Nucleolar GTP-binding protein 1

Overview
NameNucleolar GTP-binding protein 1
Smed IDSMED30007287
Length (bp)1928
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleolar GTP-binding protein 1 (SMED30007287) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleolar GTP-binding protein 1 (SMED30007287) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleolar GTP-binding protein 1 (SMED30007287) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleolar GTP-binding protein 1 (SMED30007287) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007287

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30007287SMESG000074998.1 dd_Smed_v4_764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007287SMESG000074998.1 dd_Smed_v4_764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007287SMESG000074998.1 dd_Smed_v4_764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007287SMESG000074998.1 dd_Smed_v4_764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007287SMESG000074998.1 dd_Smed_v4_764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007287SMESG000074998.1 Contig53636newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30007287SMESG000074998.1 Contig53636uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Human
Match: GTPBP4 (GTP binding protein 4 [Source:HGNC Symbol;Acc:HGNC:21535])

HSP 1 Score: 524.628 bits (1350), Expect = 2.186e-179
Identity = 301/650 (46.31%), Postives = 423/650 (65.08%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDAL---------EVFRREEKLLDDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVES-DAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVPS+K+ +D+ LSKTQRKTPTVIHK  QI   R FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ VD +AKD+ +L+K+GDS YRCK LKR ALG+M  +I +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADVDVQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL + N+ EM AITAL  L  A VL+++DLSE+CG+ +++Q+ L  NIR LF NKPLIV  NK DV +  +L E+DQ++   +++ EG  V  +  ST+T+EGV+  +  ACD +L  RV  K++   ++E+ NRL++A    + +    P      + ++  +E E    ++KK   +++ E G+ ++ D ++ W + N ++K+D IPEI+ GHNIAD  YID   +         E  R      D V+  E   E L  E R LAK+I E + LK L++ EK NT G + + R  K +    +++ M+ LGV ++  D    +    RS++ +  RK+ + +   + + S       R  SG+RD K   K + M K +Q+K+NR GK+GEADRH+ D KPKHL +GKR  GK DRR
Sbjct:    1 MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTVIKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHL-RAAVLYVMDLSEQCGHGLREQLELFQNIRPLFINKPLIVVANKCDVKRIAELSEDDQKIFTDLQS-EGFPV--IETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPTRRDDKERPPFIPEGVVARRKRMETEE---SRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIAD--YIDPAIMKKLEELEKEEELRTAAGEYDSVSESE-DEEML--EIRQLAKQIREKKKLKILESKEK-NTQGPR-MPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR 634          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Human
Match: GTPBP4 (GTP binding protein 4 [Source:HGNC Symbol;Acc:HGNC:21535])

HSP 1 Score: 183.341 bits (464), Expect = 2.535e-54
Identity = 84/142 (59.15%), Postives = 110/142 (77.46%), Query Frame = 3
Query:  144 IRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNK 569
            +RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ VD +AKD+ +L+K+GDS YRCK LKR ALG+M  +I +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK
Sbjct:    1 MRKVKFTQQNYHDRLSQILTDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTVIKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINK 140          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Human
Match: DRG2 (developmentally regulated GTP binding protein 2 [Source:HGNC Symbol;Acc:HGNC:3030])

HSP 1 Score: 50.8322 bits (120), Expect = 1.149e-6
Identity = 26/82 (31.71%), Postives = 42/82 (51.22%), Query Frame = 3
Query:  453 QYLEECRQHLSRLPTID---TSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLD 689
            Q LE  +   S+    D   +    V L GFP+VGKS+FL+ ++    +   Y FTT +   G  +Y+    Q +D PG+++
Sbjct:   40 QLLEPSKSASSKGEGFDVMKSGDARVALIGFPSVGKSTFLSLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIE 121          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Human
Match: DRG2 (developmentally regulated GTP binding protein 2 [Source:HGNC Symbol;Acc:HGNC:3030])

HSP 1 Score: 49.6766 bits (117), Expect = 5.445e-6
Identity = 27/93 (29.03%), Postives = 46/93 (49.46%), Query Frame = 3
Query:  420 IISKSVTKASLQYLEECRQHLSRLPTID---TSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLD 689
            ++   + K   Q LE  +   S+    D   +    V L GFP+VGKS+FL+ ++    +   Y FTT +   G  +Y+    Q +D PG+++
Sbjct:   29 LLKAKLAKYRAQLLEPSKSASSKGEGFDVMKSGDARVALIGFPSVGKSTFLSLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIE 121          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Celegans
Match: nog-1 (Nucleolar GTP-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O44411])

HSP 1 Score: 464.151 bits (1193), Expect = 1.511e-155
Identity = 282/694 (40.63%), Postives = 409/694 (58.93%), Query Frame = 3
Query:   12 HDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELK----NRLYVA------NKIVKPNNNMIPLEVLNRLEQKALLEAEN----------------PGCTKKKTLF----------------------EIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYID---NDALEVFRREEKLLDDVNFYEIKHEPLPEETR---VLAKKIAEAEDLKKLDNIEKTNTTGR---KTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            ++FK I  VP+++EL D+VLSKTQRKTPTV+H+   IG  R FY RK+K  QQ  HDK+ +I+ +FP ++ +H FY++LMN LY    YK AL  +N  +  +D IA+++ +L+K+ DS YRCK LKR ALG+MVK++ +   K+S +YLE+ RQHLSRLP+ID +TRT+ILCGFPNVGKSSF+N ++RADV+VQPYAFTTK+L+VGH DY+ LRWQ IDTPG+LD+PL + N+ EM A+TAL  L +A VLF++D+SE+C  SI++Q+ L  +IR LF NKP+++GLNK+D+     LP E   L   +  +E + + ++  ST+T EGVM  R+ ACD +L  RV  K++   I  ++    NR++VA       K+  P    +P  +  +  QK L EA+                 PG   K+ +                       EI+ E  + ++ D ++ +++KNP +KYDI+PEI+ GHN+ADF  +D      LE   REE+LL+    YE   +   EET+    LA +I E E L  LD+       GR   +     ++  + + ++  + +LGV V++      K      A+    KK+++   R+           R      DE+    V K+   + R + R  K+GEADRH+ D KPKHL  GKRG GK D R
Sbjct:    5 YNFKRITCVPNAQELKDVVLSKTQRKTPTVVHRQYSIGRIRAFYARKIKFLQQTLHDKLTQIITEFPKMEEIHPFYSDLMNILYDRDHYKIALGQMNTARHLIDGIAREYVRLMKYADSLYRCKMLKRAALGRMVKLLKRQ--KSSFEYLEQVRQHLSRLPSIDPATRTLILCGFPNVGKSSFINNVTRADVEVQPYAFTTKALYVGHLDYRFLRWQVIDTPGILDQPLEDRNTIEMQAVTALAHL-KASVLFMMDVSEQCDRSIEEQLHLFESIRPLFANKPVLIGLNKVDIRHRSDLPPEKAAL---LDQLEKEGIPIIETSTLTQEGVMGLRDRACDELLAQRVEAKIQAKKITNVEDCVLNRVFVAYPAPRDEKVRAP---FVPPGLAAKRAQKKLQEAQELMETDGDEFAAKIPQKPGKIGKEKIAKGGSQSTDLGDLRDENTRRLEREIELEMQDDYILDLKKHYMLKNPDEKYDIVPEIWEGHNLADF--VDPEIQSKLENLLREEELLEQAGEYESDLDSDDEETKEKLKLALQIREKEKLLTLDHAVNKRIAGRIGSRIHGSRKRDRSMSRLENELGELGVDVDTKK---MKNLQGQCAKPQLGKKMKVGRSRS---LSAVRPAPRDELAFPDEEKRAHVDKLRTKAMRGLRREAKKGEADRHVYDLKPKHLFCGKRGNGKTDWR 681          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Celegans
Match: nog-1 (Nucleolar GTP-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O44411])

HSP 1 Score: 464.151 bits (1193), Expect = 1.511e-155
Identity = 282/694 (40.63%), Postives = 409/694 (58.93%), Query Frame = 3
Query:   12 HDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELK----NRLYVA------NKIVKPNNNMIPLEVLNRLEQKALLEAEN----------------PGCTKKKTLF----------------------EIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYID---NDALEVFRREEKLLDDVNFYEIKHEPLPEETR---VLAKKIAEAEDLKKLDNIEKTNTTGR---KTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            ++FK I  VP+++EL D+VLSKTQRKTPTV+H+   IG  R FY RK+K  QQ  HDK+ +I+ +FP ++ +H FY++LMN LY    YK AL  +N  +  +D IA+++ +L+K+ DS YRCK LKR ALG+MVK++ +   K+S +YLE+ RQHLSRLP+ID +TRT+ILCGFPNVGKSSF+N ++RADV+VQPYAFTTK+L+VGH DY+ LRWQ IDTPG+LD+PL + N+ EM A+TAL  L +A VLF++D+SE+C  SI++Q+ L  +IR LF NKP+++GLNK+D+     LP E   L   +  +E + + ++  ST+T EGVM  R+ ACD +L  RV  K++   I  ++    NR++VA       K+  P    +P  +  +  QK L EA+                 PG   K+ +                       EI+ E  + ++ D ++ +++KNP +KYDI+PEI+ GHN+ADF  +D      LE   REE+LL+    YE   +   EET+    LA +I E E L  LD+       GR   +     ++  + + ++  + +LGV V++      K      A+    KK+++   R+           R      DE+    V K+   + R + R  K+GEADRH+ D KPKHL  GKRG GK D R
Sbjct:    5 YNFKRITCVPNAQELKDVVLSKTQRKTPTVVHRQYSIGRIRAFYARKIKFLQQTLHDKLTQIITEFPKMEEIHPFYSDLMNILYDRDHYKIALGQMNTARHLIDGIAREYVRLMKYADSLYRCKMLKRAALGRMVKLLKRQ--KSSFEYLEQVRQHLSRLPSIDPATRTLILCGFPNVGKSSFINNVTRADVEVQPYAFTTKALYVGHLDYRFLRWQVIDTPGILDQPLEDRNTIEMQAVTALAHL-KASVLFMMDVSEQCDRSIEEQLHLFESIRPLFANKPVLIGLNKVDIRHRSDLPPEKAAL---LDQLEKEGIPIIETSTLTQEGVMGLRDRACDELLAQRVEAKIQAKKITNVEDCVLNRVFVAYPAPRDEKVRAP---FVPPGLAAKRAQKKLQEAQELMETDGDEFAAKIPQKPGKIGKEKIAKGGSQSTDLGDLRDENTRRLEREIELEMQDDYILDLKKHYMLKNPDEKYDIVPEIWEGHNLADF--VDPEIQSKLENLLREEELLEQAGEYESDLDSDDEETKEKLKLALQIREKEKLLTLDHAVNKRIAGRIGSRIHGSRKRDRSMSRLENELGELGVDVDTKK---MKNLQGQCAKPQLGKKMKVGRSRS---LSAVRPAPRDELAFPDEEKRAHVDKLRTKAMRGLRREAKKGEADRHVYDLKPKHLFCGKRGNGKTDWR 681          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Celegans
Match: nog-1 (Nucleolar GTP-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O44411])

HSP 1 Score: 464.151 bits (1193), Expect = 1.511e-155
Identity = 282/694 (40.63%), Postives = 409/694 (58.93%), Query Frame = 3
Query:   12 HDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELK----NRLYVA------NKIVKPNNNMIPLEVLNRLEQKALLEAEN----------------PGCTKKKTLF----------------------EIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYID---NDALEVFRREEKLLDDVNFYEIKHEPLPEETR---VLAKKIAEAEDLKKLDNIEKTNTTGR---KTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            ++FK I  VP+++EL D+VLSKTQRKTPTV+H+   IG  R FY RK+K  QQ  HDK+ +I+ +FP ++ +H FY++LMN LY    YK AL  +N  +  +D IA+++ +L+K+ DS YRCK LKR ALG+MVK++ +   K+S +YLE+ RQHLSRLP+ID +TRT+ILCGFPNVGKSSF+N ++RADV+VQPYAFTTK+L+VGH DY+ LRWQ IDTPG+LD+PL + N+ EM A+TAL  L +A VLF++D+SE+C  SI++Q+ L  +IR LF NKP+++GLNK+D+     LP E   L   +  +E + + ++  ST+T EGVM  R+ ACD +L  RV  K++   I  ++    NR++VA       K+  P    +P  +  +  QK L EA+                 PG   K+ +                       EI+ E  + ++ D ++ +++KNP +KYDI+PEI+ GHN+ADF  +D      LE   REE+LL+    YE   +   EET+    LA +I E E L  LD+       GR   +     ++  + + ++  + +LGV V++      K      A+    KK+++   R+           R      DE+    V K+   + R + R  K+GEADRH+ D KPKHL  GKRG GK D R
Sbjct:    5 YNFKRITCVPNAQELKDVVLSKTQRKTPTVVHRQYSIGRIRAFYARKIKFLQQTLHDKLTQIITEFPKMEEIHPFYSDLMNILYDRDHYKIALGQMNTARHLIDGIAREYVRLMKYADSLYRCKMLKRAALGRMVKLLKRQ--KSSFEYLEQVRQHLSRLPSIDPATRTLILCGFPNVGKSSFINNVTRADVEVQPYAFTTKALYVGHLDYRFLRWQVIDTPGILDQPLEDRNTIEMQAVTALAHL-KASVLFMMDVSEQCDRSIEEQLHLFESIRPLFANKPVLIGLNKVDIRHRSDLPPEKAAL---LDQLEKEGIPIIETSTLTQEGVMGLRDRACDELLAQRVEAKIQAKKITNVEDCVLNRVFVAYPAPRDEKVRAP---FVPPGLAAKRAQKKLQEAQELMETDGDEFAAKIPQKPGKIGKEKIAKGGSQSTDLGDLRDENTRRLEREIELEMQDDYILDLKKHYMLKNPDEKYDIVPEIWEGHNLADF--VDPEIQSKLENLLREEELLEQAGEYESDLDSDDEETKEKLKLALQIREKEKLLTLDHAVNKRIAGRIGSRIHGSRKRDRSMSRLENELGELGVDVDTKK---MKNLQGQCAKPQLGKKMKVGRSRS---LSAVRPAPRDELAFPDEEKRAHVDKLRTKAMRGLRREAKKGEADRHVYDLKPKHLFCGKRGNGKTDWR 681          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Celegans
Match: M01E5.2 (pep chromosome:WBcel235:I:13277300:13280175:-1 gene:WBGene00010805.1 transcript:M01E5.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M01E5.2)

HSP 1 Score: 51.2174 bits (121), Expect = 1.226e-6
Identity = 46/141 (32.62%), Postives = 71/141 (50.35%), Query Frame = 3
Query:  516 TVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNL-RWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVL-FIIDLSEKCGNSIQQ----QVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEED 920
            T  L GFPN GKSS L  ISRA   V  Y FTT    +G   Y++  +    D PGL++    + + ++   I+ L  +E    L +++D S   G+   Q    +V L G  + L G++   + +NKID+    + PEE+
Sbjct:  190 TAGLVGFPNAGKSSLLRAISRAKPKVASYPFTTLHPHIGVVFYEDFEQIAVADIPGLIE----DSHLNKGLGISFLKHIERCESLWYVLDYS--TGSLTDQYKMLRVELEGYQKGL-GDRASTIVINKIDLSG--KSPEEE 321          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Celegans
Match: M01E5.2 (pep chromosome:WBcel235:I:13277061:13280175:-1 gene:WBGene00010805.1 transcript:M01E5.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M01E5.2)

HSP 1 Score: 51.2174 bits (121), Expect = 1.226e-6
Identity = 46/141 (32.62%), Postives = 71/141 (50.35%), Query Frame = 3
Query:  516 TVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNL-RWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVL-FIIDLSEKCGNSIQQ----QVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEED 920
            T  L GFPN GKSS L  ISRA   V  Y FTT    +G   Y++  +    D PGL++    + + ++   I+ L  +E    L +++D S   G+   Q    +V L G  + L G++   + +NKID+    + PEE+
Sbjct:  190 TAGLVGFPNAGKSSLLRAISRAKPKVASYPFTTLHPHIGVVFYEDFEQIAVADIPGLIE----DSHLNKGLGISFLKHIERCESLWYVLDYS--TGSLTDQYKMLRVELEGYQKGL-GDRASTIVINKIDLSG--KSPEEE 321          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Fly
Match: Non1 (gene:FBgn0028473 transcript:FBtr0300649)

HSP 1 Score: 456.833 bits (1174), Expect = 6.567e-153
Identity = 227/459 (49.46%), Postives = 316/459 (68.85%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALE 1379
            M  ++FK I VVP +K+ +DI+LSKTQRKTPTV+HK  +I   R FY RKVK  QQNFHD++ +I++DFP +  +H FYA+LMN LY +  YK AL  LN  +  VD +AKD+ +L+K+GDS YRCK LK+ ALG+M  I+ +  +  +L YLE+ RQHLSRLPTID  +RT+I+CGFPNVGKSSF+NKI+RADV+VQPYAFTTKSL+VGH DY+ LRWQ IDTPG+LD PL E N  EM AITAL  L  A VL+ +D+SE+CG+S+++QV L  +I+ LF NKPLI+ +NKID++  E LPEE + +I   K  E + + ++ MST+ + GVM+ +  AC+ +L+ RV  K+    +  + NRL+VA  +  P ++ +    +       LL+  +    K+K   EI++E G+ +  D ++ +      ++YDIIPE + GHNIAD  YID D  +
Sbjct:    1 MSLYNFKKIMVVPPAKDFIDIMLSKTQRKTPTVVHKGYKISRIRAFYTRKVKYTQQNFHDRLSQIIQDFPKLDDVHPFYADLMNVLYDKDHYKLALGQLNTARHLVDNVAKDYVRLLKYGDSLYRCKQLKKAALGRMATIMKRQAS--NLTYLEQVRQHLSRLPTIDPYSRTIIICGFPNVGKSSFINKITRADVEVQPYAFTTKSLYVGHTDYKYLRWQVIDTPGILDHPLEERNVIEMQAITALAHL-RACVLYFMDISEQCGHSLEEQVKLFESIKPLFTNKPLILAINKIDILTPEDLPEERRAII--TKLQEDKNIPVMLMSTVQETGVMEVKTEACERLLSYRVDQKMRTKKVDNILNRLHVA--MPAPRDDKLRAPCIPEKASARLLQNADKAERKRKLEKEIEEEMGDDYTLDLKKNYSEIPEEERYDIIPEFWQGHNIAD--YIDADIFD 450          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Fly
Match: Non1 (gene:FBgn0028473 transcript:FBtr0088554)

HSP 1 Score: 456.833 bits (1174), Expect = 6.567e-153
Identity = 227/459 (49.46%), Postives = 316/459 (68.85%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALE 1379
            M  ++FK I VVP +K+ +DI+LSKTQRKTPTV+HK  +I   R FY RKVK  QQNFHD++ +I++DFP +  +H FYA+LMN LY +  YK AL  LN  +  VD +AKD+ +L+K+GDS YRCK LK+ ALG+M  I+ +  +  +L YLE+ RQHLSRLPTID  +RT+I+CGFPNVGKSSF+NKI+RADV+VQPYAFTTKSL+VGH DY+ LRWQ IDTPG+LD PL E N  EM AITAL  L  A VL+ +D+SE+CG+S+++QV L  +I+ LF NKPLI+ +NKID++  E LPEE + +I   K  E + + ++ MST+ + GVM+ +  AC+ +L+ RV  K+    +  + NRL+VA  +  P ++ +    +       LL+  +    K+K   EI++E G+ +  D ++ +      ++YDIIPE + GHNIAD  YID D  +
Sbjct:    1 MSLYNFKKIMVVPPAKDFIDIMLSKTQRKTPTVVHKGYKISRIRAFYTRKVKYTQQNFHDRLSQIIQDFPKLDDVHPFYADLMNVLYDKDHYKLALGQLNTARHLVDNVAKDYVRLLKYGDSLYRCKQLKKAALGRMATIMKRQAS--NLTYLEQVRQHLSRLPTIDPYSRTIIICGFPNVGKSSFINKITRADVEVQPYAFTTKSLYVGHTDYKYLRWQVIDTPGILDHPLEERNVIEMQAITALAHL-RACVLYFMDISEQCGHSLEEQVKLFESIKPLFTNKPLILAINKIDILTPEDLPEERRAII--TKLQEDKNIPVMLMSTVQETGVMEVKTEACERLLSYRVDQKMRTKKVDNILNRLHVA--MPAPRDDKLRAPCIPEKASARLLQNADKAERKRKLEKEIEEEMGDDYTLDLKKNYSEIPEEERYDIIPEFWQGHNIAD--YIDADIFD 450          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Fly
Match: CG13390 (gene:FBgn0032031 transcript:FBtr0079723)

HSP 1 Score: 60.8474 bits (146), Expect = 1.771e-9
Identity = 50/162 (30.86%), Postives = 79/162 (48.77%), Query Frame = 3
Query:  507 STRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQN-LRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAG-VLFIIDLSEKCGNSIQQQVALLGNIRALFG---NKPLIVGLNKIDVVK----FEQLPEEDQQLIMGIKTMEGQEV 965
            S   V L G+PN GKS+ LN ++RA   V PYAFTT    +G   Y + ++    D PGL    + + + ++   I  L   E    +LF++D S     +  +Q  L+  +R   G   ++P +V  NK+DV +    FE+L    Q  ++GI    G  +
Sbjct:  204 SMADVGLIGYPNAGKSTLLNALTRAKPKVAPYAFTTLRPHLGTVQYDDHVQLTIADLPGL----VPDAHRNKGLGIQFLKHAERCTLLLFVLDASAPEPWTHYEQ--LMHELRQFGGRLASRPQLVVANKLDVEEGQNNFEELQRRLQNPVLGISAKMGHNL 359          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Fly
Match: CG6195 (gene:FBgn0038723 transcript:FBtr0083803)

HSP 1 Score: 50.8322 bits (120), Expect = 2.476e-6
Identity = 21/57 (36.84%), Postives = 35/57 (61.40%), Query Frame = 3
Query:  519 VILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLD 689
            V L GFP+VGKS+ L+ +++ + +   Y FTT +   G  +YQ    Q +D PG+++
Sbjct:   64 VALIGFPSVGKSTMLSTLTKTESEAANYEFTTLTCIPGVIEYQGANIQLLDLPGIIE 120          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Zebrafish
Match: gtpbp4 (GTP binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5982])

HSP 1 Score: 523.087 bits (1346), Expect = 5.633e-179
Identity = 294/648 (45.37%), Postives = 415/648 (64.04%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLL------DDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTV--ESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVP++K+ +D+ LSKTQRKTPTVIHK  QI   R FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ +D +AKD+ +L+K+GDS YRCK LKR ALG+M  I+ +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADV+VQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL E N+ EM AITAL  L  A VL+++D+SE+CG+++ QQ+ L  NIR LF NKPLIV  NK DV K  +L EE+Q++   + T EG  V ++  S++T+EGVM  +  ACD +LT RV  K++   +H++ NRL++A    +      P      L +K  +E + P   K+K   +++ E G+ ++ D ++ W + NP +K D IPEI+ GHNIAD  YID + ++     E+         + +  E   +   +E R LA +I E   LK + + EK +T G + + R  K +  A +++ M  LG+ +  + D+    ++RS  + R         S  R++          R +SG+RD K   KV+ M K SQ+ +NR G++GE+DRH+ D KPKHL  GKR  G   RR
Sbjct:    1 MALYNFKKIMVVPTAKDFIDVTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFPKLDDIHPFYADLMNVLYDKDHYKLALGQINIAKNLIDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTILKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVEVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEERNTIEMQAITALAHL-RAAVLYVMDVSEQCGHTLSQQLELFNNIRPLFANKPLIVMANKCDVRKISELSEENQKIFADL-TAEG--VDVIETSSLTEEGVMQVKTEACDRLLTHRVDTKMKSKKVHDVLNRLHLAIPTKRDEKARPPFIPEGALLRKKAMETDAP---KRKLERDLEVELGDDYILDLQKYWDLMNPDEKQDKIPEIWEGHNIAD--YIDPEIMKRLEDLEQEEELREKAGEYDSEEESEDEEMQEIRHLASQIREKRKLKIIASKEK-DTNGPR-LPRTAKKVERATLEKEMSDLGLDMNNKDDSHYARRSRSLVRKRKREVSAPPTSRTRSQ----SASRPPRDQSGVRDAKMLKKVKTMMKSSQKGMNREGRKGESDRHVFDVKPKHLLAGKRKSGSTSRR 631          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Zebrafish
Match: mtg2 (mitochondrial ribosome-associated GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2209])

HSP 1 Score: 62.003 bits (149), Expect = 8.548e-10
Identity = 49/149 (32.89%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  525 LCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQN-LRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGV-LFIIDLSE-KCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDV----VKFEQLPEEDQQLIMGIKTM 950
            L GFPNVGKSS L  IS+A   V  Y FTT +  VG  +Y++  +    D PGL+  P A  N      ++ L  +E   V L+++D+S  +     QQ    L   R LF  +P  +  NK+D+       E L E   Q ++ +  +
Sbjct:  199 LVGFPNVGKSSLLRAISKARPAVAAYPFTTLNPHVGIVEYRDHTQVAVADIPGLI--PGAHLNRG--LGLSFLRHIERCRVLLYVLDMSSPEPWEQFQQLCFELDQYRPLFSQRPHAIVANKMDLPESRANLEALRERISQTVIPVSAL 343          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Zebrafish
Match: drg2 (developmentally regulated GTP binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-040808-29])

HSP 1 Score: 51.2174 bits (121), Expect = 2.403e-6
Identity = 21/57 (36.84%), Postives = 36/57 (63.16%), Query Frame = 3
Query:  519 VILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLD 689
            V L GFP+VGKS+FL+ +++ + +   Y FTT +   G  +Y+    Q +D PG+++
Sbjct:   65 VALIGFPSVGKSTFLSLMTKTESEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIE 121          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Zebrafish
Match: drg2 (developmentally regulated GTP binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-040808-29])

HSP 1 Score: 51.2174 bits (121), Expect = 2.403e-6
Identity = 21/57 (36.84%), Postives = 36/57 (63.16%), Query Frame = 3
Query:  519 VILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLD 689
            V L GFP+VGKS+FL+ +++ + +   Y FTT +   G  +Y+    Q +D PG+++
Sbjct:   65 VALIGFPSVGKSTFLSLMTKTESEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIE 121          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Xenopus
Match: wnt7c (wingless-type MMTV integration site family, member 7c [Source:Xenbase;Acc:XB-GENE-5835754])

HSP 1 Score: 526.554 bits (1355), Expect = 3.937e-180
Identity = 295/646 (45.67%), Postives = 421/646 (65.17%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLL---DDVNFYEIKHEPLPEET---RVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVP +K+ +D+ LSKTQRKTPTVIHK  QI   R+FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  LN  K+ +D +AKD+ +L+K+GDS YRCK LKR ALG+M  II +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADV+VQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL E N+ EM AITAL  L  A +L+++D+SE+CG++I+QQ+ L  NIR LF NKPLI+ +NK D+ +  +LP+E +++    + +E + + ++  ST+TDEGVM  +  ACD +L  RV  K++   ++++ NRL++A    +     +P      L +K  +  + P   KK+   +I+ E G+ ++ D ++ W + NP+++ D +PEI+ GHNIAD  YID + ++     EK     +    Y+   E   EE    R LA++I E + LK L++ EK     R  + R  K +   ++++ M  LG+ +         A++RS++    RK+ E     + + SR      R +SG+RD K   K +K+ K SQ+K NR GK+GEADRH+ D KPKHL  GKR  GK DRR
Sbjct:    1 MALYNFKKIMVVPPAKDFIDLTLSKTQRKTPTVIHKHYQINRIRQFYMRKVKYTQQNYHDRLSQILTDFPKLDDVHPFYADLMNVLYDKDHYKLALGQLNIAKNLIDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVEVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEERNTIEMQAITALAHL-RAAILYVMDISEQCGHTIEQQLELFNNIRPLFSNKPLIIVMNKCDIKRVSELPDEQRKI---FQDLESEGLTVIETSTLTDEGVMTVKTEACDRLLVHRVETKMKGNKVNDVLNRLHLAVPSKRDEKERLPFIPEGALARKKRMVTDAP---KKRLEKDIEVEMGDDYILDLQKYWDLMNPSERTDKVPEIWQGHNIAD--YIDPEIMKKLEELEKEEELREGAGEYDSDIESEDEEMTEIRELAQQIREKKKLKILESKEKDIHAPR--LPRTVKKVQRKSLEKEMSSLGLDMTEKDQTHYAAQARSRSLQRKRKRDESEPPVSAARSRSSSKTPRDQSGMRDVKMVKKAKKIMKNSQKKGNRLGKRGEADRHVFDLKPKHLLAGKRKSGKTDRR 633          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Xenopus
Match: wnt7c (wingless-type MMTV integration site family, member 7c [Source:Xenbase;Acc:XB-GENE-5835754])

HSP 1 Score: 511.531 bits (1316), Expect = 3.027e-174
Identity = 287/631 (45.48%), Postives = 411/631 (65.13%), Query Frame = 3
Query:   48 KELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLL---DDVNFYEIKHEPLPEET---RVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            ++ +D+ LSKTQRKTPTVIHK  QI   R+FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  LN  K+ +D +AKD+ +L+K+GDS YRCK LKR ALG+M  II +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADV+VQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL E N+ EM AITAL  L  A +L+++D+SE+CG++I+QQ+ L  NIR LF NKPLI+ +NK D+ +  +LP+E +++    + +E + + ++  ST+TDEGVM  +  ACD +L  RV  K++   ++++ NRL++A    +     +P      L +K  +  + P   KK+   +I+ E G+ ++ D ++ W + NP+++ D +PEI+ GHNIAD  YID + ++     EK     +    Y+   E   EE    R LA++I E + LK L++ EK     R  + R  K +   ++++ M  LG+ +         A++RS++    RK+ E     + + SR      R +SG+RD K   K +K+ K SQ+K NR GK+GEADRH+ D KPKHL  GKR  GK DRR
Sbjct:   13 QDFIDLTLSKTQRKTPTVIHKHYQINRIRQFYMRKVKYTQQNYHDRLSQILTDFPKLDDVHPFYADLMNVLYDKDHYKLALGQLNIAKNLIDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVEVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEERNTIEMQAITALAHL-RAAILYVMDISEQCGHTIEQQLELFNNIRPLFSNKPLIIVMNKCDIKRVSELPDEQRKI---FQDLESEGLTVIETSTLTDEGVMTVKTEACDRLLVHRVETKMKGNKVNDVLNRLHLAVPSKRDEKERLPFIPEGALARKKRMVTDAP---KKRLEKDIEVEMGDDYILDLQKYWDLMNPSERTDKVPEIWQGHNIAD--YIDPEIMKKLEELEKEEELREGAGEYDSDIESEDEEMTEIRELAQQIREKKKLKILESKEKDIHAPR--LPRTVKKVQRKSLEKEMSSLGLDMTEKDQTHYAAQARSRSLQRKRKRDESEPPVSAARSRSSSKTPRDQSGMRDVKMVKKAKKIMKNSQKKGNRLGKRGEADRHVFDLKPKHLLAGKRKSGKTDRR 630          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Xenopus
Match: wnt7c (wingless-type MMTV integration site family, member 7c [Source:Xenbase;Acc:XB-GENE-5835754])

HSP 1 Score: 505.368 bits (1300), Expect = 5.866e-172
Identity = 287/633 (45.34%), Postives = 409/633 (64.61%), Query Frame = 3
Query:   48 KELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLL---DDVNFYEIKHEPLPEET---RVLAKKIAEAEDLKKLDNIEKTNTTGR--KTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            ++ +D+ LSKTQRKTPTVIHK  QI   R+FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  LN  K+ +D +AKD+ +L+K+GDS YRCK LKR ALG+M  II +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADV+VQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL E N+ EM AITAL  L  A +L+++D+SE+CG++I+QQ+ L  NIR LF NKPLI+ +NK D+ +  +LP+E +++    + +E + + ++  ST+TDEGVM  +  ACD +L  RV  K++   ++++ NRL++A    +     +P      L +K  +  + P   KK+   +I+ E G+ ++ D ++ W + NP+++ D +PEI+ GHNIAD  YID + ++     EK     +    Y+   E   EE    R LA++I E + LK L++ EK     R  +T+ +A    T   +       G ++E        A++RS++    RK+ E     + + SR      R +SG+RD K   K +K+ K SQ+K NR GK+GEADRH+ D KPKHL  GKR  GK DRR
Sbjct:   11 QDFIDLTLSKTQRKTPTVIHKHYQINRIRQFYMRKVKYTQQNYHDRLSQILTDFPKLDDVHPFYADLMNVLYDKDHYKLALGQLNIAKNLIDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVEVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEERNTIEMQAITALAHL-RAAILYVMDISEQCGHTIEQQLELFNNIRPLFSNKPLIIVMNKCDIKRVSELPDEQRKI---FQDLESEGLTVIETSTLTDEGVMTVKTEACDRLLVHRVETKMKGNKVNDVLNRLHLAVPSKRDEKERLPFIPEGALARKKRMVTDAP---KKRLEKDIEVEMGDDYILDLQKYWDLMNPSERTDKVPEIWQGHNIAD--YIDPEIMKKLEELEKEEELREGAGEYDSDIESEDEEMTEIRELAQQIREKKKLKILESKEKDIHAPRLPRTVKKASDGGTGCWVTS----WGHSLEGSYTTHYAAQARSRSLQRKRKRDESEPPVSAARSRSSSKTPRDQSGMRDVKMVKKAKKIMKNSQKKGNRLGKRGEADRHVFDLKPKHLLAGKRKSGKTDRR 628          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Xenopus
Match: wnt7c (wingless-type MMTV integration site family, member 7c [Source:Xenbase;Acc:XB-GENE-5835754])

HSP 1 Score: 496.893 bits (1278), Expect = 7.184e-169
Identity = 286/646 (44.27%), Postives = 404/646 (62.54%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLL---DDVNFYEIKHEPLPEET---RVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVP +K+ +D+ LSKTQRKTPTVIHK  QI   R+FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  LN  K+ +D +AKD+ +L+K+GDS YRCK LKR ALG+M  II +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADV+VQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL E N+ EM AITAL  L  A +L+++D+SE+CG++I+QQ+ L  NIR LF NK +                          + +E + + ++  ST+TDEGVM  +  ACD +L  RV  K++   ++++ NRL++A    +     +P      L +K  +  + P   KK+   +I+ E G+ ++ D ++ W + NP+++ D +PEI+ GHNIAD  YID + ++     EK     +    Y+   E   EE    R LA++I E + LK L++ EK     R  + R  K +   ++++ M  LG+ +         A++RS++    RK+ E     + + SR      R +SG+RD K   K +K+ K SQ+K NR GK+GEADRH+ D KPKHL  GKR  GK DRR
Sbjct:    1 MALYNFKKIMVVPPAKDFIDLTLSKTQRKTPTVIHKHYQINRIRQFYMRKVKYTQQNYHDRLSQILTDFPKLDDVHPFYADLMNVLYDKDHYKLALGQLNIAKNLIDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVEVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEERNTIEMQAITALAHL-RAAILYVMDISEQCGHTIEQQLELFNNIRPLFSNKKI-------------------------FQDLESEGLTVIETSTLTDEGVMTVKTEACDRLLVHRVETKMKGNKVNDVLNRLHLAVPSKRDEKERLPFIPEGALARKKRMVTDAP---KKRLEKDIEVEMGDDYILDLQKYWDLMNPSERTDKVPEIWQGHNIAD--YIDPEIMKKLEELEKEEELREGAGEYDSDIESEDEEMTEIRELAQQIREKKKLKILESKEKDIHAPR--LPRTVKKVQRKSLEKEMSSLGLDMTEKDQTHYAAQARSRSLQRKRKRDESEPPVSAARSRSSSKTPRDQSGMRDVKMVKKAKKIMKNSQKKGNRLGKRGEADRHVFDLKPKHLLAGKRKSGKTDRR 611          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Xenopus
Match: wnt7c (wingless-type MMTV integration site family, member 7c [Source:Xenbase;Acc:XB-GENE-5835754])

HSP 1 Score: 478.404 bits (1230), Expect = 7.489e-162
Identity = 278/631 (44.06%), Postives = 392/631 (62.12%), Query Frame = 3
Query:   48 KELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLL---DDVNFYEIKHEPLPEET---RVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            ++ +D+ LSKTQRKTPTVIHK  QI   R+FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  LN  K+ +D +AKD+ +L+K+GDS YRCK LKR ALG+M  II +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADV+VQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL E N+ EM AITAL  L  A +L+++D+SE+CG++I+QQ+ L  NIR LF NKPLI+ +NK D+ +  +LP+E +                                 ACD +L  RV  K++   ++++ NRL++A    +     +P      L +K  +  + P   KK+   +I+ E G+ ++ D ++ W + NP+++ D +PEI+ GHNIAD  YID + ++     EK     +    Y+   E   EE    R LA++I E + LK L++ EK     R  + R  K +   ++++ M  LG+ +         A++RS++    RK+ E     + + SR      R +SG+RD K   K +K+ K SQ+K NR GK+GEADRH+ D KPKHL  GKR  GK DRR
Sbjct:   13 QDFIDLTLSKTQRKTPTVIHKHYQINRIRQFYMRKVKYTQQNYHDRLSQILTDFPKLDDVHPFYADLMNVLYDKDHYKLALGQLNIAKNLIDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVEVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEERNTIEMQAITALAHLR-AAILYVMDISEQCGHTIEQQLELFNNIRPLFSNKPLIIVMNKCDIKRVSELPDEQR---------------------------------ACDRLLVHRVETKMKGNKVNDVLNRLHLAVPSKRDEKERLPFIPEGALARKKRMVTDAP---KKRLEKDIEVEMGDDYILDLQKYWDLMNPSERTDKVPEIWQGHNIAD--YIDPEIMKKLEELEKEEELREGAGEYDSDIESEDEEMTEIRELAQQIREKKKLKILESKEKDIHAPR--LPRTVKKVQRKSLEKEMSSLGLDMTEKDQTHYAAQARSRSLQRKRKRDESEPPVSAARSRSSSKTPRDQSGMRDVKMVKKAKKIMKNSQKKGNRLGKRGEADRHVFDLKPKHLLAGKRKSGKTDRR 600          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Mouse
Match: Gtpbp4 (GTP binding protein 4 [Source:MGI Symbol;Acc:MGI:1916487])

HSP 1 Score: 514.998 bits (1325), Expect = 8.966e-176
Identity = 298/647 (46.06%), Postives = 414/647 (63.99%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLL------DDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEIS-ELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVPS+K+ +D+ LSKTQRKTPTVIHK  QI   R FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ VD +AKD+ +L+K+GDS YRCK LKR ALG+M  II +   + SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADVDVQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL + N+ EM AITAL  L  A VL+++DLSE+CG+ +++Q+ L  NIR LF NKPLIV  NK DV +  +L EEDQ++ + ++  EG  V  +  ST+T+EGV+  +  ACD +L  RV  K++   ++E+ NRL++A    + +    P      + ++  +E E P   KKK   +++ E G+ ++ D ++ W + N ++KYD IPEI+ GHN+AD  YID   ++     EK         + +      +    E R LAK+I E + LK L + EK     R  + R  K +  A ++  M+ LGV ++         ++R       ++K E S    + + SR      R  SG+RD K   K + M K +Q+K+NR GK+GEADRH+ D KPKHL +GKR  GK DRR
Sbjct:    1 MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILSDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--RQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHL-RAAVLYVMDLSEQCGHGLKEQLELFQNIRPLFINKPLIVVANKCDVKRIAELSEEDQKIFLDLQA-EGFPV--IETSTLTEEGVIQVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAVPNKRDDKERPPFIPEGVIARRKRMEIEEP---KKKRERDLELEMGDDYILDLQKYWDLMNSSEKYDKIPEIWEGHNVAD--YIDPAIMKKLEELEKEEELRTAAGEYDSDSESEDEEMMEIRQLAKQIREKKKLKILQSKEKNKQGPR--MPRTAKKVQRADLENEMRSLGVDMDDKNNAHYAVQARRSRSVTRKRKREESVPPSSTARSRSCSRTPRDVSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR 634          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Mouse
Match: Gtpbp4 (GTP binding protein 4 [Source:MGI Symbol;Acc:MGI:1916487])

HSP 1 Score: 213.772 bits (543), Expect = 1.385e-65
Identity = 98/151 (64.90%), Postives = 121/151 (80.13%), Query Frame = 3
Query:  210 PDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQ 662
            P  K +H FYA+LMN LY +  YK AL  +N  K+ VD +AKD+ +L+K+GDS YRCK LKR ALG+M  II +   + SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADVDVQPYAFTTKSLFVGH DY+ LRWQ
Sbjct:   13 PSAKDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--RQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQ 161          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Mouse
Match: Gtpbp10 (GTP-binding protein 10 (putative) [Source:MGI Symbol;Acc:MGI:2385599])

HSP 1 Score: 51.9878 bits (123), Expect = 1.608e-6
Identity = 57/193 (29.53%), Postives = 93/193 (48.19%), Query Frame = 3
Query:  519 VILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRW-QFIDTPGLLDRPLAECNSSEMCAITALDALEEA-GVLFIIDLSEKCGNSIQ------QQVALLGNIRALF----GNKPLIVGLNKIDV----VKFEQL------PEEDQQL----IMGIKTMEGQEVKMVSMSTMTDEGVMDARN 1019
            V L GFPN GKSS L+++S A   +  YAFTT    +G   Y + +     D PGL++   A  N         L  LE    +LF++D+S    +S+       + + LL     L+      KP ++ +NK+D+    VK ++L      PE+   L    ++  K +E Q +  V +ST+T EG+ + ++
Sbjct:  151 VGLVGFPNAGKSSLLSRVSHATPVIADYAFTTLRPELGKIMYNDFKQISVADLPGLIEG--AHMNKG--MGHKFLKHLERTRQLLFVVDISGFQLSSVTPYRTAFETIILLTKELELYKEELQTKPALLAINKMDLPDAQVKLQELMKQLLSPEDFLHLFETKMIPEKALEFQHI--VPISTVTGEGIAELKS 337          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Mouse
Match: Drg2 (developmentally regulated GTP binding protein 2 [Source:MGI Symbol;Acc:MGI:1342307])

HSP 1 Score: 49.6766 bits (117), Expect = 8.958e-6
Identity = 30/107 (28.04%), Postives = 51/107 (47.66%), Query Frame = 3
Query:  378 CKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTID---TSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLD 689
             +T K  A    + ++   + K   Q LE  +   S+    D   +    V L GFP+VGKS+FL+ ++    +   Y FTT +   G  +Y+    Q +D PG+++
Sbjct:   15 ARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASSKGEGFDVMKSGDARVALIGFPSVGKSTFLSLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIE 121          
BLAST of Nucleolar GTP-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9BZE4|NOG1_HUMAN (Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4 PE=1 SV=3)

HSP 1 Score: 524.628 bits (1350), Expect = 1.050e-178
Identity = 301/650 (46.31%), Postives = 423/650 (65.08%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDAL---------EVFRREEKLLDDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVES-DAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVPS+K+ +D+ LSKTQRKTPTVIHK  QI   R FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ VD +AKD+ +L+K+GDS YRCK LKR ALG+M  +I +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADVDVQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL + N+ EM AITAL  L  A VL+++DLSE+CG+ +++Q+ L  NIR LF NKPLIV  NK DV +  +L E+DQ++   +++ EG  V  +  ST+T+EGV+  +  ACD +L  RV  K++   ++E+ NRL++A    + +    P      + ++  +E E    ++KK   +++ E G+ ++ D ++ W + N ++K+D IPEI+ GHNIAD  YID   +         E  R      D V+  E   E L  E R LAK+I E + LK L++ EK NT G + + R  K +    +++ M+ LGV ++  D    +    RS++ +  RK+ + +   + + S       R  SG+RD K   K + M K +Q+K+NR GK+GEADRH+ D KPKHL +GKR  GK DRR
Sbjct:    1 MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTVIKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHL-RAAVLYVMDLSEQCGHGLREQLELFQNIRPLFINKPLIVVANKCDVKRIAELSEDDQKIFTDLQS-EGFPV--IETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPTRRDDKERPPFIPEGVVARRKRMETEE---SRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIAD--YIDPAIMKKLEELEKEEELRTAAGEYDSVSESE-DEEML--EIRQLAKQIREKKKLKILESKEK-NTQGPR-MPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR 634          
BLAST of Nucleolar GTP-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q99ME9|NOG1_MOUSE (Nucleolar GTP-binding protein 1 OS=Mus musculus OX=10090 GN=Gtpbp4 PE=1 SV=3)

HSP 1 Score: 514.998 bits (1325), Expect = 6.272e-175
Identity = 298/647 (46.06%), Postives = 414/647 (63.99%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLL------DDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEIS-ELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVPS+K+ +D+ LSKTQRKTPTVIHK  QI   R FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ VD +AKD+ +L+K+GDS YRCK LKR ALG+M  II +   + SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADVDVQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL + N+ EM AITAL  L  A VL+++DLSE+CG+ +++Q+ L  NIR LF NKPLIV  NK DV +  +L EEDQ++ + ++  EG  V  +  ST+T+EGV+  +  ACD +L  RV  K++   ++E+ NRL++A    + +    P      + ++  +E E P   KKK   +++ E G+ ++ D ++ W + N ++KYD IPEI+ GHN+AD  YID   ++     EK         + +      +    E R LAK+I E + LK L + EK     R  + R  K +  A ++  M+ LGV ++         ++R       ++K E S    + + SR      R  SG+RD K   K + M K +Q+K+NR GK+GEADRH+ D KPKHL +GKR  GK DRR
Sbjct:    1 MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILSDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--RQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHL-RAAVLYVMDLSEQCGHGLKEQLELFQNIRPLFINKPLIVVANKCDVKRIAELSEEDQKIFLDLQA-EGFPV--IETSTLTEEGVIQVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAVPNKRDDKERPPFIPEGVIARRKRMEIEEP---KKKRERDLELEMGDDYILDLQKYWDLMNSSEKYDKIPEIWEGHNVAD--YIDPAIMKKLEELEKEEELRTAAGEYDSDSESEDEEMMEIRQLAKQIREKKKLKILQSKEKNKQGPR--MPRTAKKVQRADLENEMRSLGVDMDDKNNAHYAVQARRSRSVTRKRKREESVPPSSTARSRSCSRTPRDVSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR 634          
BLAST of Nucleolar GTP-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q99P77|NOG1_RAT (Nucleolar GTP-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gtpbp4 PE=2 SV=3)

HSP 1 Score: 512.301 bits (1318), Expect = 7.260e-174
Identity = 301/653 (46.09%), Postives = 418/653 (64.01%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLLDDVNFYEIKHEPLPEETRV----------LAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEIS---ELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVPS+K+ +D+ LSKTQRKTPTVIHK  QI   R FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ VD +AKD+ +L+K+GDS YRCK LKR ALG+M  II +   + SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADVDVQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL + N+ EM AITAL  L  A VL+++DLSE+CG+ +++Q+ L  NIR LF NKPLIV  +K +V +  +L EEDQ++ + ++  EG  V  +  ST+T+EGV+  +  ACD +L  RV  K++   ++E+ NRL++A    + +    P      + ++  +E   P   KKK   +++ E G+ ++ D ++ W + N ++KYD IPEI+ GHN AD  YID     + ++ E+L       E     +P   RV          LAK+I E + LK L + EK NT G + + R  K +  A ++  M+ LGV ++         R+R       ++K E S      A+S SR      R  SG+RD K   K + M K +Q+K+NR GK+GEADRH+ D KPKHL +GKR  GK +RR
Sbjct:    1 MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILSDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--RQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHVDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHL-RAAVLYVMDLSEQCGHGLKEQLGLFQNIRPLFINKPLIVVASKCEVKRIAELSEEDQKIFLDLQA-EGFPV--IETSTLTEEGVIQVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAVPNKRDDKERPPFIPEGVVARRKRMEIAEP---KKKRERDLELEMGDDYILDLQKYWDLMNSSEKYDKIPEIWEGHNAAD--YIDP---AIMKKLEELEKGKKSSEQLLGSMPVSLRVKTRKWWKIRQLAKQIREKKKLKILQSKEK-NTQGPR-MPRTAKKVQRADLENEMRSLGVDMDDKDNAHYAVRARRSRSVTRKRKREESVPPSSIARSRSRSCSKTPRDVSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKERR 637          
BLAST of Nucleolar GTP-binding protein 1 vs. UniProt/SwissProt
Match: sp|O44411|NOG1_CAEEL (Nucleolar GTP-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=nog-1 PE=1 SV=1)

HSP 1 Score: 464.151 bits (1193), Expect = 1.922e-154
Identity = 282/694 (40.63%), Postives = 409/694 (58.93%), Query Frame = 3
Query:   12 HDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELK----NRLYVA------NKIVKPNNNMIPLEVLNRLEQKALLEAEN----------------PGCTKKKTLF----------------------EIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYID---NDALEVFRREEKLLDDVNFYEIKHEPLPEETR---VLAKKIAEAEDLKKLDNIEKTNTTGR---KTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            ++FK I  VP+++EL D+VLSKTQRKTPTV+H+   IG  R FY RK+K  QQ  HDK+ +I+ +FP ++ +H FY++LMN LY    YK AL  +N  +  +D IA+++ +L+K+ DS YRCK LKR ALG+MVK++ +   K+S +YLE+ RQHLSRLP+ID +TRT+ILCGFPNVGKSSF+N ++RADV+VQPYAFTTK+L+VGH DY+ LRWQ IDTPG+LD+PL + N+ EM A+TAL  L +A VLF++D+SE+C  SI++Q+ L  +IR LF NKP+++GLNK+D+     LP E   L   +  +E + + ++  ST+T EGVM  R+ ACD +L  RV  K++   I  ++    NR++VA       K+  P    +P  +  +  QK L EA+                 PG   K+ +                       EI+ E  + ++ D ++ +++KNP +KYDI+PEI+ GHN+ADF  +D      LE   REE+LL+    YE   +   EET+    LA +I E E L  LD+       GR   +     ++  + + ++  + +LGV V++      K      A+    KK+++   R+           R      DE+    V K+   + R + R  K+GEADRH+ D KPKHL  GKRG GK D R
Sbjct:    5 YNFKRITCVPNAQELKDVVLSKTQRKTPTVVHRQYSIGRIRAFYARKIKFLQQTLHDKLTQIITEFPKMEEIHPFYSDLMNILYDRDHYKIALGQMNTARHLIDGIAREYVRLMKYADSLYRCKMLKRAALGRMVKLLKRQ--KSSFEYLEQVRQHLSRLPSIDPATRTLILCGFPNVGKSSFINNVTRADVEVQPYAFTTKALYVGHLDYRFLRWQVIDTPGILDQPLEDRNTIEMQAVTALAHL-KASVLFMMDVSEQCDRSIEEQLHLFESIRPLFANKPVLIGLNKVDIRHRSDLPPEKAAL---LDQLEKEGIPIIETSTLTQEGVMGLRDRACDELLAQRVEAKIQAKKITNVEDCVLNRVFVAYPAPRDEKVRAP---FVPPGLAAKRAQKKLQEAQELMETDGDEFAAKIPQKPGKIGKEKIAKGGSQSTDLGDLRDENTRRLEREIELEMQDDYILDLKKHYMLKNPDEKYDIVPEIWEGHNLADF--VDPEIQSKLENLLREEELLEQAGEYESDLDSDDEETKEKLKLALQIREKEKLLTLDHAVNKRIAGRIGSRIHGSRKRDRSMSRLENELGELGVDVDTKK---MKNLQGQCAKPQLGKKMKVGRSRS---LSAVRPAPRDELAFPDEEKRAHVDKLRTKAMRGLRREAKKGEADRHVYDLKPKHLFCGKRGNGKTDWR 681          
BLAST of Nucleolar GTP-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9C6I8|NOG1_ARATH (Nucleolar GTP-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=At1g50920 PE=2 SV=1)

HSP 1 Score: 461.07 bits (1185), Expect = 2.343e-153
Identity = 281/690 (40.72%), Postives = 412/690 (59.71%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLI-----MGIKTMEG--QEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNM-----IPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDT--REEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEV---FRREEKLLD--------DVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINR---AQKSITTAAIQEGMKKLGVTVES----------------------DAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVP+ KE VDI+LS+TQR+TPTV+HK  +I   R+FY+RKVK  Q NFH K+  I+ +FP ++ +H FY +L++ LY +  YK AL  +N  ++ + +I+KD+ KL+K+GDS YRCK LK  ALG+M  ++ K +T  SL YLE+ RQH++RLP+ID +TRTV++CG+PNVGKSSF+NK++RADVDVQPYAFTTKSLFVGH DY+ LR+Q IDTPG+LDRP  + N  EMC+ITAL  L  A VLF +D+S  CG +I QQ AL  +I++LF NKPL++  NK D++  E + EED++LI       +KT  G  +E  ++ MST+TDEGVM  +NAAC+ +L  RV  K++   I++  NR +VA  I KP +++     IP  VL    ++A          K+KT  ++++E+G   VY    ++ +++++   K DI+PEI +GHN+ADF  ID D L+      REE + +        +++  ++  E L + + +  KK      L K   ++KT    R T+ R     K  TT  +   +  +G+   S                      DA  +   +  +K +    K   +S  R++  SR          G +D    +   K+S  S +K ++  ++GEADR I   +PKHL +GKRG GK DRR
Sbjct:    1 MVQYNFKRITVVPNGKEFVDIILSRTQRQTPTVVHKGYKINRLRQFYMRKVKYTQTNFHAKLSAIIDEFPRLEQIHPFYGDLLHVLYNKDHYKLALGQVNTARNLISKISKDYVKLLKYGDSLYRCKCLKVAALGRMCTVL-KRIT-PSLAYLEQIRQHMARLPSIDPNTRTVLICGYPNVGKSSFMNKVTRADVDVQPYAFTTKSLFVGHTDYKYLRYQVIDTPGILDRPFEDRNIIEMCSITALAHL-RAAVLFFLDISGSCGYTIAQQAALFHSIKSLFMNKPLVIVCNKTDLMPMENISEEDRKLIEEMKSEAMKTAMGASEEQVLLKMSTLTDEGVMSVKNAACERLLDQRVEAKMKSKKINDHLNRFHVA--IPKPRDSIERLPCIPQVVLEAKAKEAAAM------EKRKTEKDLEEENGGAGVYSASLKKNYILQHDEWKEDIMPEILDGHNVADF--IDPDILQRLAELEREEGIREAGVEEADMEMDIEKLSDEQLKQLSEIRKKKAI----LIKNHRLKKTVAQNRSTVPRKFDKDKKYTTKRMGRELSAMGLDPSSAMDRARSKSRGRKRDRSEDAGNDAMDVDDEQQSNKKQRVRSKSRAMSISRSQ--SRPPAHEVVPGEGFKDSTQKLSAIKISNKSHKKRDKNARRGEADRVIPTLRPKHLFSGKRGKGKTDRR 671          
BLAST of Nucleolar GTP-binding protein 1 vs. TrEMBL
Match: A0A267EHU4 (Nucleolar GTP-binding protein 1 OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013246g2 PE=3 SV=1)

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 313/656 (47.71%), Postives = 425/656 (64.79%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVA---NKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKK--KTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFR---REEKLLDDVNFYEIKHEPLPEETRVL---AKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDA-----PGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVP++K+ VDIVLSKTQRKTPTVIH+  QI   R+FY RKVK  QQ F+DK+  I+ +FP ++ LH FYA+L+N LY    YK AL  +N  +  V R+ +D+++L+K+GDS YRCK LKR ALG+M  I+      ++L YLE+ RQHLSRLP+I+ + R++ILCGFPNVGKSSFLNK++RADV+VQPY FTT+SL+VGH D++ LRWQ IDTPG+LD PL + N+ EM AITAL  L  A VLF +DLS +CG ++ QQV L  +IR LF NKPL+V  NK DV+K  +L EE + L+ G+++ EG  V ++ MS +T+EG++  +N ACDL+L  RV  KL    I E+ NRLYVA    +  KP   MIP E + R  Q   L A+     KK  K   EI+ E G+ +V D ++ WL++    K D IPEI+ GHNI DF  ID D LE  R   REE       +Y+I      +E + +   A+ I E + L+KL++ E+    G K + R  K ++T  ++EGM++LGV V++DA      G S++R R ++    R     ++   +S SR      RS SG+RD   A K R M+K SQRK N+  ++GEADRH+   KPKHL +GKRG+GK DRR
Sbjct:    1 MVQYNFKQITVVPTAKDFVDIVLSKTQRKTPTVIHRHYQISRIRQFYTRKVKFTQQTFYDKLTAIVTEFPRLEELHPFYADLINALYDRDHYKLALGQINTARHLVARVGQDYSRLLKYGDSLYRCKQLKRAALGRMATIMRGQ--SSTLAYLEQVRQHLSRLPSINPTGRSLILCGFPNVGKSSFLNKMTRADVEVQPYPFTTRSLYVGHMDHEYLRWQVIDTPGILDHPLEDRNNIEMLAITALAHL-RAAVLFFLDLSGQCGYTVPQQVHLFNSIRPLFANKPLVVCANKADVLKIAELDEESRALLDGLQS-EG--VPVMEMSNLTEEGLIRVKNEACDLLLKQRVEAKLAGKKIGEVANRLYVALPKPRDDKPRPPMIP-EAVTRKRQ---LAAQGIEVEKKPRKLEREIELEMGHDYVLDLQKNWLLEKEEWKQDAIPEIWEGHNIQDF--IDPDILERLRQLEREEDARAGAGYYDIDQPESDDEMQAIRHTARLIREKKALRKLESRERKGVKGAK-MPRTGKKMSTDDVEEGMEELGVDVDADATAHMSAGRSRSRLRDRSAQRRRDADVAADEERRSRSRSRSRPPRSESGVRDAAMAGKARLMAKQSQRKNNQLARKGEADRHVFIAKPKHLFSGKRGIGKTDRR 643          
BLAST of Nucleolar GTP-binding protein 1 vs. TrEMBL
Match: Q5ZM18 (Nucleolar GTP-binding protein 1 OS=Gallus gallus OX=9031 GN=GTPBP4 PE=2 SV=1)

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 301/648 (46.45%), Postives = 425/648 (65.59%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDAL------EVFRREEKLLDDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGV--TVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVPS+K+ +D+ LSKTQRKTPTVIHK  QI   R+FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ +D +AKD+ +L+K+GDS YRCK LKR ALG+M  II +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADV+VQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL + N+ EM AITAL  L  A VL+++D+SE+CG+S+++QV L  NI+ LF NKPLI+  NK DV + E+LPEE Q++    ++ E +   ++  ST+T+EGV+  +  ACD +L  RV  K++   ++E+ NRL++A    + N   +P      + +K  +E + P   K+K+  +++ E G+ +V D ++ W + N ++KYD IPEI+ GHNI D  YID D +      E      +   + +      +    E R LAK+I E + LK L + EK +T G + + R  K +    +++ M  LG+  T + DA        RS++ +  RK+ E    ++ + SR      R  SG+RDEK   KV+ M+K +Q+K+NR G++GEADRHI DTKPKHL  GKR  GK  RR
Sbjct:    1 MALYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRQFYMRKVKYTQQNYHDRLTQILTDFPKLDDIHPFYADLMNVLYDKDHYKLALGQINIAKNLIDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVEVQPYAFTTKSLFVGHMDYRYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHL-RAAVLYVMDVSEQCGHSLEEQVELFRNIKPLFANKPLIIVANKCDVKRIEELPEESQKI---FESFEAEGFSVIQTSTLTEEGVIQVKTEACDRLLAHRVDTKMKGNKVNEVLNRLHLAMPAKRDNKERLPFIPEGAIARKKRMEVDTP---KRKSERDLELEMGDDYVLDLQKYWDLMNSSEKYDKIPEIWQGHNILD--YIDPDIMKKLEELEKEEELREAAGEYDSEPESEDEEMMEIRQLAKRIREKKKLKILQSKEK-DTRGPR-MPRTAKKVQRKVLEKEMTDLGLDMTNKDDA----HYARRSRSVTRKRKRDESETPKSVARSRSSSRPPRDVSGLRDEKMVKKVKTMAKKAQKKMNRLGRKGEADRHIFDTKPKHLLAGKRKSGKTQRR 631          
BLAST of Nucleolar GTP-binding protein 1 vs. TrEMBL
Match: B7X613 (Nucleolar GTP-binding protein 1 OS=Xenopus laevis OX=8355 GN=gtpbp4 PE=1 SV=1)

HSP 1 Score: 533.487 bits (1373), Expect = 1.235e-179
Identity = 297/646 (45.98%), Postives = 420/646 (65.02%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLL---DDVNFYEIKHEPLPEET---RVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVP++K+ +D+ LSKTQRKTPTV+HK  QI   R FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  LN  K+ +D ++KD+ +L+K+GDS YRCK LKR ALG+M  II +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADV+VQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL E N+ EM AITAL  L  A +L+++D+SE+CG+SI+QQ+ L  NIR LF NKPLI+ +NK D+ +  +LPEE Q++    + +E + + ++  ST+T+EGVM  +  ACD +L  RV +K++   ++++ NRL++A    +     +P      LE+K  +  + P   KK+   +I+ E G+ ++ D ++ W + NP +K DIIPEI+ GHNIAD  YID + ++     EK     +    Y+   E   EE    R LA++I E + LK L + EK     R  + R  K +   ++++ M  LG+ +          ++RS++    RK+ E      +S SR      R +SG+RD K   K +K+ K SQ+K NR GK+GE DRH+ D KPKHL +GKR  GK D R
Sbjct:    1 MALYNFKKIMVVPAAKDFIDLTLSKTQRKTPTVVHKHYQINRIRHFYMRKVKYTQQNYHDRLSQILTDFPKLDDVHPFYADLMNVLYDKDHYKLALGQLNIAKNLIDNVSKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVEVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEERNTIEMQAITALAHLRSA-ILYVMDISEQCGHSIEQQLELFSNIRPLFSNKPLIIVVNKCDIKRVSELPEEQQKI---FQDLENEGLTVIETSTLTEEGVMTVKTEACDRLLVHRVENKMKGNKVNDVLNRLHLAIPAKRDGKERLPFIPEGALERKKRMVTDAP---KKRLERDIEMELGDDYILDLQKYWDLMNPTEKQDIIPEIWQGHNIAD--YIDPEIMKKLEELEKEEELREGAGEYDSDPESEDEEMVEIRELAQQIREKKKLKFLASKEKDIHGPR--LPRTAKKVQRKSLEKEMSSLGLDMTEKDETHYATQARSRSVQRKRKREESEPPATRSRSRSVSKTPRDQSGMRDVKMVKKAKKIMKNSQKKNNRLGKKGEGDRHVFDLKPKHLFSGKRKSGKTDSR 633          
BLAST of Nucleolar GTP-binding protein 1 vs. TrEMBL
Match: U3J2D4 (Nucleolar GTP-binding protein 1 OS=Anas platyrhynchos platyrhynchos OX=8840 PE=3 SV=2)

HSP 1 Score: 532.332 bits (1370), Expect = 2.725e-179
Identity = 298/646 (46.13%), Postives = 420/646 (65.02%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDAL------EVFRREEKLLDDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVPS+K+ +D+ LSKTQRKTPT+IHK  QI   R+FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ +D +AKD+ +L+K+GDS YRCK LKR ALG+M  II +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADV+VQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL + N+ EM AITAL  L  A VL+++D+SE+CG+S+++QV L  NI+ LF NKPLI+  NK DV +  +LPEE Q++    +T E +   ++  ST+T+EGV+  +  ACD +L  RV  K++   ++E+ NRL++A    + +   +P      + +K  +E + P   ++KT  +++ E G+ ++ D ++ W + N ++KYD IPEI+ GHNI D  YID D +      E      +   + +      +    E R LAK+I E + LK L + EK +T G + + R  K +    +++ M  LG+ + +        RSRS  R   R + E     A+  SR      R  SG+RDEK   KV+ M+K +Q K+NR G++GEADRHI DTKPKHL  GKR +GK  RR
Sbjct:    1 MALYNFKKITVVPSAKDFIDLTLSKTQRKTPTIIHKHYQIHRIRQFYMRKVKYTQQNYHDRLTQILTDFPKLDDIHPFYADLMNVLYDKDHYKLALGQINIAKNLIDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVEVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHL-RAAVLYVMDVSEQCGHSLEEQVELFRNIKPLFANKPLIIVANKCDVKRIAELPEESQKI---FETFEAEGFSVIETSTLTEEGVIQVKTEACDRLLAHRVDTKMKGNKVNEVLNRLHLAMPAKRDDKERLPFIPEGAIARKKRMEVDTP---RRKTERDLELEMGDDYILDLQKYWDLMNASEKYDKIPEIWQGHNILD--YIDPDIMKKLEELEKEEELREAAGEYDSEPESEDEEMMEIRQLAKQIREKKKLKILQSKEK-DTRGPR-MPRTAKKVQRKVLEKEMSDLGLDMTNKDDAHYARRSRSVTRKRKRDESETPTSVAR--SRSSSRPPRDVSGLRDEKMVKKVKTMAKKAQTKMNRMGRKGEADRHIFDTKPKHLLAGKRKMGKTQRR 631          
BLAST of Nucleolar GTP-binding protein 1 vs. TrEMBL
Match: A0A4U1EVT9 (Nucleolar GTP-binding protein 1 OS=Monodon monoceros OX=40151 GN=EI555_018087 PE=3 SV=1)

HSP 1 Score: 532.332 bits (1370), Expect = 3.777e-179
Identity = 305/651 (46.85%), Postives = 426/651 (65.44%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVA---NKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLLDD---VNFYEIKHEPLPEET---RVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQK-SITTAAIQEGMKKLGVTVES-DAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVPS+K+ +D+ LSKTQRKTPTVIHK  QI   R FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ VD +AKD+ +L+K+GDS YRCK LKR ALG+M  II +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADVDVQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL + N+ EM AITAL  L  A VL+++DLSE+CG+ + +Q+ L  NIR LF NKPLI+  NK DV +  +L E+DQ++ +G++  EG  V  V  ST+T+EGV+  +  ACD +L  RV  K++   ++E+ NRL++A    +  K     IP  V+ R ++  L      G  K++   +I+ E G+ ++ D ++ W I N ++K+D IPEI+ GHNIAD  YID D ++     EK  +       Y+ K E   EE    + LAK+I E + LK L + EK +T G +    A+K S+    +++ M+ LGV +++ D+        R+++ +  RK+ +     + +  R      R  SG+RD K   K + M K +Q+K+NR G++GEADRH+ D KPKHL +GKR  GK DRR
Sbjct:    1 MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHL-RAAVLYVMDLSEQCGHGLGEQLELFQNIRPLFVNKPLIIVANKCDVKRIAELSEDDQKIFLGLQA-EGFSV--VETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAVPSRRDDKERPPFIPEGVVARRKRMEL------GEPKRRRERDIELEMGDDYILDLQKYWDIMNSSEKHDKIPEIWEGHNIAD--YIDPDIMQKLEELEKEEELRTAAGVYDSKSETEDEEMVEIQQLAKQIREKKKLKILQSREK-DTQGPRMPRTAKKASVQQKVLEDEMRSLGVDMDNKDSAHYVVQARRARSVTRKRKREDSVPPTSVARIRSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGRKGEADRHVFDMKPKHLLSGKRKAGKKDRR 636          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Cavefish
Match: gtpbp4 (GTP binding protein 4 [Source:NCBI gene;Acc:103030518])

HSP 1 Score: 498.819 bits (1283), Expect = 1.728e-169
Identity = 291/646 (45.05%), Postives = 407/646 (63.00%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLL------DDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVP++K+ +D+ LSKTQRKTPTVIHK  QI   R FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ +D +AKD+ +L+K+GDS YRCK LKR ALG+M  I+ +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADV+VQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL E N+ EM AITAL  L  A VL+++D SE+CG+++ QQ  L  NIR LF NKPLI+  NK DV K  +L EE+Q+L   I   EG  + ++  ST+T+EGVM  +  ACD +L  RV  K++   +H++ NRL++A    +      P      L ++  +E + P   K+K   +++ E G+ +  D ++ W + N  +K D IPEI+ GHNIAD  YID + ++     EK         + +  E   +   +E R LA +I E   LK L++ EK     R  + R  + +  A +++ M  LG+ +          + RS++    RK+   +   +++ S+      R +SGIRD K   K + M K SQ+ +NR GK+GEADRH+ + KPKHL  GKR  G   RR
Sbjct:    1 MALYNFKKIMVVPTAKDFIDVTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLTQILTDFPKLDDIHPFYADLMNVLYDKDHYKLALGQINIAKNLIDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTILKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVEVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEERNTIEMQAITALAHLRSA-VLYVMDPSEQCGHTLSQQFELFSNIRPLFANKPLIIVANKCDVKKISELSEENQKLFTDI-LAEG--IPVIETSTLTEEGVMQVKTEACDKLLAHRVDSKMKGKKVHDVLNRLHLAVPAKRDQKERPPFIPEGALLRRKAMEVDVP---KRKLEKDLELELGDDYTLDLQKYWDLMNADEKTDKIPEIWEGHNIAD--YIDPEIMKRLSELEKEEELREQAGEYDSDEESEDEEMQEIRKLASQIREKRKLKILESKEKDVHGPR--LPRTARKVERATLEKEMGDLGLDMGDKDDSHYVQQGRSRSLVRKRKREASAPPTSRTRSQSASRPPRDKSGIRDAKMMKKSKTMMKNSQKGMNRQGKKGEADRHVFNLKPKHLLAGKRKSGSTSRR 633          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Cavefish
Match: gtpbp4 (GTP binding protein 4 [Source:NCBI gene;Acc:103030518])

HSP 1 Score: 468.003 bits (1203), Expect = 6.341e-158
Identity = 280/646 (43.34%), Postives = 389/646 (60.22%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLL------DDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVP++K+ +D+ LSKTQRKTPTVIHK  QI   R FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ +D +AKD+ +L+K+GDS YRCK LKR ALG+M  I+ +   K SL+YLE+ RQHLSRLPTID +TRT++LCG+PNVGKSSF+NK++RADV+VQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL E N+ EM AITAL  L  A VL+++D SE+CG+++ QQ  L  NIR LF NKPLI+  NK DV K  +L EE+Q                                 ACD +L  RV  K++   +H++ NRL++A    +      P      L ++  +E + P   K+K   +++ E G+ +  D ++ W + N  +K D IPEI+ GHNIAD  YID + ++     EK         + +  E   +   +E R LA +I E   LK L++ EK     R  + R  + +  A +++ M  LG+ +          + RS++    RK+   +   +++ S+      R +SGIRD K   K + M K SQ+ +NR GK+GEADRH+ + KPKHL  GKR  G   RR
Sbjct:    1 MALYNFKKIMVVPTAKDFIDVTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLTQILTDFPKLDDIHPFYADLMNVLYDKDHYKLALGQINIAKNLIDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTILKRQ--KQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVEVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEERNTIEMQAITALAHLRSA-VLYVMDPSEQCGHTLSQQFELFSNIRPLFANKPLIIVANKCDVKKISELSEENQ---------------------------------ACDKLLAHRVDSKMKGKKVHDVLNRLHLAVPAKRDQKERPPFIPEGALLRRKAMEVDVP---KRKLEKDLELELGDDYTLDLQKYWDLMNADEKTDKIPEIWEGHNIAD--YIDPEIMKRLSELEKEEELREQAGEYDSDEESEDEEMQEIRKLASQIREKRKLKILESKEKDVHGPR--LPRTARKVERATLEKEMGDLGLDMGDKDDSHYVQQGRSRSLVRKRKREASAPPTSRTRSQSASRPPRDKSGIRDAKMMKKSKTMMKNSQKGMNRQGKKGEADRHVFNLKPKHLLAGKRKSGSTSRR 603          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Cavefish
Match: drg2 (developmentally regulated GTP binding protein 2 [Source:NCBI gene;Acc:103036155])

HSP 1 Score: 50.0618 bits (118), Expect = 3.891e-6
Identity = 21/57 (36.84%), Postives = 35/57 (61.40%), Query Frame = 3
Query:  519 VILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLD 689
            V L GFP+VGKS+FL+ ++  + +   Y FTT +   G  +Y+    Q +D PG+++
Sbjct:   65 VALIGFPSVGKSTFLSLMTSTESEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIE 121          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Cavefish
Match: drg2 (developmentally regulated GTP binding protein 2 [Source:NCBI gene;Acc:103036155])

HSP 1 Score: 50.0618 bits (118), Expect = 4.455e-6
Identity = 21/57 (36.84%), Postives = 35/57 (61.40%), Query Frame = 3
Query:  519 VILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLD 689
            V L GFP+VGKS+FL+ ++  + +   Y FTT +   G  +Y+    Q +D PG+++
Sbjct:   65 VALIGFPSVGKSTFLSLMTSTESEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIE 121          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Sea Lamprey
Match: gtpbp4 (GTP binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5982])

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 290/646 (44.89%), Postives = 424/646 (65.63%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDND---ALEVFRREEKL---LDDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVP+SK+ +DI LSKTQRKTPTVIH+  QI   R+FY+RK+K  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ +D +AKD+ +L+K+GDS YRCK LKR ALG+M  II +     SL+YLE+ RQHLSRLP+ID +TRT++LCG+PNVGKSSF+NKI+RADV+VQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL E N+ EM AITAL  L  A VL++ D SE+CG+S++QQ+ L  NIR LF NKPLI+  NK DVV+  +LPE+ +++    +  E + + ++  ST+T+EGV+  +  ACD +LT RV  K++   ++++ NRL++A    +     +P      L++K  +E   P   K++   +++ E G+ ++ + ++ W +K  +++YDI+PE++ GHNIADF  +D D    L+   +EE L     +    +   +      R LA +I E + L+ +++  K + T    + R  K +    +++ M +LG+ + +D  G   A  RS++ +  RK+ E  E  A++ SR +    R +SG+RD + A K + + K SQ+ + R G++GE DRHI D KPKHL TGKRG G NDRR
Sbjct:    1 MALYNFKKIMVVPTSKDFIDITLSKTQRKTPTVIHRHYQIARIRQFYMRKIKYTQQNYHDRLSQILTDFPKMDDVHPFYADLMNVLYDKDHYKLALGQINIAKNLIDNVAKDYVRLLKYGDSLYRCKQLKRAALGRMCTIIKRQT--QSLEYLEQVRQHLSRLPSIDPNTRTLLLCGYPNVGKSSFINKITRADVEVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEERNTIEMQAITALAHL-RAAVLYVTDPSEQCGHSLEQQLELFNNIRPLFANKPLIIVSNKCDVVRLSELPEDKRKV---FEDFEKENILVIETSTLTEEGVIKVKTEACDQLLTHRVDAKMKGKKVNDVLNRLHLAMPAKRDAKERLPFIPEGALKKKREMETSAP---KRRLERDLEMEMGDDYILEMQKHWDVKE-SERYDIVPELWEGHNIADF--VDPDILKKLDELEQEEGLRVAAGEYESEDESEDEEARHIRTLAARIREKKQLRIIESRLKESGTH---MPRTAKKVERKTLEKEMTELGLDM-TDKDGAHYATQRSRSVTRKRKRGESVESTARARSRSNSRPPRDQSGVRDLEMAKKAKLIMKKSQKPMGRKGRRGEGDRHIPDLKPKHLFTGKRGSGTNDRR 630          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005122.1 (pep scaffold:Pmarinus_7.0:GL483372:649:9649:-1 gene:ENSPMAG00000004654.1 transcript:ENSPMAT00000005122.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 9.451e-7
Identity = 22/72 (30.56%), Postives = 38/72 (52.78%), Query Frame = 3
Query:  519 VILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAIT 734
            V L GFP+VGKS+FL+ ++    +   Y FTT +   G  +Y     Q +D PG+++    +    ++ A+ 
Sbjct:   65 VALIGFPSVGKSTFLSLVTATASECASYEFTTLTCIPGVIEYNGANIQLLDLPGIIEGAARKGRGRQVIAVA 136          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Yeast
Match: NOG1 (Putative GTPase; associates with free 60S ribosomal subunits in the nucleolus and is required for 60S ribosomal subunit biogenesis; constituent of 66S pre-ribosomal particles; member of the ODN family of nucleolar G-proteins [Source:SGD;Acc:S000006014])

HSP 1 Score: 380.178 bits (975), Expect = 4.436e-124
Identity = 249/671 (37.11%), Postives = 383/671 (57.08%), Query Frame = 3
Query:   18 FKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLE-KPNIHELKNRLYVANKIVKPNNNMIPL-------------EVLNRLEQKALLEAENPGCT------KKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDII-PEI--------YNGHNIADFGYIDNDALEVFRREEKLLDDVNFYEIKHEPLPEETRVLAKK----IAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLG--VTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXX-XXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            +K I  V  + +L+DIVL++TQRKTPTVI    +I   R FY+RKVK   + F +K + ILK FP+I  +H F+ +LM+TLY +  YK +L+ ++  KS V+++A+D+ +L+KFG S ++CK LKR ALG+M  I+ K   +  L YLE+ RQH+ RLP+ID +TRT+++CG+PNVGKSSFL  I+++DVDVQPYAFTTKSL+VGH DY+ LR+Q IDTPG+LDRP  E N+ EM +I A+  L    VL+ +DLSE+CG +I+ QV L  +I+ LF NK ++V +NK D+++ E L EE  QL+  +K + G  V++++ S   +E VM+ RN AC+ +L +R+ +KL+ +  I+ + N+++VA    + +    P              E  NR +    +EAEN G        K K L E      ++W  D   E L  +  + YD + PEI             + + G+ ++D       EE++ D     E+  + + E+   +  +    IAEA + K L N        +  + R++ + +   ++E M  LG  ++   D    +  ++R   R +     +   L A + +        R   G+ D     K  +M+K+ +R+ NR  KQGE+DRH   +  KHL +GKRGVGK D R
Sbjct:    5 WKDIPTVAPANDLLDIVLNRTQRKTPTVIRPGFKITRIRAFYMRKVKYTGEGFVEKFEDILKGFPNINDVHPFHRDLMDTLYEKNHYKISLAAISRAKSLVEQVARDYVRLLKFGQSLFQCKQLKRAALGRMATIVKK--LRDPLAYLEQVRQHIGRLPSIDPNTRTLLICGYPNVGKSSFLRCITKSDVDVQPYAFTTKSLYVGHFDYKYLRFQAIDTPGILDRPTEEMNNIEMQSIYAIAHLRSC-VLYFMDLSEQCGFTIEAQVKLFHSIKPLFANKSVMVVINKTDIIRPEDLDEERAQLLESVKEVPG--VEIMTSSCQLEENVMEVRNKACEKLLASRIENKLKSQSRINNVLNKIHVAQPQARDDVKRTPFIPESVKNLKKYDPEDPNRRKLARDIEAENGGAGVFNVNLKDKYLLE-----DDEWKNDIMPEIL--DGKNVYDFLDPEIAAKLQALEEEEEKLENEGFYNSDD------EEEIYDGFEASEV--DDIKEKAAWIRNRQKTMIAEARNRKSLKN--------KAIMPRSKLTKSFGKMEEHMSTLGHDMSALQDKQNRAARKNRYVERGSDVVFGDQDALTASTENGVKLRQTDRLLDGVADGSMRSKADRMAKMERRERNRHAKQGESDRHNAVSLSKHLFSGKRGVGKTDFR 647          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Yeast
Match: RBG2 (Protein with a role in translation; forms a complex with Gir2p; has similarity to mammalian developmentally regulated GTP-binding protein [Source:SGD;Acc:S000003405])

HSP 1 Score: 54.299 bits (129), Expect = 3.085e-8
Identity = 24/56 (42.86%), Postives = 34/56 (60.71%), Query Frame = 3
Query:  519 VILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLL 686
            V+L G+P+VGKSS L KI+    ++  YAFTT +   G   YQ    Q +D PG++
Sbjct:   66 VVLIGYPSVGKSSLLGKITTTKSEIAHYAFTTLTSVPGVLKYQGAEIQIVDLPGII 121          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Yeast
Match: RBG1 (Member of the DRG family of GTP-binding proteins; associates with translating ribosomes; interacts with Tma46p, Ygr250cp, Gir2p and Yap1p via two-hybrid [Source:SGD;Acc:S000000034])

HSP 1 Score: 50.0618 bits (118), Expect = 6.789e-7
Identity = 22/62 (35.48%), Postives = 35/62 (56.45%), Query Frame = 3
Query:  504 TSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLD 689
            T   +V   GFP+VGKS+ L+K++  + +   Y FTT     G   Y+  + Q +D PG++D
Sbjct:   63 TGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTVPGVIRYKGAKIQMLDLPGIID 124          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Yeast
Match: MSS1 (Mitochondrial protein; forms a heterodimer complex with Mto1p that performs the 5-carboxymethylaminomethyl modification of the wobble uridine base in mitochondrial tRNAs; similar to human GTPBP3 [Source:SGD;Acc:S000004625])

HSP 1 Score: 46.595 bits (109), Expect = 9.294e-6
Identity = 44/168 (26.19%), Postives = 82/168 (48.81%), Query Frame = 3
Query:  519 VILCGFPNVGKSSFLNKISRADVD-VQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGV-----LFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGV 1004
            ++L G PNVGKSS +N ++  D+  V     TT+       +    +    DT G+ ++      SS+   +  +D  ++  V     LFI+D ++      +  +A L +    FGNK +I+ +NK D+V      +E  +++  ++T  G +  ++S+S  T EG+
Sbjct:  277 LVLLGAPNVGKSSLVNSLTNDDISIVSDIPGTTRDSIDAMINVNGYKVIICDTAGIREK------SSDKIEMLGIDRAKKKSVQSDLCLFIVDPTDLSKLLPEDILAHLSS--KTFGNKRIIIVVNKSDLVS----DDEMTKVLNKLQTRLGSKYPILSVSCKTKEGI 432          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Nematostella
Match: EDO48882 (Nucleolar GTP-binding protein 1 [Source:UniProtKB/TrEMBL;Acc:A7RHM9])

HSP 1 Score: 498.049 bits (1281), Expect = 6.139e-170
Identity = 241/458 (52.62%), Postives = 331/458 (72.27%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDAL 1376
            M  ++FK I VVP++K+ +DIVLSKTQRKTPTV+HK  +I   R+FY+RK+K  QQN+HDK+ +I+ DFP ++ +H FYA+LMN LY +  YK AL  +N  ++ +D +AKD+A+L+K+GDS +RCK LKR ALG+M  I+ +     SLQYLE+ RQHLSRLP+ID +TRT+++CGFPNVGKSSF+NK++RADVDVQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL E N+ EM AITAL  L  A VL++ D+SE+CG++++QQV L  NI+ LF NKPLIV LNKIDV++ E L EE ++L+ G    E + V ++ MST ++EGVMD RN ACDL+L  RV  K++   ++++ NRL+VA    + N    P      LE+K  ++ E  G   +K   ++++E G  +  D R++W +KN  +K D+IPEI+ G NIAD  YID D +
Sbjct:    1 MAHYNFKKITVVPTAKDFIDIVLSKTQRKTPTVVHKGYKISRIRQFYLRKIKYTQQNYHDKLSQIITDFPRLEDVHPFYADLMNVLYDKDHYKLALGQINTARNLIDNVAKDYARLMKYGDSLFRCKQLKRAALGRMCTIMKRQ--NQSLQYLEQVRQHLSRLPSIDPNTRTLLVCGFPNVGKSSFMNKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGVLDHPLEERNTIEMQAITALAHLRSA-VLYVTDISEQCGHTLEQQVELFNNIKPLFSNKPLIVVLNKIDVIRPEDLSEERKELLKGF---EQEGVTILPMSTFSEEGVMDVRNTACDLLLAQRVEVKMKSKKVNDIVNRLHVAMPTARDNKARPPCIPQAVLEKKKAMDVE--GSKTRKLAVDVERELGEDYYLDLRQQWDLKNKEEKGDVIPEIFLGKNIAD--YIDPDIM 448          

HSP 2 Score: 55.4546 bits (132), Expect = 5.862e-8
Identity = 27/56 (48.21%), Postives = 35/56 (62.50%), Query Frame = 3
Query: 1755 GIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            G+ + +   K + ++K  QRK+NR GK GEADR I    PKHL +GKR  GK  RR
Sbjct:  561 GLSNPEKKQKAKTLAKTVQRKMNRMGKAGEADRMIRTKMPKHLFSGKRKGGKTSRR 616          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Nematostella
Match: EDO26541 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBR4])

HSP 1 Score: 53.5286 bits (127), Expect = 1.058e-8
Identity = 23/35 (65.71%), Postives = 30/35 (85.71%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIH 107
            M  ++FK I VVP++K+ +DIVLSKTQRKTPTV+H
Sbjct:    1 MAHYNFKKITVVPTAKDFIDIVLSKTQRKTPTVVH 35          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Nematostella
Match: EDO46414 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ12])

HSP 1 Score: 52.373 bits (124), Expect = 2.911e-7
Identity = 44/131 (33.59%), Postives = 67/131 (51.15%), Query Frame = 3
Query:  519 VILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNL-RWQFIDTPGLLDRPLAECNSSEMCAITALDALEE-AGVLFIIDLSEKCGN----SIQQQVALLGNIRALFGNKPLIVGLNKIDVV 893
            V L GFPN GKS+ L  ISRA   V  Y FTT +  VG  +Y +  +    D PGL+  P A  N       T L  +E    +L+++D+S+K  +    S+Q+++ L    +    ++P  +  NKID+ 
Sbjct:  192 VGLVGFPNAGKSTLLRAISRATPTVAAYPFTTLNPSVGMVEYDDFSQIAVADIPGLI--PDAHLNKG--LGHTFLRHIERCCSLLYVLDISQKDFHSQFISLQRELELY---KKGLSSRPAAIVANKIDLA 315          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Nematostella
Match: EDO47586 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLD7])

HSP 1 Score: 47.7506 bits (112), Expect = 9.113e-6
Identity = 21/57 (36.84%), Postives = 32/57 (56.14%), Query Frame = 3
Query:  519 VILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLD 689
            V L GFP+VGKS+ L K+++       Y FTT +   G  +Y     Q +D PG+++
Sbjct:   66 VALIGFPSVGKSTLLTKLTQTQSACASYEFTTLTCIPGVINYNGANIQLLDLPGIIE 122          
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Medaka
Match: gtpbp4 (GTP binding protein 4 [Source:NCBI gene;Acc:101156680])

HSP 1 Score: 518.079 bits (1333), Expect = 5.419e-177
Identity = 290/647 (44.82%), Postives = 416/647 (64.30%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLLD------DVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEIS-ELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            M  ++FK I VVP++KE +DI LSKTQRKTPTV+HK  QI   R FY+RKVK  QQN+HD++ +IL DFP +  +H FYA+LMN LY +  YK AL  +N  K+ +D +AKD+ +L+K+GDS YRCK LKR ALG+M  I+ +   K+SL+YLE+ RQHLSRLP+ID +TRT++LCG+PNVGKSSF+NK++RADVDVQPYAFTTKSLFVGH DY+ LRWQ +DTPG+LD PL + N+ EM AITAL  L  A VL+++DLSE+CG+++Q+Q+ L  NIR LF NKPLI+  NK DV K  +L EE+Q+++  + T EG  + ++  ST+T+EGVM  +  ACD +L  RV  K++   +H++ NRL++A    +   +  P      L ++  +E + P   K+K   +++ E G+ ++ D ++ W + N  +K D IPE++ GHNIAD  YID D ++     EK  +      + +  +   +    E R LAK+I E + L  +++ EK     R  + R    +    +++ M +LG+ +          ++R     A ++K E S    +K+ S+      R +SG+RD K   K +K+ K SQ   NR G++GE+DRH+ D KPKHL  GKR  GK DRR
Sbjct:    1 MALYNFKKIMVVPTAKEFIDITLSKTQRKTPTVVHKHYQIHRIRHFYMRKVKFTQQNYHDRLTQILTDFPKLDDIHPFYADLMNVLYDKDHYKLALGQINIAKNLIDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTILKRQ--KSSLEYLEQVRQHLSRLPSIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYRYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHL-RAAVLYVMDLSEQCGHTLQEQLELFNNIRPLFANKPLIIVANKCDVKKISELTEENQKILADL-TTEG--IPVIETSTLTEEGVMQVKTEACDQLLAHRVNTKMKGKKVHDVLNRLHLAMPAKRDEKDRPPFIPDGALTRRRAMEVDAP---KRKLERDLELELGDDYILDLQKYWDLMNEDEKQDRIPEVWEGHNIAD--YIDPDIMKKLEDLEKEEELKERAGEYDSDDESEDEDMLEIRSLAKQIREKKQLMVMESREKDVHGPR--MPRTATRVERKKLEKEMSELGLDMSDKNDSHYAEQARRSRSVAKKRKRETSAPPTSKTRSQSASRPPRDQSGLRDAKMVKKAKKIMKNSQTDRNRDGRKGESDRHVYDLKPKHLLAGKRKSGKTDRR 634          
BLAST of Nucleolar GTP-binding protein 1 vs. Planmine SMEST
Match: SMESG000074998.1 (SMESG000074998.1)

HSP 1 Score: 1248.42 bits (3229), Expect = 0.000e+0
Identity = 640/640 (100.00%), Postives = 640/640 (100.00%), Query Frame = 3
Query:    3 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLLDDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGIXXXXXXXXXXXXXXXXIEISELRAKXXXXXXXXXXXXXXGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 1922
            MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLLDDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGISKARSRSKARSASRKKIEISELRAKSISRCDPSRSRSRSGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR
Sbjct:    1 MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRKVKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLNYVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASLQYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALEEAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFEQLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRVAHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPGCTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADFGYIDNDALEVFRREEKLLDDVNFYEIKHEPLPEETRVLAKKIAEAEDLKKLDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGISKARSRSKARSASRKKIEISELRAKSISRCDPSRSRSRSGIRDEKTAMKVRKMSKVSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR 640          
BLAST of Nucleolar GTP-binding protein 1 vs. Planmine SMEST
Match: SMESG000025280.1 (SMESG000025280.1)

HSP 1 Score: 50.0618 bits (118), Expect = 3.478e-6
Identity = 20/57 (35.09%), Postives = 35/57 (61.40%), Query Frame = 3
Query:  519 VILCGFPNVGKSSFLNKISRADVDVQPYAFTTKSLFVGHCDYQNLRWQFIDTPGLLD 689
            V L GFP+VGKS+ L+ +++ + +   Y FTT +   G  +Y+    Q +D PG+++
Sbjct:   65 VALIGFPSVGKSTLLSMLTKTESETASYEFTTLTCIPGVIEYKGANIQLLDLPGIIE 121          
The following BLAST results are available for this feature:
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GTPBP42.186e-17946.31GTP binding protein 4 [Source:HGNC Symbol;Acc:HGNC... [more]
GTPBP42.535e-5459.15GTP binding protein 4 [Source:HGNC Symbol;Acc:HGNC... [more]
DRG21.149e-631.71developmentally regulated GTP binding protein 2 [S... [more]
DRG25.445e-629.03developmentally regulated GTP binding protein 2 [S... [more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nog-11.511e-15540.63Nucleolar GTP-binding protein 1 [Source:UniProtKB... [more]
nog-11.511e-15540.63Nucleolar GTP-binding protein 1 [Source:UniProtKB... [more]
nog-11.511e-15540.63Nucleolar GTP-binding protein 1 [Source:UniProtKB... [more]
M01E5.21.226e-632.62pep chromosome:WBcel235:I:13277300:13280175:-1 gen... [more]
M01E5.21.226e-632.62pep chromosome:WBcel235:I:13277061:13280175:-1 gen... [more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Non16.567e-15349.46gene:FBgn0028473 transcript:FBtr0300649[more]
Non16.567e-15349.46gene:FBgn0028473 transcript:FBtr0088554[more]
CG133901.771e-930.86gene:FBgn0032031 transcript:FBtr0079723[more]
CG61952.476e-636.84gene:FBgn0038723 transcript:FBtr0083803[more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gtpbp45.633e-17945.37GTP binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
mtg28.548e-1032.89mitochondrial ribosome-associated GTPase 2 [Source... [more]
drg22.403e-636.84developmentally regulated GTP binding protein 2 [S... [more]
drg22.403e-636.84developmentally regulated GTP binding protein 2 [S... [more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt7c3.937e-18045.67wingless-type MMTV integration site family, member... [more]
wnt7c3.027e-17445.48wingless-type MMTV integration site family, member... [more]
wnt7c5.866e-17245.34wingless-type MMTV integration site family, member... [more]
wnt7c7.184e-16944.27wingless-type MMTV integration site family, member... [more]
wnt7c7.489e-16244.06wingless-type MMTV integration site family, member... [more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Gtpbp48.966e-17646.06GTP binding protein 4 [Source:MGI Symbol;Acc:MGI:1... [more]
Gtpbp41.385e-6564.90GTP binding protein 4 [Source:MGI Symbol;Acc:MGI:1... [more]
Gtpbp101.608e-629.53GTP-binding protein 10 (putative) [Source:MGI Symb... [more]
Drg28.958e-628.04developmentally regulated GTP binding protein 2 [S... [more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BZE4|NOG1_HUMAN1.050e-17846.31Nucleolar GTP-binding protein 1 OS=Homo sapiens OX... [more]
sp|Q99ME9|NOG1_MOUSE6.272e-17546.06Nucleolar GTP-binding protein 1 OS=Mus musculus OX... [more]
sp|Q99P77|NOG1_RAT7.260e-17446.09Nucleolar GTP-binding protein 1 OS=Rattus norvegic... [more]
sp|O44411|NOG1_CAEEL1.922e-15440.63Nucleolar GTP-binding protein 1 OS=Caenorhabditis ... [more]
sp|Q9C6I8|NOG1_ARATH2.343e-15340.72Nucleolar GTP-binding protein 1 OS=Arabidopsis tha... [more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EHU40.000e+047.71Nucleolar GTP-binding protein 1 OS=Macrostomum lig... [more]
Q5ZM180.000e+046.45Nucleolar GTP-binding protein 1 OS=Gallus gallus O... [more]
B7X6131.235e-17945.98Nucleolar GTP-binding protein 1 OS=Xenopus laevis ... [more]
U3J2D42.725e-17946.13Nucleolar GTP-binding protein 1 OS=Anas platyrhync... [more]
A0A4U1EVT93.777e-17946.85Nucleolar GTP-binding protein 1 OS=Monodon monocer... [more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gtpbp41.728e-16945.05GTP binding protein 4 [Source:NCBI gene;Acc:103030... [more]
gtpbp46.341e-15843.34GTP binding protein 4 [Source:NCBI gene;Acc:103030... [more]
drg23.891e-636.84developmentally regulated GTP binding protein 2 [S... [more]
drg24.455e-636.84developmentally regulated GTP binding protein 2 [S... [more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gtpbp40.000e+044.89GTP binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ENSPMAT00000005122.19.451e-730.56pep scaffold:Pmarinus_7.0:GL483372:649:9649:-1 gen... [more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
NOG14.436e-12437.11Putative GTPase; associates with free 60S ribosoma... [more]
RBG23.085e-842.86Protein with a role in translation; forms a comple... [more]
RBG16.789e-735.48Member of the DRG family of GTP-binding proteins; ... [more]
MSS19.294e-626.19Mitochondrial protein; forms a heterodimer complex... [more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO488826.139e-17052.62Nucleolar GTP-binding protein 1 [Source:UniProtKB... [more]
EDO265411.058e-865.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464142.911e-733.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475869.113e-636.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtpbp45.419e-17744.82GTP binding protein 4 [Source:NCBI gene;Acc:101156... [more]
back to top
BLAST of Nucleolar GTP-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000074998.10.000e+0100.00SMESG000074998.1[more]
SMESG000025280.13.478e-635.09SMESG000025280.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007287 ID=SMED30007287|Name=Nucleolar GTP-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1928bp
CAATGCCATCTCACGATTTTAAGTCAATTCAAGTGGTTCCATCGAGTAAA
GAGTTAGTTGATATAGTGTTATCAAAAACTCAACGCAAAACTCCCACTGT
TATTCACAAGAGTGCTCAAATTGGAACCCATAGAAAGTTTTATATAAGAA
AGGTCAAAGCTTGCCAACAAAATTTTCATGACAAGATTGACAAAATTCTT
AAAGATTTTCCTGATATTAAAAGTCTCCACAAATTTTATGCCAATCTCAT
GAATACTTTGTATGGTGAAACCGAATACAAATCTGCTTTAAGCCATTTAA
ATTATGTTAAAAGCAAAGTGGATAGAATTGCAAAAGATCATGCAAAATTA
ATAAAGTTTGGTGACTCTGCATATAGATGCAAAACATTAAAAAGAGTAGC
TCTCGGAAAAATGGTTAAAATTATTTCCAAAAGTGTTACCAAAGCAAGTT
TACAATATCTTGAAGAATGTCGCCAACATTTATCCAGATTGCCTACAATT
GATACTAGTACGCGTACTGTAATTCTATGTGGTTTTCCAAATGTTGGAAA
ATCTAGCTTCTTAAACAAAATAAGTCGTGCAGATGTTGATGTTCAACCAT
ATGCATTTACAACCAAATCTTTGTTTGTCGGTCATTGTGACTATCAAAAT
TTAAGATGGCAATTTATCGACACTCCTGGTTTATTAGATCGTCCATTAGC
TGAATGTAATTCTTCTGAAATGTGTGCCATTACAGCCCTCGATGCTCTTG
AAGAAGCAGGAGTTTTATTCATTATTGATTTATCTGAAAAATGTGGAAAT
TCAATTCAGCAACAGGTAGCATTATTAGGGAATATTAGAGCATTGTTTGG
TAACAAACCATTAATCGTTGGTTTGAATAAAATCGATGTTGTGAAATTTG
AACAGCTTCCAGAAGAAGATCAGCAATTGATAATGGGAATCAAAACAATG
GAGGGGCAAGAGGTGAAAATGGTTTCTATGTCAACCATGACAGATGAAGG
TGTAATGGATGCGAGAAATGCTGCCTGTGACCTTGTTTTGACCACTCGTG
TCGCTCACAAACTAGAAAAGCCGAATATTCATGAATTAAAGAATCGTCTG
TATGTCGCTAACAAAATTGTTAAACCAAACAATAACATGATCCCGTTGGA
GGTTCTAAATCGATTGGAACAGAAGGCATTGTTGGAGGCTGAGAATCCCG
GGTGCACTAAAAAGAAGACTTTGTTTGAAATACAGAAAGAAGATGGAAAT
AAATGGGTTTATGATACTCGTGAGGAGTGGTTGATAAAGAATCCTGCTGA
CAAATACGATATTATCCCCGAGATTTACAATGGACACAACATTGCTGATT
TCGGATATATCGATAATGATGCTCTTGAAGTGTTCCGAAGGGAAGAGAAG
CTTTTGGATGATGTTAATTTCTATGAAATTAAGCATGAGCCGTTGCCAGA
GGAGACTCGTGTCCTTGCTAAGAAAATAGCCGAAGCCGAAGACTTAAAGA
AATTAGATAATATCGAGAAAACCAACACCACCGGTAGGAAAACAATCAAC
AGAGCTCAGAAATCGATTACCACTGCTGCTATCCAGGAGGGAATGAAGAA
ATTAGGTGTGACTGTGGAATCTGATGCTCCAGGAATATCGAAAGCCCGAT
CTAGATCAAAGGCTAGATCAGCAAGTCGCAAGAAGATTGAAATTTCTGAA
TTACGAGCAAAATCGATTAGTAGGTGCGATCCATCACGATCGAGATCAAG
GTCTGGTATCAGAGATGAAAAGACTGCTATGAAGGTCAGGAAGATGTCCA
AGGTATCACAGAGAAAGATCAACAGATTCGGTAAACAAGGAGAAGCCGAT
AGGCATATTGGGGACACGAAACCGAAACATTTGAATACTGGCAAGAGAGG
CGTCGGTAAAAACGACAGACGATAATTT
back to top

protein sequence of SMED30007287-orf-1

>SMED30007287-orf-1 ID=SMED30007287-orf-1|Name=SMED30007287-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=641bp
MPSHDFKSIQVVPSSKELVDIVLSKTQRKTPTVIHKSAQIGTHRKFYIRK
VKACQQNFHDKIDKILKDFPDIKSLHKFYANLMNTLYGETEYKSALSHLN
YVKSKVDRIAKDHAKLIKFGDSAYRCKTLKRVALGKMVKIISKSVTKASL
QYLEECRQHLSRLPTIDTSTRTVILCGFPNVGKSSFLNKISRADVDVQPY
AFTTKSLFVGHCDYQNLRWQFIDTPGLLDRPLAECNSSEMCAITALDALE
EAGVLFIIDLSEKCGNSIQQQVALLGNIRALFGNKPLIVGLNKIDVVKFE
QLPEEDQQLIMGIKTMEGQEVKMVSMSTMTDEGVMDARNAACDLVLTTRV
AHKLEKPNIHELKNRLYVANKIVKPNNNMIPLEVLNRLEQKALLEAENPG
CTKKKTLFEIQKEDGNKWVYDTREEWLIKNPADKYDIIPEIYNGHNIADF
GYIDNDALEVFRREEKLLDDVNFYEIKHEPLPEETRVLAKKIAEAEDLKK
LDNIEKTNTTGRKTINRAQKSITTAAIQEGMKKLGVTVESDAPGISKARS
RSKARSASRKKIEISELRAKSISRCDPSRSRSRSGIRDEKTAMKVRKMSK
VSQRKINRFGKQGEADRHIGDTKPKHLNTGKRGVGKNDRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR041623NOG1_N
IPR006073GTP_binding_domain
IPR024926NOG1
IPR012973NOG_C
IPR010674NOG1_Rossman_fold_dom
IPR027417P-loop_NTPase
IPR031167G_OBG
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0003924GTPase activity
Vocabulary: cellular component
TermDefinition
GO:0005730nucleolus
GO:0048471perinuclear region of cytoplasm
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0016020membrane
GO:0031965nuclear membrane
Vocabulary: biological process
TermDefinition
GO:0042254ribosome biogenesis
GO:0050821protein stabilization
GO:0000079regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0000463maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001649osteoblast differentiation
GO:0008156negative regulation of DNA replication
GO:0008285negative regulation of cell proliferation
GO:0022408negative regulation of cell-cell adhesion
GO:0030336negative regulation of cell migration
GO:0031397negative regulation of protein ubiquitination
GO:0033342negative regulation of collagen binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006073GTP binding domainPRINTSPR00326GTP1OBGcoord: 173..193
score: 46.72
coord: 194..212
score: 27.59
NoneNo IPR availableGENE3DG3DSA:1.20.120.1190coord: 3..163
e-value: 1.2E-50
score: 173.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 164..371
e-value: 5.3E-50
score: 171.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 571..596
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 571..640
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 607..640
NoneNo IPR availablePANTHERPTHR45759FAMILY NOT NAMEDcoord: 1..640
NoneNo IPR availableCDDcd01897NOGcoord: 171..346
e-value: 2.86364E-78
score: 244.007
IPR041623NOG1, N-terminal helical domainPFAMPF17835NOG1_Ncoord: 6..167
e-value: 1.1E-42
score: 145.8
IPR024926Nucleolar GTP-binding protein 1PIRSFPIRSF038919NOG1coord: 1..640
e-value: 1.4E-200
score: 665.8
IPR024926Nucleolar GTP-binding protein 1PANTHERPTHR45759:SF1NUCLEOLAR GTP-BINDING PROTEIN 1coord: 1..640
IPR012973NOG, C-terminalPFAMPF08155NOGCTcoord: 404..451
e-value: 6.2E-14
score: 51.7
IPR010674Nucleolar GTP-binding protein 1, Rossman-fold domainPFAMPF06858NOG1coord: 239..295
e-value: 5.5E-17
score: 61.3
IPR031167OBG-type guanine nucleotide-binding (G) domainPROSITEPS51710G_OBGcoord: 171..346
score: 32.427
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 49..341