRNANGEPVCNACGLYFKLHNVNRPLTMKKEGIQT 338          
BLAST of GATA456 vs. Ensembl Medaka
Match: gata2a (GATA-binding factor 2 [Source:NCBI gene;Acc:101161391])

HSP 1 Score: 125.561 bits (314), Expect = 2.713e-30
Identity = 56/121 (46.28%), Postives = 78/121 (64.46%), Query Frame = 1
Query: 1018 SRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
             RECVNCGA++T LW RD +G+YLC+ C  + + N +N   + P  ++S++                 +R+   C+NC+ T T+LWRRN  G+PVCNACGLY+KLH   RPL+M+KEGIQT
Sbjct:  272 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA-----------------RRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYFKLHNVNRPLTMKKEGIQT 375          
BLAST of GATA456 vs. Planmine SMEST
Match: SMESG000039559.1 (SMESG000039559.1)

HSP 1 Score: 1021.15 bits (2639), Expect = 0.000e+0
Identity = 512/513 (99.81%), Postives = 513/513 (100.00%), Query Frame = 1
Query:  250 MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV 1788
            MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTRKRKRKTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQS+ENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV
Sbjct:    1 MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTRKRKRKTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQSSENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV 513          
BLAST of GATA456 vs. Planmine SMEST
Match: SMESG000037031.1 (SMESG000037031.1)

HSP 1 Score: 1021.15 bits (2639), Expect = 0.000e+0
Identity = 512/513 (99.81%), Postives = 513/513 (100.00%), Query Frame = 1
Query:  250 MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTXXXXXXTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV 1788
            MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTRKRKRKTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQS+ENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV
Sbjct:    1 MDIVSPKSNTSNLNALITYSNCPNIDLQSNDLSVNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGDLKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSIINDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFNQNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVFDPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTRKRKRKTQMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMPNISVQPFNHILNSSQYQFQSSENPINQSYLNSSIKNSNPFYDSESILYSYNNSNKIKDEPLLSMDNEPKPYSSINEKIDV 513          
BLAST of GATA456 vs. Planmine SMEST
Match: SMESG000028503.1 (SMESG000028503.1)

HSP 1 Score: 121.324 bits (303), Expect = 1.506e-28
Identity = 58/120 (48.33%), Postives = 74/120 (61.67%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCGA NT LW RD  G YLC+ C  + + N +N   + P  ++S+S                 +R+   CSNC  + T+LWRRN+ GEPVCNACGLY+KLH   RP +M+KEGIQT
Sbjct:  368 RECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSAS-----------------RRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 470          
BLAST of GATA456 vs. Planmine SMEST
Match: SMESG000028503.1 (SMESG000028503.1)

HSP 1 Score: 121.324 bits (303), Expect = 1.552e-28
Identity = 58/120 (48.33%), Postives = 74/120 (61.67%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCGA NT LW RD  G YLC+ C  + + N +N   + P  ++S+S                 +R+   CSNC  + T+LWRRN+ GEPVCNACGLY+KLH   RP +M+KEGIQT
Sbjct:  370 RECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSAS-----------------RRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 472          
BLAST of GATA456 vs. Planmine SMEST
Match: SMESG000028503.1 (SMESG000028503.1)

HSP 1 Score: 120.939 bits (302), Expect = 2.271e-28
Identity = 58/120 (48.33%), Postives = 74/120 (61.67%), Query Frame = 1
Query: 1021 RECVNCGASNTQLWSRDNSGYYLCDECDRFSQNNSRNLEKL-PTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNCKITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQT 1377
            RECVNCGA NT LW RD  G YLC+ C  + + N +N   + P  ++S+S                 +R+   CSNC  + T+LWRRN+ GEPVCNACGLY+KLH   RP +M+KEGIQT
Sbjct:  368 RECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSAS-----------------RRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 470          
The following BLAST results are available for this feature:
BLAST of GATA456 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GATA41.393e-3346.36GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
GATA41.393e-3346.36GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
GATA41.528e-3346.36GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
GATA41.528e-3346.36GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
GATA45.522e-3346.36GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of GATA456 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elt-13.074e-3151.24Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-16.811e-3150.41Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-17.712e-3151.24Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-17.766e-3151.24Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-11.709e-3050.41Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of GATA456 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grn2.646e-3249.17gene:FBgn0001138 transcript:FBtr0081808[more]
grn2.671e-3245.19gene:FBgn0001138 transcript:FBtr0300040[more]
grn2.917e-3245.19gene:FBgn0001138 transcript:FBtr0330188[more]
pnr6.771e-3249.59gene:FBgn0003117 transcript:FBtr0335427[more]
pnr6.771e-3249.59gene:FBgn0003117 transcript:FBtr0083220[more]
back to top
BLAST of GATA456 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata63.126e-3248.20GATA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
gata2a7.574e-3240.91GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata41.116e-3149.23GATA binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-9... [more]
gata2a1.158e-3139.77GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata61.548e-3148.20GATA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of GATA456 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata66.588e-3351.08GATA binding protein 6 [Source:NCBI gene;Acc:39506... [more]
mcm41.497e-3248.06minichromosome maintenance complex component 4 [So... [more]
gata34.752e-3147.11GATA binding protein 3 [Source:NCBI gene;Acc:44839... [more]
gata35.183e-3147.11GATA binding protein 3 [Source:NCBI gene;Acc:44839... [more]
gata51.459e-3039.42GATA binding protein 5 [Source:NCBI gene;Acc:49685... [more]
back to top
BLAST of GATA456 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gata43.179e-3350.41GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Gata41.444e-3250.41GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Gata41.491e-3250.41GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Gata31.475e-3140.12GATA binding protein 3 [Source:MGI Symbol;Acc:MGI:... [more]
Gata63.143e-3153.28GATA binding protein 6 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of GATA456 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91677|GATA4_XENLA9.633e-3334.51Transcription factor GATA-4 OS=Xenopus laevis OX=8... [more]
sp|P70005|GAT6B_XENLA1.213e-3250.36GATA-binding factor 6-B OS=Xenopus laevis OX=8355 ... [more]
sp|P43694|GATA4_HUMAN2.687e-3246.36Transcription factor GATA-4 OS=Homo sapiens OX=960... [more]
sp|P43691|GATA4_CHICK5.457e-3250.00Transcription factor GATA-4 (Fragment) OS=Gallus g... [more]
sp|Q0Q0E4|GATA4_CANLF9.190e-3250.41Transcription factor GATA-4 OS=Canis lupus familia... [more]
back to top
BLAST of GATA456 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203439390.000e+0100.00tr|H8YS98|H8YS98_SCHMD GATA456 OS=Schmidtea medite... [more]
gnl|BL_ORD_ID|209121420.000e+093.37tr|F1CDE4|F1CDE4_SCHPL GATA456a OS=Schmidtea polyc... [more]
gnl|BL_ORD_ID|213388441.563e-3251.91tr|A0A0P4VRZ8|A0A0P4VRZ8_9EUCA Uncharacterized pro... [more]
gnl|BL_ORD_ID|170036776.933e-3142.71tr|A0A1S3HKG8|A0A1S3HKG8_LINUN transcription facto... [more]
gnl|BL_ORD_ID|265338777.708e-3146.36tr|W5Q0U8|W5Q0U8_SHEEP GATA binding protein 4 OS=O... [more]
back to top
BLAST of GATA456 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata44.254e-3242.44GATA binding protein 4 [Source:NCBI gene;Acc:10303... [more]
gata35.848e-3246.40GATA binding protein 3 [Source:NCBI gene;Acc:10304... [more]
gata35.853e-3246.40GATA binding protein 3 [Source:NCBI gene;Acc:10304... [more]
gata2a5.763e-3140.91GATA-binding factor 2-like [Source:NCBI gene;Acc:1... [more]
gata67.676e-3150.00GATA binding protein 6 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of GATA456 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata2b7.716e-3448.76GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata31.139e-3247.11GATA binding protein 3 [Source:NCBI gene;Acc:30458... [more]
gata2b1.261e-3248.76GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata41.559e-2344.03GATA binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-9... [more]
ENSPMAT00000000698.17.760e-1053.85pep scaffold:Pmarinus_7.0:GL479144:20133:30389:-1 ... [more]
back to top
BLAST of GATA456 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
GLN36.999e-1351.92Transcriptional activator of genes regulated by ni... [more]
GAT11.712e-1242.86Transcriptional activator of nitrogen catabolite r... [more]
DAL802.120e-1048.94Negative regulator of genes in multiple nitrogen d... [more]
GZF31.408e-946.81GATA zinc finger protein; negatively regulates nit... [more]
back to top
BLAST of GATA456 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
GATA6.719e-3149.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383432.243e-650.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GATA456 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata21.361e-3146.40GATA binding protein 2 [Source:NCBI gene;Acc:10012... [more]
gata31.716e-3145.60GATA binding protein 3 [Source:NCBI gene;Acc:10004... [more]
gata61.896e-3052.27GATA binding protein 6 [Source:NCBI gene;Acc:10115... [more]
gata-12.303e-3044.62hematopietic transcription factor GATA-1 [Source:N... [more]
gata2a2.713e-3046.28GATA-binding factor 2 [Source:NCBI gene;Acc:101161... [more]
back to top
BLAST of GATA456 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039559.10.000e+099.81SMESG000039559.1[more]
SMESG000037031.10.000e+099.81SMESG000037031.1[more]
SMESG000028503.11.506e-2848.33SMESG000028503.1[more]
SMESG000028503.11.552e-2848.33SMESG000028503.1[more]
SMESG000028503.12.271e-2848.33SMESG000028503.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30007290
GenBankAFF18488.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007290 ID=SMED30007290|Name=GATA456|organism=Schmidtea mediterranea sexual|type=transcript|length=2033bp
AGGTAAGTGTCGTCATCACAAGTGGCTTTATTATTATCATTTAAATTTTT
TATCATATTATCATTGATTGCTTGTTTTCCTCATTCAAAATTTAACTGAT
TGTTATCAAGCTCATTTGATAACTCCAAATCTAATTGACACTCATGTAAA
TATCCCATTCGAATTTCCGTTCCCGTCCGTAAGATCCACGATCCGACAAT
GTTTCTCCCATCGGTATTGTCGAATTCTCACCAGAGAAACTCACCAATAA
TGGACATTGTATCACCAAAATCCAACACCAGCAATCTGAATGCGTTGATC
ACGTATTCGAATTGTCCCAACATAGATCTACAGTCGAATGATCTGTCAGT
GAACTTGACGAATTCTCAAAACTTCCACGAATTGGATCACAAAACCAATT
ACGGATACAAAGTTTCAAACAACGAGACAAAACTGAATGCTTTTCCATAT
TTAGCTCAATCGAACTTAACAGATTGCACAACAGACATCAGTGGAGATCT
GAAAAATCCAAATTCACATCTCAACTATGGAAACGGAATTTCGTTCTCGG
AATTTTCGAAAATGTCCGAAACCAACATCCACGGATATCCGCCATATTGT
TTCTCCACTAAACTGTTTCCCATTCCAAATCTACAAGAGAAATCAATTAT
CAACGACAACTATTCCGTGAAATCCACCGCCGGAGGCTTTATCACCGAAT
CGAATGAGCATCAAAACTCTGTAAATACTGGAAATTCCTACAATTCCAAT
TTAAGCTCATACAGAACGGTAATTCCCGCTCATTTTCATCTCTTCAATCA
GAATTCACCAGAATCGAACTCGTTTTACAATACGGCTTGGAACAACTATC
CGTTTCAAATATCCCCAACTTATCCCATACAAAATCTACCGGATTCAACA
ATCAACTGGACAACAAACAATCAAATTCCAAGCAGCAATTTAGTTTTTGA
TCCCTGGAGCTGTAAATCAAATCTTAATCTTCCTCCGATTAATGAATTCG
GTTCCAATTGCGATGTCAGCAGAGAGTGTGTGAACTGTGGAGCTAGCAAT
ACTCAGTTGTGGTCCCGGGATAATTCTGGCTATTATTTGTGTGATGAATG
CGACAGGTTCTCTCAAAACAACAGTAGAAACCTCGAAAAACTACCAACGA
ATCAAGTCTCATCAAGTACCGAAAATGAGTTCATGAAAAAATCCAATGCC
AACTTTCAACAATATGGAAAAAGATCCGACCTCGAATGCAGCAATTGTAA
AATTACCAAGACTTCTTTATGGAGAAGAAACAACGAAGGAGAACCTGTCT
GCAATGCTTGCGGCTTGTATTATAAATTACATAAGTCTCTAAGACCTCTT
TCAATGAGGAAAGAAGGAATACAAACAAGGAAAAGAAAACGGAAAACACA
AATGAAACCGGTTTCCACTCATATTGCCAATAATCAAAAGGTGCCGTCTT
CAGAATCGTCATCAGAACAAAATCAGTTTATAAACACTGTGAAATCAAGT
GAAAATTGCTATAACATGATTTCTGAAAATTCTCCAACATATATGCCAAA
TATATCAGTCCAGCCCTTCAATCACATTCTGAACTCCAGCCAATATCAAT
TCCAATCTACAGAAAATCCCATTAATCAATCATATTTAAATTCCTCAATC
AAAAACAGCAATCCCTTTTACGATTCCGAAAGTATACTTTATTCCTACAA
CAATTCAAACAAAATCAAAGATGAGCCCCTATTATCCATGGACAACGAAC
CGAAGCCCTATTCCTCAATCAACGAGAAAATTGACGTCAACTCCATAGTG
AGAATTAATGAAATCTCAAACAATTCGAATTCGAGTTAATTATTCTGATC
TACTTTTTAATTATATATTTAAGAACCGTATATACTTCGAAATATAATTT
TAATGATAAAATTTTATATCTAAAAAATGTAATTTTTAAGTGCGAATTAT
TAAGTATGCATTTAAATAGTGCAATTATTGTGGTAGTTATTTTTATTACT
AAATAAATGTTGTTTGTAAATTCGAGAATTTGT
back to top

protein sequence of SMED30007290-orf-1

>SMED30007290-orf-1 ID=SMED30007290-orf-1|Name=SMED30007290-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=547bp
MFLPSVLSNSHQRNSPIMDIVSPKSNTSNLNALITYSNCPNIDLQSNDLS
VNLTNSQNFHELDHKTNYGYKVSNNETKLNAFPYLAQSNLTDCTTDISGD
LKNPNSHLNYGNGISFSEFSKMSETNIHGYPPYCFSTKLFPIPNLQEKSI
INDNYSVKSTAGGFITESNEHQNSVNTGNSYNSNLSSYRTVIPAHFHLFN
QNSPESNSFYNTAWNNYPFQISPTYPIQNLPDSTINWTTNNQIPSSNLVF
DPWSCKSNLNLPPINEFGSNCDVSRECVNCGASNTQLWSRDNSGYYLCDE
CDRFSQNNSRNLEKLPTNQVSSSTENEFMKKSNANFQQYGKRSDLECSNC
KITKTSLWRRNNEGEPVCNACGLYYKLHKSLRPLSMRKEGIQTRKRKRKT
QMKPVSTHIANNQKVPSSESSSEQNQFINTVKSSENCYNMISENSPTYMP
NISVQPFNHILNSSQYQFQSTENPINQSYLNSSIKNSNPFYDSESILYSY
NNSNKIKDEPLLSMDNEPKPYSSINEKIDVNSIVRINEISNNSNSS*
back to top
Aliases
The feature 'GATA456' has the following synonyms
Synonym
gata456a
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0003108gastrodermal cell
PLANA:0000039gamma neoblast
PLANA:0000058embryonic digestive system
PLANA:0000023embryonic pharynx
PLANA:0000049digestive system
PLANA:0000026gut
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000005Stage 5
PLANA:0000007Stage 7
PLANA:0000006Stage 6
PLANA:0000002Stage 2
Vocabulary: INTERPRO
TermDefinition
IPR039355Transcription_factor_GATA
IPR027417P-loop_NTPase
IPR000679Znf_GATA
IPR013088Znf_NHR/GATA
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001076transcription factor activity, RNA polymerase II transcription factor binding
GO:0001085RNA polymerase II transcription factor binding
GO:0001158enhancer sequence-specific DNA binding
GO:0001228transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003677DNA binding
GO:0003682chromatin binding
GO:0003713transcription coactivator activity
GO:0008134transcription factor binding
GO:0019901protein kinase binding
GO:0033613activating transcription factor binding
GO:0044212transcription regulatory region DNA binding
GO:0046872metal ion binding
GO:0051525NFAT protein binding
GO:0070410co-SMAD binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0003197endocardial cushion development
GO:0003290atrial septum secundum morphogenesis
GO:0006351transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
GO:0007507heart development
GO:0008584male gonad development
GO:0009612response to mechanical stimulus
GO:0010507negative regulation of autophagy
GO:0030513positive regulation of BMP signaling pathway
GO:0033189response to vitamin A
GO:0042493response to drug
GO:0045893positive regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0055007cardiac muscle cell differentiation
GO:0060290transdifferentiation
GO:0060413atrial septum morphogenesis
GO:0060575intestinal epithelial cell differentiation
GO:0061049cell growth involved in cardiac muscle cell development
GO:0071333cellular response to glucose stimulus
GO:0086004regulation of cardiac muscle cell contraction
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005667transcription factor complex
GO:0016604nuclear body
GO:0090575RNA polymerase II transcription factor complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000679Zinc finger, GATA-typePRINTSPR00619GATAZNFINGERcoord: 343..360
score: 51.48
coord: 361..378
score: 57.38
IPR000679Zinc finger, GATA-typeSMARTSM00401GATA_3coord: 341..391
e-value: 4.2E-22
score: 89.4
IPR000679Zinc finger, GATA-typePFAMPF00320GATAcoord: 347..380
e-value: 4.7E-14
score: 51.7
IPR000679Zinc finger, GATA-typePROSITEPS00344GATA_ZN_FINGER_1coord: 347..371
IPR000679Zinc finger, GATA-typePROSITEPS50114GATA_ZN_FINGER_2coord: 341..394
score: 26.297
IPR000679Zinc finger, GATA-typePROSITEPS50114GATA_ZN_FINGER_2coord: 271..311
score: 14.022
IPR000679Zinc finger, GATA-typeCDDcd00202ZnF_GATAcoord: 346..397
e-value: 1.79497E-19
score: 80.1094
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 271..318
e-value: 9.3E-9
score: 36.5
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 336..397
e-value: 6.3E-28
score: 98.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 404..424
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 390..424
NoneNo IPR availablePANTHERPTHR10071:SF289TRANSCRIPTION FACTOR GATA-5coord: 172..431
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 339..398
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 271..308
IPR039355Transcription factor GATAPANTHERPTHR10071TRANSCRIPTION FACTOR GATA FAMILY MEMBERcoord: 172..431