Potassium voltage-gated channel subfamily KQT member 1

Overview
NamePotassium voltage-gated channel subfamily KQT member 1
Smed IDSMED30007283
Length (bp)1194
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium voltage-gated channel subfamily KQT member 1 (SMED30007283) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium voltage-gated channel subfamily KQT member 1 (SMED30007283) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage-gated channel subfamily KQT member 1 (SMED30007283) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage-gated channel subfamily KQT member 1 (SMED30007283) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007283

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30007283SMESG000040474.1 SmedASXL_016124SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30007283SMESG000040474.1 dd_Smed_v4_14126_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30007283SMESG000040474.1 dd_Smed_v4_14126_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30007283SMESG000040474.1 dd_Smed_v6_14126_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ1 (potassium voltage-gated channel subfamily Q member 1 [Source:HGNC Symbol;Acc:HGNC:6294])

HSP 1 Score: 117.472 bits (293), Expect = 7.754e-31
Identity = 59/114 (51.75%), Postives = 81/114 (71.05%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA-----HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKL 1084
            L    +  I+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ++GKP+        + DR   TI  RL  +E K+T L+ ++A   +   ++L L
Sbjct:    2 LREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVTQLDQRLALITDMLHQLLSL 115          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ1 (potassium voltage-gated channel subfamily Q member 1 [Source:HGNC Symbol;Acc:HGNC:6294])

HSP 1 Score: 117.472 bits (293), Expect = 7.754e-31
Identity = 59/114 (51.75%), Postives = 81/114 (71.05%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA-----HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKL 1084
            L    +  I+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ++GKP+        + DR   TI  RL  +E K+T L+ ++A   +   ++L L
Sbjct:    2 LREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVTQLDQRLALITDMLHQLLSL 115          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ1 (potassium voltage-gated channel subfamily Q member 1 [Source:HGNC Symbol;Acc:HGNC:6294])

HSP 1 Score: 118.627 bits (296), Expect = 1.716e-28
Identity = 59/114 (51.75%), Postives = 82/114 (71.93%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNI-----DRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKL 1084
            L    +  I+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ++GKP+   ++     DR   TI  RL  +E K+T L+ ++A   +   ++L L
Sbjct:  379 LREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVTQLDQRLALITDMLHQLLSL 492          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ1 (potassium voltage-gated channel subfamily Q member 1 [Source:HGNC Symbol;Acc:HGNC:6294])

HSP 1 Score: 118.627 bits (296), Expect = 2.624e-28
Identity = 59/114 (51.75%), Postives = 82/114 (71.93%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNI-----DRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKL 1084
            L    +  I+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ++GKP+   ++     DR   TI  RL  +E K+T L+ ++A   +   ++L L
Sbjct:  506 LREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVTQLDQRLALITDMLHQLLSL 619          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ1 (potassium voltage-gated channel subfamily Q member 1 [Source:HGNC Symbol;Acc:HGNC:6294])

HSP 1 Score: 112.464 bits (280), Expect = 1.406e-27
Identity = 55/95 (57.89%), Postives = 70/95 (73.68%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA-----HRNNIDRHRMTIAQRLLVIEYKIT 1027
            L    +  I+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ++GKP+        + DR   TI  RL  +E K T
Sbjct:  208 LREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKST 302          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 124.02 bits (310), Expect = 8.390e-31
Identity = 61/117 (52.14%), Postives = 84/117 (71.79%), Query Frame = 2
Query:  749 VFSLNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAH---RNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLS 1090
            V  L  + + AIR +RR++Y+VARR+FQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLDQTLGKP     + +   H +TI  RL  +E +++ L+ KV  +    + + +L++
Sbjct:  417 VCELTDAHRNAIRAIRRVKYFVARRRFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDQTLGKPGQYDGKGSRKGHPVTIGSRLSRLELQMSSLDRKVESSNRTLNALYRLMA 533          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 124.02 bits (310), Expect = 8.390e-31
Identity = 61/117 (52.14%), Postives = 84/117 (71.79%), Query Frame = 2
Query:  749 VFSLNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAH---RNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLS 1090
            V  L  + + AIR +RR++Y+VARR+FQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLDQTLGKP     + +   H +TI  RL  +E +++ L+ KV  +    + + +L++
Sbjct:  417 VCELTDAHRNAIRAIRRVKYFVARRRFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDQTLGKPGQYDGKGSRKGHPVTIGSRLSRLELQMSSLDRKVESSNRTLNALYRLMA 533          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 124.405 bits (311), Expect = 8.493e-31
Identity = 60/102 (58.82%), Postives = 77/102 (75.49%), Query Frame = 2
Query:  749 VFSLNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAH---RNNIDRHRMTIAQRLLVIEYKITDLESKV 1045
            V  L  + + AIR +RR++Y+VARR+FQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLDQTLGKP     + +   H +TI  RL  +E +++ L+ KV
Sbjct:  458 VCELTDAHRNAIRAIRRVKYFVARRRFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDQTLGKPGQYDGKGSRKGHPVTIGSRLSRLELQMSSLDRKV 559          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 124.405 bits (311), Expect = 8.493e-31
Identity = 60/102 (58.82%), Postives = 77/102 (75.49%), Query Frame = 2
Query:  749 VFSLNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAH---RNNIDRHRMTIAQRLLVIEYKITDLESKV 1045
            V  L  + + AIR +RR++Y+VARR+FQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLDQTLGKP     + +   H +TI  RL  +E +++ L+ KV
Sbjct:  458 VCELTDAHRNAIRAIRRVKYFVARRRFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDQTLGKPGQYDGKGSRKGHPVTIGSRLSRLELQMSSLDRKV 559          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 124.02 bits (310), Expect = 1.010e-30
Identity = 61/117 (52.14%), Postives = 84/117 (71.79%), Query Frame = 2
Query:  749 VFSLNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAH---RNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLS 1090
            V  L  + + AIR +RR++Y+VARR+FQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLDQTLGKP     + +   H +TI  RL  +E +++ L+ KV  +    + + +L++
Sbjct:  454 VCELTDAHRNAIRAIRRVKYFVARRRFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDQTLGKPGQYDGKGSRKGHPVTIGSRLSRLELQMSSLDRKVESSNRTLNALYRLMA 570          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0299833)

HSP 1 Score: 93.5893 bits (231), Expect = 2.719e-20
Identity = 42/97 (43.30%), Postives = 71/97 (73.20%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHR-NNIDRHRMTIAQRLLVIEYKITDLESKV 1045
            L +  K AIR +R+++Y+VARRKF++  KPYDVKDV+EQY+ GH++++ R+K L  RLDQ LGK   +  ++   ++++A R++ +E ++ D+E K+
Sbjct:  395 LTNRHKTAIRFIRKLKYFVARRKFKEALKPYDVKDVMEQYAAGHVDLLGRVKMLHLRLDQILGKQGSKAKDVYASKISLASRVVKVERQVADIEEKL 491          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0301444)

HSP 1 Score: 93.5893 bits (231), Expect = 3.091e-20
Identity = 42/97 (43.30%), Postives = 71/97 (73.20%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHR-NNIDRHRMTIAQRLLVIEYKITDLESKV 1045
            L +  K AIR +R+++Y+VARRKF++  KPYDVKDV+EQY+ GH++++ R+K L  RLDQ LGK   +  ++   ++++A R++ +E ++ D+E K+
Sbjct:  614 LTNRHKTAIRFIRKLKYFVARRKFKEALKPYDVKDVMEQYAAGHVDLLGRVKMLHLRLDQILGKQGSKAKDVYASKISLASRVVKVERQVADIEEKL 710          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0301443)

HSP 1 Score: 93.5893 bits (231), Expect = 3.136e-20
Identity = 42/97 (43.30%), Postives = 71/97 (73.20%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHR-NNIDRHRMTIAQRLLVIEYKITDLESKV 1045
            L +  K AIR +R+++Y+VARRKF++  KPYDVKDV+EQY+ GH++++ R+K L  RLDQ LGK   +  ++   ++++A R++ +E ++ D+E K+
Sbjct:  429 LTNRHKTAIRFIRKLKYFVARRKFKEALKPYDVKDVMEQYAAGHVDLLGRVKMLHLRLDQILGKQGSKAKDVYASKISLASRVVKVERQVADIEEKL 525          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0310097)

HSP 1 Score: 93.5893 bits (231), Expect = 3.251e-20
Identity = 42/97 (43.30%), Postives = 71/97 (73.20%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHR-NNIDRHRMTIAQRLLVIEYKITDLESKV 1045
            L +  K AIR +R+++Y+VARRKF++  KPYDVKDV+EQY+ GH++++ R+K L  RLDQ LGK   +  ++   ++++A R++ +E ++ D+E K+
Sbjct:  429 LTNRHKTAIRFIRKLKYFVARRKFKEALKPYDVKDVMEQYAAGHVDLLGRVKMLHLRLDQILGKQGSKAKDVYASKISLASRVVKVERQVADIEEKL 525          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0310094)

HSP 1 Score: 93.5893 bits (231), Expect = 3.254e-20
Identity = 42/97 (43.30%), Postives = 71/97 (73.20%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHR-NNIDRHRMTIAQRLLVIEYKITDLESKV 1045
            L +  K AIR +R+++Y+VARRKF++  KPYDVKDV+EQY+ GH++++ R+K L  RLDQ LGK   +  ++   ++++A R++ +E ++ D+E K+
Sbjct:  444 LTNRHKTAIRFIRKLKYFVARRKFKEALKPYDVKDVMEQYAAGHVDLLGRVKMLHLRLDQILGKQGSKAKDVYASKISLASRVVKVERQVADIEEKL 540          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq1.1 (potassium voltage-gated channel, KQT-like subfamily, member 1.1 [Source:ZFIN;Acc:ZDB-GENE-061214-5])

HSP 1 Score: 114.775 bits (286), Expect = 3.351e-27
Identity = 62/115 (53.91%), Postives = 80/115 (69.57%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNI-----DRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLL 1087
            L  S + AIRV++RM Y+VAR+KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLD +LGK +          D+   TI  RL  ++ KIT ++     TLN+ +E L L+
Sbjct:  486 LRDSHRAAIRVIQRMYYFVARKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDHSLGKQSLFQTSSERLKDKGTNTIGSRLNRMDEKITHMD----RTLNSIAESLNLM 596          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq1.1 (potassium voltage-gated channel, KQT-like subfamily, member 1.1 [Source:ZFIN;Acc:ZDB-GENE-061214-5])

HSP 1 Score: 114.775 bits (286), Expect = 3.379e-27
Identity = 62/115 (53.91%), Postives = 80/115 (69.57%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNI-----DRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLL 1087
            L  S + AIRV++RM Y+VAR+KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLD +LGK +          D+   TI  RL  ++ KIT ++     TLN+ +E L L+
Sbjct:  498 LRDSHRAAIRVIQRMYYFVARKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDHSLGKQSLFQTSSERLKDKGTNTIGSRLNRMDEKITHMD----RTLNSIAESLNLM 608          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq5a (potassium voltage-gated channel, KQT-like subfamily, member 5a [Source:ZFIN;Acc:ZDB-GENE-090312-185])

HSP 1 Score: 95.1301 bits (235), Expect = 1.287e-20
Identity = 52/131 (39.69%), Postives = 79/131 (60.31%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNIDR--------------HRMTIAQRLLVIEYKITDLESKVAETLN--------NSSEMLKL 1084
            L++  K  IR +R M+++VA++KF++T +PYDVKDVIEQYS GHL+M+ R+K LQ R+DQ LGK   + ++DR              H M++  R+  +E ++  +ESK+   L+         SS ML L
Sbjct:  484 LSAPLKAVIRAIRIMKFHVAKKKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGK--GQISVDRKGREKILPEGESLEHDMSMLGRVCKVERQVQSIESKLDSLLDIYRQVLQKGSSSMLGL 612          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: CR388054.1 (potassium voltage-gated channel, KQT-like subfamily, member 5b [Source:NCBI gene;Acc:568646])

HSP 1 Score: 88.1965 bits (217), Expect = 1.845e-18
Identity = 48/129 (37.21%), Postives = 80/129 (62.02%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGK---PAHRNNIDR--------HRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQKFN 1111
            L S+ K  IR +R M+++VA++KF++T +PYDVKDVIEQYS GHL+M+ R+K LQ R+DQ LG+   P  +   ++          +++  R+  +E ++  +ESK+   L+   ++L+  S T   F+
Sbjct:  372 LPSALKTVIRAVRIMKFHVAKKKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGRGQMPVDKKVREKLLSDGDILEDVSMLGRVCKVERQVQSIESKLDSLLDIYRQVLQKGSSTALTFS 500          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: CR388054.1 (potassium voltage-gated channel, KQT-like subfamily, member 5b [Source:NCBI gene;Acc:568646])

HSP 1 Score: 88.5817 bits (218), Expect = 1.856e-18
Identity = 48/131 (36.64%), Postives = 80/131 (61.07%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNIDR-------------HRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQKFN 1111
            L S+ K  IR +R M+++VA++KF++T +PYDVKDVIEQYS GHL+M+ R+K LQ R+DQ LG+   +  +D+               +++  R+  +E ++  +ESK+   L+   ++L+  S T   F+
Sbjct:  392 LPSALKTVIRAVRIMKFHVAKKKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGR--GQMPVDKKVREKLLSDGDILEDVSMLGRVCKVERQVQSIESKLDSLLDIYRQVLQKGSSTALTFS 520          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: ENSXETT00000046816.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:100492908])

HSP 1 Score: 125.176 bits (313), Expect = 8.440e-31
Identity = 58/103 (56.31%), Postives = 77/103 (74.76%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA---HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETL 1057
            L  + ++A++V RRM+Y+VARRKFQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLD +LGKP        +D+   T+  RL+ +E K+  ++ K+ E L
Sbjct:  434 LTEAHRMAVKVTRRMQYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDHSLGKPGLFLPEKGVDKGYYTVGSRLMRLEEKVNRMDHKLDEIL 536          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: ENSXETT00000046772.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:100492908])

HSP 1 Score: 125.946 bits (315), Expect = 8.702e-31
Identity = 58/103 (56.31%), Postives = 77/103 (74.76%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA---HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETL 1057
            L  + ++A++V RRM+Y+VARRKFQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLD +LGKP        +D+   T+  RL+ +E K+  ++ K+ E L
Sbjct:  545 LTEAHRMAVKVTRRMQYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDHSLGKPGLFLPEKGVDKGYYTVGSRLMRLEEKVNRMDHKLDEIL 647          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: ENSXETT00000046791.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:100492908])

HSP 1 Score: 125.176 bits (313), Expect = 1.204e-30
Identity = 58/103 (56.31%), Postives = 77/103 (74.76%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA---HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETL 1057
            L  + ++A++V RRM+Y+VARRKFQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLD +LGKP        +D+   T+  RL+ +E K+  ++ K+ E L
Sbjct:  505 LTEAHRMAVKVTRRMQYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDHSLGKPGLFLPEKGVDKGYYTVGSRLMRLEEKVNRMDHKLDEIL 607          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: kri1 (KRI1 homolog [Source:Xenbase;Acc:XB-GENE-6036517])

HSP 1 Score: 118.242 bits (295), Expect = 1.812e-28
Identity = 61/112 (54.46%), Postives = 82/112 (73.21%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNI-----DRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEML 1078
            L    + AI+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ+LGKP+   ++     D+   TI  RL  +E K+T ++ K    LN  ++ML
Sbjct:  407 LKEHHRAAIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSLGKPSLFLSVSDKVKDKGSNTIGSRLNRVEDKVTQMDHK----LNLITDML 514          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: kri1 (KRI1 homolog [Source:Xenbase;Acc:XB-GENE-6036517])

HSP 1 Score: 118.242 bits (295), Expect = 2.977e-28
Identity = 62/115 (53.91%), Postives = 83/115 (72.17%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNI-----DRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLL 1087
            L    + AI+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ+LGKP+   ++     D+   TI  RL  +E K+T ++ K    LN  ++ML  L
Sbjct:  502 LKEHHRAAIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSLGKPSLFLSVSDKVKDKGSNTIGSRLNRVEDKVTQMDHK----LNLITDMLHHL 612          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq1 (potassium voltage-gated channel, subfamily Q, member 1 [Source:MGI Symbol;Acc:MGI:108083])

HSP 1 Score: 117.087 bits (292), Expect = 5.878e-28
Identity = 63/141 (44.68%), Postives = 88/141 (62.41%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNI-----DRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQKFNRNFKNEDCRSDCFAANEN 1165
            L    +  I+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ++GKP+    I     DR   TI  RL  +E K+T L+ ++    +   ++L +         +     + RS   A+NE 
Sbjct:  505 LRDHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKVTQLDQRLVIITDMLHQLLSM--------QQGGPTCNSRSQVVASNEG 637          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq5 (potassium voltage-gated channel, subfamily Q, member 5 [Source:MGI Symbol;Acc:MGI:1924937])

HSP 1 Score: 88.5817 bits (218), Expect = 1.981e-18
Identity = 38/64 (59.38%), Postives = 50/64 (78.12%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGK 949
            L    K  IR +R M+++VA+RKF++T +PYDVKDVIEQYS GHL+M+ R+K LQ R+DQ LGK
Sbjct:  506 LTPPLKTVIRAIRIMKFHVAKRKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGK 569          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq5 (potassium voltage-gated channel, subfamily Q, member 5 [Source:MGI Symbol;Acc:MGI:1924937])

HSP 1 Score: 88.5817 bits (218), Expect = 2.063e-18
Identity = 38/64 (59.38%), Postives = 50/64 (78.12%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGK 949
            L    K  IR +R M+++VA+RKF++T +PYDVKDVIEQYS GHL+M+ R+K LQ R+DQ LGK
Sbjct:  515 LTPPLKTVIRAIRIMKFHVAKRKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGK 578          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq5 (potassium voltage-gated channel, subfamily Q, member 5 [Source:MGI Symbol;Acc:MGI:1924937])

HSP 1 Score: 88.5817 bits (218), Expect = 2.157e-18
Identity = 38/64 (59.38%), Postives = 50/64 (78.12%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGK 949
            L    K  IR +R M+++VA+RKF++T +PYDVKDVIEQYS GHL+M+ R+K LQ R+DQ LGK
Sbjct:  534 LTPPLKTVIRAIRIMKFHVAKRKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGK 597          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq5 (potassium voltage-gated channel, subfamily Q, member 5 [Source:MGI Symbol;Acc:MGI:1924937])

HSP 1 Score: 82.0333 bits (201), Expect = 3.032e-16
Identity = 34/52 (65.38%), Postives = 45/52 (86.54%), Query Frame = 2
Query:  794 RRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGK 949
            R M+++VA+RKF++T +PYDVKDVIEQYS GHL+M+ R+K LQ R+DQ LGK
Sbjct:  417 RIMKFHVAKRKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGK 468          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|O73925|KCNQ1_SQUAC (Potassium voltage-gated channel subfamily KQT member 1 OS=Squalus acanthias OX=7797 GN=KCNQ1 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.751e-28
Identity = 62/115 (53.91%), Postives = 82/115 (71.30%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNI-----DRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLL 1087
            L  S +V ++V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ+LGKP    ++     DR + TI  RL  +E K   ++ K    LN  ++ML  L
Sbjct:  500 LRESHRVTVKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSLGKPTMFLSVSEKSQDRGKNTIGARLNRVEEKFVHMDQK----LNTITDMLHHL 610          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|P51787|KCNQ1_HUMAN (Potassium voltage-gated channel subfamily KQT member 1 OS=Homo sapiens OX=9606 GN=KCNQ1 PE=1 SV=3)

HSP 1 Score: 118.627 bits (296), Expect = 1.260e-27
Identity = 59/114 (51.75%), Postives = 82/114 (71.93%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNI-----DRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKL 1084
            L    +  I+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ++GKP+   ++     DR   TI  RL  +E K+T L+ ++A   +   ++L L
Sbjct:  506 LREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVTQLDQRLALITDMLHQLLSL 619          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|P70057|KCNQ1_XENLA (Potassium voltage-gated channel subfamily KQT member 1 OS=Xenopus laevis OX=8355 GN=kcnq1 PE=1 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 3.412e-27
Identity = 62/115 (53.91%), Postives = 83/115 (72.17%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNI-----DRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLL 1087
            L    + AI+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ+LGKP+   ++     D+   TI  RL  +E K+T ++ K    LN  ++ML  L
Sbjct:  495 LKEHHRAAIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSLGKPSLFLSVSDKVKDKGINTIGSRLNRVEDKVTQMDHK----LNLITDMLHHL 605          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|P97414|KCNQ1_MOUSE (Potassium voltage-gated channel subfamily KQT member 1 OS=Mus musculus OX=10090 GN=Kcnq1 PE=1 SV=3)

HSP 1 Score: 117.087 bits (292), Expect = 4.111e-27
Identity = 63/141 (44.68%), Postives = 88/141 (62.41%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNI-----DRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQKFNRNFKNEDCRSDCFAANEN 1165
            L    +  I+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ++GKP+    I     DR   TI  RL  +E K+T L+ ++    +   ++L +         +     + RS   A+NE 
Sbjct:  505 LRDHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKVTQLDQRLVIITDMLHQLLSM--------QQGGPTCNSRSQVVASNEG 637          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|O70344|KCNQ1_CAVPO (Potassium voltage-gated channel subfamily KQT member 1 OS=Cavia porcellus OX=10141 GN=KCNQ1 PE=2 SV=3)

HSP 1 Score: 117.087 bits (292), Expect = 4.215e-27
Identity = 58/114 (50.88%), Postives = 80/114 (70.18%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA-----HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKL 1084
            L    +  I+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ++GKP+        + DR   TI  RL  +E K+T L+ ++    +   ++L L
Sbjct:  507 LREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKVTQLDQRLVVITDMLHQLLSL 620          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A401NKI8 (KCNQ_channel domain-containing protein (Fragment) OS=Scyliorhinus torazame OX=75743 GN=scyTo_0004085 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 7.476e-32
Identity = 64/112 (57.14%), Postives = 84/112 (75.00%), Query Frame = 2
Query:  767 SQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA-----HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLL 1087
            S +V I+V+RRM+Y+VA++KFQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ+LGKP         + DR + TI  RL  +E K+ D++ K    LNN ++ML+ L
Sbjct:    3 SHRVTIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSLGKPTLFLSVSEKSQDRGKNTIGARLNRVEEKVVDMDQK----LNNITDMLQCL 110          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A183D3F8 (KCNQ_channel domain-containing protein OS=Gongylonema pulchrum OX=637853 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.168e-31
Identity = 60/99 (60.61%), Postives = 73/99 (73.74%), Query Frame = 2
Query:  743 F*VFSLNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNIDR--HRMTIAQRLLVIEYKITDL 1033
            F  + L  + K AIR +R+++Y+VARRKFQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLDQTLGKP      +R  H MTI  RL  +E ++   
Sbjct:    3 FSYYELTETHKNAIRAIRKIKYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDQTLGKPGQYQTHNRKGHSMTIGSRLCRVEMQVVPC 101          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A3P6Q8D0 (KCNQ_channel domain-containing protein OS=Gongylonema pulchrum OX=637853 GN=GPUH_LOCUS3248 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.191e-31
Identity = 60/99 (60.61%), Postives = 73/99 (73.74%), Query Frame = 2
Query:  743 F*VFSLNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNIDR--HRMTIAQRLLVIEYKITDL 1033
            F  + L  + K AIR +R+++Y+VARRKFQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLDQTLGKP      +R  H MTI  RL  +E ++   
Sbjct:    3 FSYYELTETHKNAIRAIRKIKYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDQTLGKPGQYQTHNRKGHSMTIGSRLCRVEMQVVPC 101          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A5A9PWU4 (Potassium voltage-gated channel subfamily KQT member 1 OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti021434 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.265e-30
Identity = 60/99 (60.61%), Postives = 75/99 (75.76%), Query Frame = 2
Query:  749 VFSLNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA---HRNNIDRHRMTIAQRLLVIEYKITDLE 1036
            V  L+ + K AI+V+RRM+Y+VARRKFQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLD TLGKP        +D+   T+  RL+ +E K + +E
Sbjct:   14 VLGLSHAHKSAIKVIRRMQYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDHTLGKPGMFLPEKGVDKEYHTVGARLIRLEDKSSPVE 112          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A0L8G0C9 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22002839mg PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.261e-30
Identity = 68/119 (57.14%), Postives = 89/119 (74.79%), Query Frame = 2
Query:  749 VFSLNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA--HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTL 1099
            VF L    KVAIRV+R+++Y+V+RRK  Q RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLDQ LGKP+  + N+ DR +MTI  R++ +E ++  ++ K    L+N  EML+ L K L
Sbjct:  357 VFHLTERHKVAIRVIRKIKYFVSRRKLLQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDQILGKPSTLYHNSRDRDKMTICARIVRVENQMVQMDQK----LDNVVEMLRNLMKHL 471          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.2 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:103028784])

HSP 1 Score: 127.872 bits (320), Expect = 9.832e-32
Identity = 64/119 (53.78%), Postives = 83/119 (69.75%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA---HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQK 1105
            L+ + + AI+V+RRM+Y+VARRKFQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLD TLGKP        +D+   T+  RL+ +E K+  ++ KV   L    E  +   + LQK
Sbjct:  573 LSHAHRSAIKVIRRMQYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDHTLGKPGLFLPEKGVDKEFHTVGARLIRLEDKVLQMDQKVENILKILVEQFQPKPELLQK 691          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.2 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:103028784])

HSP 1 Score: 127.872 bits (320), Expect = 1.132e-31
Identity = 64/119 (53.78%), Postives = 83/119 (69.75%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA---HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQK 1105
            L+ + + AI+V+RRM+Y+VARRKFQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLD TLGKP        +D+   T+  RL+ +E K+  ++ KV   L    E  +   + LQK
Sbjct:  596 LSHAHRSAIKVIRRMQYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDHTLGKPGLFLPEKGVDKEFHTVGARLIRLEDKVLQMDQKVENILKILVEQFQPKPELLQK 714          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.2 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:103028784])

HSP 1 Score: 127.872 bits (320), Expect = 1.226e-31
Identity = 64/119 (53.78%), Postives = 83/119 (69.75%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA---HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQK 1105
            L+ + + AI+V+RRM+Y+VARRKFQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLD TLGKP        +D+   T+  RL+ +E K+  ++ KV   L    E  +   + LQK
Sbjct:  579 LSHAHRSAIKVIRRMQYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDHTLGKPGLFLPEKGVDKEFHTVGARLIRLEDKVLQMDQKVENILKILVEQFQPKPELLQK 697          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.2 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:103028784])

HSP 1 Score: 121.709 bits (304), Expect = 1.110e-29
Identity = 57/91 (62.64%), Postives = 71/91 (78.02%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA---HRNNIDRHRMTIAQRLLVIEYK 1021
            L+ + + AI+V+RRM+Y+VARRKFQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLD TLGKP        +D+   T+  RL+ +E K
Sbjct:  596 LSHAHRSAIKVIRRMQYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDHTLGKPGLFLPEKGVDKEFHTVGARLIRLEDK 686          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.1 (potassium voltage-gated channel subfamily Q member 1 [Source:NCBI gene;Acc:103046994])

HSP 1 Score: 117.472 bits (293), Expect = 3.407e-28
Identity = 62/110 (56.36%), Postives = 82/110 (74.55%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA-HRNNIDRHR----MTIAQRLLVIEYKITDLE---SKVAETLNN 1063
            L  S + AIRV++RMRY+VA+++FQQ RKPYDV+DVIEQYSQGHLN+MVR+KELQRRLDQ+LGK    +   DR +     TI  RL  +E KIT ++   + +AE+LN+
Sbjct:  502 LRESHRAAIRVIQRMRYFVAKKRFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSLGKITLFQTGSDRAKDKGLNTIGSRLNRMEEKITHMDKTLNCIAESLNS 611          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: kcnq1.1 (potassium voltage-gated channel, KQT-like subfamily, member 1.1 [Source:ZFIN;Acc:ZDB-GENE-061214-5])

HSP 1 Score: 116.316 bits (290), Expect = 4.333e-29
Identity = 58/94 (61.70%), Postives = 70/94 (74.47%), Query Frame = 2
Query:  755 SLNSSQKVAIRVLRRMRYYVARRKFQQ-TRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKP---AHRNNIDRHRMTIAQRLLVIEYKI 1024
             L  S K+AIRV+RRM+Y+VAR KFQQ  +KPYDV+DVIEQYSQGH+NMMVR+KELQRRLD +LGKP         DR + TI  RL  +E K+
Sbjct:  350 GLTESHKIAIRVIRRMQYFVARSKFQQQAKKPYDVRDVIEQYSQGHVNMMVRIKELQRRLDHSLGKPNMFLSEKGKDRSKYTIGARLDRVEEKV 443          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001299.1 (pep scaffold:Pmarinus_7.0:GL481928:27736:29864:-1 gene:ENSPMAG00000001169.1 transcript:ENSPMAT00000001299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 6.352e-17
Identity = 35/63 (55.56%), Postives = 48/63 (76.19%), Query Frame = 2
Query:  791 LRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRR-LDQTLGKPAHRNNIDR 976
            LR M++ VA++KF++T +PYDVKDVIEQYS GHL+M+ R+K LQ R +DQ LG   H   ++R
Sbjct:    5 LRVMKFLVAKKKFKETLRPYDVKDVIEQYSAGHLDMLGRVKSLQARWVDQILGVRTHSGPVER 67          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003068.1 (pep scaffold:Pmarinus_7.0:GL481645:5707:7212:1 gene:ENSPMAG00000002804.1 transcript:ENSPMAT00000003068.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 2.073e-16
Identity = 32/57 (56.14%), Postives = 46/57 (80.70%), Query Frame = 2
Query:  749 VFSLNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKEL 919
            V  L  + ++AIR +R M+++VA+RKF++T +PYDVKDVIEQYS GHL+M+ R+K L
Sbjct:   68 VEELTPALRIAIRGVRIMKFHVAKRKFKETLRPYDVKDVIEQYSAGHLDMLSRIKSL 124          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009768.1 (pep scaffold:Pmarinus_7.0:GL477078:100805:104414:-1 gene:ENSPMAG00000008831.1 transcript:ENSPMAT00000009768.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 3.448e-16
Identity = 32/55 (58.18%), Postives = 42/55 (76.36%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQ 922
               S K  IR +R MR+ VA++KF++T +PYDVKDVIEQYS GHL+M+ R+K LQ
Sbjct:  123 FEPSVKAVIRAIRAMRFLVAKKKFKETLRPYDVKDVIEQYSAGHLDMLSRIKSLQ 177          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: ENSORLT00000035260.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:101166715])

HSP 1 Score: 122.865 bits (307), Expect = 5.673e-30
Identity = 60/103 (58.25%), Postives = 77/103 (74.76%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA---HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETL 1057
            L+ +Q+ A++VLRRM+Y+VARRKFQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLD TLGKP         D+   TI  +++ +E KI  ++ K+   L
Sbjct:  581 LSHAQRSAVKVLRRMQYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDGTLGKPGMFLPGKGEDKEYHTIGAQMIRLEEKIHQMDLKMDSVL 683          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: ENSORLT00000044551.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:101166715])

HSP 1 Score: 122.479 bits (306), Expect = 6.262e-30
Identity = 60/103 (58.25%), Postives = 77/103 (74.76%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPA---HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETL 1057
            L+ +Q+ A++VLRRM+Y+VARRKFQQ RKPYDV+DVIEQYSQGHLNMMVR+KELQRRLD TLGKP         D+   TI  +++ +E KI  ++ K+   L
Sbjct:  554 LSHAQRSAVKVLRRMQYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDGTLGKPGMFLPGKGEDKEYHTIGAQMIRLEEKIHQMDLKMDSVL 656          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: kcnq1.1 (potassium voltage-gated channel subfamily KQT member 1 [Source:NCBI gene;Acc:101161541])

HSP 1 Score: 111.694 bits (278), Expect = 3.223e-26
Identity = 63/115 (54.78%), Postives = 80/115 (69.57%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGK-PAHRNNIDRHR----MTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLL 1087
            L  S + AIRV++RMRY+VA+RKFQQ RKPYDV+DVIEQYSQGH+N+MVR+KELQRRLDQ+LGK    +   DR R     +I  RL  +E KI+ ++    +TL    E L  L
Sbjct:  518 LTESHRKAIRVVQRMRYFVAKRKFQQARKPYDVRDVIEQYSQGHVNLMVRIKELQRRLDQSLGKMTLFQTGTDRARDKGNNSIGSRLNRMEDKISHMD----QTLTLIMESLTFL 628          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: kcnq1.1 (potassium voltage-gated channel subfamily KQT member 1 [Source:NCBI gene;Acc:101161541])

HSP 1 Score: 111.694 bits (278), Expect = 3.282e-26
Identity = 63/115 (54.78%), Postives = 80/115 (69.57%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGK-PAHRNNIDRHR----MTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLL 1087
            L  S + AIRV++RMRY+VA+RKFQQ RKPYDV+DVIEQYSQGH+N+MVR+KELQRRLDQ+LGK    +   DR R     +I  RL  +E KI+ ++    +TL    E L  L
Sbjct:  499 LTESHRKAIRVVQRMRYFVAKRKFQQARKPYDVRDVIEQYSQGHVNLMVRIKELQRRLDQSLGKMTLFQTGTDRARDKGNNSIGSRLNRMEDKISHMD----QTLTLIMESLTFL 609          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: kcnq5a (potassium voltage-gated channel subfamily KQT member 5 [Source:NCBI gene;Acc:101161745])

HSP 1 Score: 93.2041 bits (230), Expect = 4.813e-20
Identity = 46/112 (41.07%), Postives = 72/112 (64.29%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGK---PA--------HRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLN 1060
            L++  K  IR +R M+++VA++KF++T +PYDVKDVIEQYS GHL+M+ R+K LQ R+DQ LGK   P         H +      M++  R+  +E +++ +ESK+   L+
Sbjct:  492 LSAPLKAVIRAVRIMKFHVAKKKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGKGQIPVEKKPRDKLHPDGDSLEGMSMLGRVCKVERQVSSIESKLDSLLD 603          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000040474.1 (SMESG000040474.1)

HSP 1 Score: 295.434 bits (755), Expect = 1.027e-95
Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQKFNRNFKNEDCRSDCFAANENEFNVSK 1183
            LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQKFNRNFKNEDCRSDCFAANENEFNVSK
Sbjct:  354 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQKFNRNFKNEDCRSDCFAANENEFNVSK 495          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000040474.1 (SMESG000040474.1)

HSP 1 Score: 295.434 bits (755), Expect = 2.343e-95
Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQKFNRNFKNEDCRSDCFAANENEFNVSK 1183
            LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQKFNRNFKNEDCRSDCFAANENEFNVSK
Sbjct:  386 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTLQKFNRNFKNEDCRSDCFAANENEFNVSK 527          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000028160.1 (SMESG000028160.1)

HSP 1 Score: 140.969 bits (354), Expect = 4.590e-40
Identity = 67/96 (69.79%), Postives = 80/96 (83.33%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNNIDRHRMTIAQRLLVIEYKITDLESKV 1045
            L +SQK AIRVLRR+RYYVAR+KFQQ RKPYDVKDV+EQYSQGHL+MMVR+KELQRRLDQ LGKPA   N D+ ++T+  +L  IE KIT +E+ V
Sbjct:   46 LTNSQKTAIRVLRRIRYYVARKKFQQARKPYDVKDVLEQYSQGHLSMMVRIKELQRRLDQVLGKPAQLENSDKCKVTVIHKLQYIENKITSIEASV 141          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000078022.1 (SMESG000078022.1)

HSP 1 Score: 127.872 bits (320), Expect = 2.362e-32
Identity = 58/98 (59.18%), Postives = 79/98 (80.61%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNN--IDRHRMTIAQRLLVIEYKITDLESKV 1045
            L+S QK AIRV R+++Y+VAR+KFQQ RKPYDV+DVIEQYSQG++NMMVRLKELQRR+DQT+GKP   N    D+ R T+  R++ +E ++  +++KV
Sbjct:  309 LSSEQKNAIRVFRKIKYFVARKKFQQARKPYDVRDVIEQYSQGNINMMVRLKELQRRIDQTIGKPFFWNTDLPDKQRPTVLSRMICVENQLCAIDTKV 406          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000078022.1 (SMESG000078022.1)

HSP 1 Score: 127.487 bits (319), Expect = 3.155e-32
Identity = 58/98 (59.18%), Postives = 79/98 (80.61%), Query Frame = 2
Query:  758 LNSSQKVAIRVLRRMRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGKPAHRNN--IDRHRMTIAQRLLVIEYKITDLESKV 1045
            L+S QK AIRV R+++Y+VAR+KFQQ RKPYDV+DVIEQYSQG++NMMVRLKELQRR+DQT+GKP   N    D+ R T+  R++ +E ++  +++KV
Sbjct:  313 LSSEQKNAIRVFRKIKYFVARKKFQQARKPYDVRDVIEQYSQGNINMMVRLKELQRRIDQTIGKPFFWNTDLPDKQRPTVLSRMICVENQLCAIDTKV 410          
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNQ17.754e-3151.75potassium voltage-gated channel subfamily Q member... [more]
KCNQ17.754e-3151.75potassium voltage-gated channel subfamily Q member... [more]
KCNQ11.716e-2851.75potassium voltage-gated channel subfamily Q member... [more]
KCNQ12.624e-2851.75potassium voltage-gated channel subfamily Q member... [more]
KCNQ11.406e-2757.89potassium voltage-gated channel subfamily Q member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kqt-38.390e-3152.14Potassium channel, KvQLT family [Source:UniProtKB... [more]
kqt-38.390e-3152.14Potassium channel, KvQLT family [Source:UniProtKB... [more]
kqt-38.493e-3158.82Potassium channel, KvQLT family [Source:UniProtKB... [more]
kqt-38.493e-3158.82Potassium channel, KvQLT family [Source:UniProtKB... [more]
kqt-31.010e-3052.14Potassium channel, KvQLT family [Source:UniProtKB... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNQ2.719e-2043.30gene:FBgn0033494 transcript:FBtr0299833[more]
KCNQ3.091e-2043.30gene:FBgn0033494 transcript:FBtr0301444[more]
KCNQ3.136e-2043.30gene:FBgn0033494 transcript:FBtr0301443[more]
KCNQ3.251e-2043.30gene:FBgn0033494 transcript:FBtr0310097[more]
KCNQ3.254e-2043.30gene:FBgn0033494 transcript:FBtr0310094[more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnq1.13.351e-2753.91potassium voltage-gated channel, KQT-like subfamil... [more]
kcnq1.13.379e-2753.91potassium voltage-gated channel, KQT-like subfamil... [more]
kcnq5a1.287e-2039.69potassium voltage-gated channel, KQT-like subfamil... [more]
CR388054.11.845e-1837.21potassium voltage-gated channel, KQT-like subfamil... [more]
CR388054.11.856e-1836.64potassium voltage-gated channel, KQT-like subfamil... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000046816.18.440e-3156.31potassium voltage-gated channel subfamily KQT memb... [more]
ENSXETT00000046772.18.702e-3156.31potassium voltage-gated channel subfamily KQT memb... [more]
ENSXETT00000046791.11.204e-3056.31potassium voltage-gated channel subfamily KQT memb... [more]
kri11.812e-2854.46KRI1 homolog [Source:Xenbase;Acc:XB-GENE-6036517][more]
kri12.977e-2853.91KRI1 homolog [Source:Xenbase;Acc:XB-GENE-6036517][more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnq15.878e-2844.68potassium voltage-gated channel, subfamily Q, memb... [more]
Kcnq51.981e-1859.38potassium voltage-gated channel, subfamily Q, memb... [more]
Kcnq52.063e-1859.38potassium voltage-gated channel, subfamily Q, memb... [more]
Kcnq52.157e-1859.38potassium voltage-gated channel, subfamily Q, memb... [more]
Kcnq53.032e-1665.38potassium voltage-gated channel, subfamily Q, memb... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O73925|KCNQ1_SQUAC2.751e-2853.91Potassium voltage-gated channel subfamily KQT memb... [more]
sp|P51787|KCNQ1_HUMAN1.260e-2751.75Potassium voltage-gated channel subfamily KQT memb... [more]
sp|P70057|KCNQ1_XENLA3.412e-2753.91Potassium voltage-gated channel subfamily KQT memb... [more]
sp|P97414|KCNQ1_MOUSE4.111e-2744.68Potassium voltage-gated channel subfamily KQT memb... [more]
sp|O70344|KCNQ1_CAVPO4.215e-2750.88Potassium voltage-gated channel subfamily KQT memb... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A401NKI87.476e-3257.14KCNQ_channel domain-containing protein (Fragment) ... [more]
A0A183D3F82.168e-3160.61KCNQ_channel domain-containing protein OS=Gongylon... [more]
A0A3P6Q8D02.191e-3160.61KCNQ_channel domain-containing protein OS=Gongylon... [more]
A0A5A9PWU41.265e-3060.61Potassium voltage-gated channel subfamily KQT memb... [more]
A0A0L8G0C92.261e-3057.14Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnq1.29.832e-3253.78potassium voltage-gated channel subfamily KQT memb... [more]
kcnq1.21.132e-3153.78potassium voltage-gated channel subfamily KQT memb... [more]
kcnq1.21.226e-3153.78potassium voltage-gated channel subfamily KQT memb... [more]
kcnq1.21.110e-2962.64potassium voltage-gated channel subfamily KQT memb... [more]
kcnq1.13.407e-2856.36potassium voltage-gated channel subfamily Q member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
kcnq1.14.333e-2961.70potassium voltage-gated channel, KQT-like subfamil... [more]
ENSPMAT00000001299.16.352e-1755.56pep scaffold:Pmarinus_7.0:GL481928:27736:29864:-1 ... [more]
ENSPMAT00000003068.12.073e-1656.14pep scaffold:Pmarinus_7.0:GL481645:5707:7212:1 gen... [more]
ENSPMAT00000009768.13.448e-1658.18pep scaffold:Pmarinus_7.0:GL477078:100805:104414:-... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000035260.15.673e-3058.25potassium voltage-gated channel subfamily KQT memb... [more]
ENSORLT00000044551.16.262e-3058.25potassium voltage-gated channel subfamily KQT memb... [more]
kcnq1.13.223e-2654.78potassium voltage-gated channel subfamily KQT memb... [more]
kcnq1.13.282e-2654.78potassium voltage-gated channel subfamily KQT memb... [more]
kcnq5a4.813e-2041.07potassium voltage-gated channel subfamily KQT memb... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040474.11.027e-95100.00SMESG000040474.1[more]
SMESG000040474.12.343e-95100.00SMESG000040474.1[more]
SMESG000028160.14.590e-4069.79SMESG000028160.1[more]
SMESG000078022.12.362e-3259.18SMESG000078022.1[more]
SMESG000078022.13.155e-3259.18SMESG000078022.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007283 ID=SMED30007283|Name=Potassium voltage-gated channel subfamily KQT member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1194bp
ATTATTATGATGATTAATGTGCAACATGAATAGAAACATAAATACACTGA
AATGTATATAGACATCAAAGACTCGAAATATATGCAAATACTGAGCATTA
AAGTTATTATGTTTTATGTATTTTGTAAAGATTGTATGCAGGGGGTGCCG
ATTTTGCGTTTTGTCCTCGGGCGCAAACTGCCCTAGCTACGCCACTGACC
TAATTTGTTTTAGCGAAATAATTTTTTAGGAGTTTTTCTAAATTACTTAA
TCAGTTAAGTGAGTAATTTGTTTTCAAAAATGTACTTCTGGATGCGTAAT
TAACATTGGCGATGGTGTATATAAGCGTCAAACGCAGAGCAAATTAGCCA
ATAGGTTAGGAATACCAATATATAACTAATAAACCATTATTCTTATGAGG
AAAAAAATGAAGTTAAGTGATAATAATAATGGTTAAGTGATAATGAAATT
TCGACAGTTTTTATTGCTGTGATGTGTCACTCGTATAATTTCCACGTTAT
AATTGTAATTTTGACAGTAATGATTTTCTACTCATGAAACAATTTTTTCC
TTTTTTATTTATAGAGGCTATACAAACTATGTAATCAAACACTCATTTCA
ATATAAGCCCTAATGTATTTTTGTAAGTAAAACAACATAGAGATTTCAAC
ACTCGTTTAATGTTTATAAATAATGAATTTATAATTTCTTTTAATTATCC
AAAATAGTAATTATTTATATATTTTATGATAATTATTTATAATTTTGAGT
TTTTAGTCTAAATTCATCGCAAAAGGTTGCTATTAGAGTTTTGAGACGCA
TGAGATACTACGTTGCAAGGCGTAAATTTCAACAAACCCGTAAACCATAT
GATGTCAAAGATGTAATTGAACAATATTCTCAAGGTCATTTAAATATGAT
GGTTCGTCTCAAAGAACTTCAAAGGAGATTGGATCAAACTCTTGGCAAAC
CGGCCCATCGAAATAATATTGATAGGCACCGAATGACTATAGCTCAAAGA
TTGTTAGTTATTGAATATAAGATAACTGATTTGGAATCGAAGGTTGCAGA
AACATTAAATAATTCTTCAGAAATGCTCAAATTGTTATCTAAAACTTTGC
AAAAATTTAATAGAAATTTCAAAAACGAAGATTGTCGTTCTGATTGTTTT
GCTGCAAATGAAAATGAATTCAATGTTTCTAAATAGATATTAAA
back to top

protein sequence of SMED30007283-orf-1

>SMED30007283-orf-1 ID=SMED30007283-orf-1|Name=SMED30007283-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=129bp
MRYYVARRKFQQTRKPYDVKDVIEQYSQGHLNMMVRLKELQRRLDQTLGK
PAHRNNIDRHRMTIAQRLLVIEYKITDLESKVAETLNNSSEMLKLLSKTL
QKFNRNFKNEDCRSDCFAANENEFNVSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR013821K_chnl_volt-dep_KCNQ_C
IPR000048IQ_motif_EF-hand-BS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005249voltage-gated potassium channel activity
GO:0005267potassium channel activity
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013821Potassium channel, voltage dependent, KCNQ, C-terminalPFAMPF03520KCNQ_channelcoord: 1..76
e-value: 2.3E-21
score: 76.5
NoneNo IPR availablePANTHERPTHR47735FAMILY NOT NAMEDcoord: 1..86