DUF862 domain-containing protein

Overview
NameDUF862 domain-containing protein
Smed IDSMED30007270
Length (bp)912
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF862 domain-containing protein (SMED30007270) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF862 domain-containing protein (SMED30007270) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF862 domain-containing protein (SMED30007270) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF862 domain-containing protein (SMED30007270) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007270

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30007270 dd_Smed_v4_1503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30007270 dd_Smed_v4_1503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007270 dd_Smed_v4_1503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30007270 dd_Smed_v4_1503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30007270 dd_Smed_v4_1503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30007270 dd_Smed_v4_1503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30007270 dd_Smed_v4_1503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30007270 dd_Smed_v4_1503_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF862 domain-containing protein vs. TrEMBL
Match: A0A164QG11 (DUF862 domain-containing protein OS=Daphnia magna OX=35525 GN=APZ42_028510 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.661e-9
Identity = 39/121 (32.23%), Postives = 64/121 (52.89%), Query Frame = 1
Query:  307 LVDLTKAITNVWYYKTPLSALQLTQLIFYHAFLILKTEGHYYSLEKNDSGILMQKSRNVSDVVSKVEGKQRNAVTKLNEKKVKNKS----MKELVAHXXXXXXXXXXXXXXNLHNCKGFAD 657
            LVD+T+ I  V YYK PL + QL   + +HAF++ +T   ++S+EKND G+ +Q+S++   V  +    +R        + VK  S    + EL+ HI       +  +    +NC+ FAD
Sbjct:   50 LVDVTERIIEVRYYKHPLGSWQLMDNVLHHAFIVFETNAWWWSIEKNDEGVTIQRSKDFDSVCHRYRRTKRKTSIGKGVEMVKKASGSATVMELINHIWRKNYLNQEYNFLT-YNCQHFAD 169          
BLAST of DUF862 domain-containing protein vs. TrEMBL
Match: A0A3M6TN79 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00005107 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.177e-8
Identity = 39/121 (32.23%), Postives = 65/121 (53.72%), Query Frame = 1
Query:  307 LVDLTKAITNVWYYKTPLSALQLTQLIFYHAFLILKTEGHYYSLEKNDSGILMQKSRNV---SDVVSKVEGKQRNAVTKLNEKKVKNKSMKELVAHXXXXXXXXXXXXXXNLHNCKGFADR 660
            L+D ++ I N+W +K+PLS  Q TQL   H F+++KT+  ++S+EKN   IL+Q+S++      V+      +R          V  K+MK+L+      E  +      N++NCK FA +
Sbjct:   68 LIDFSENILNIWVFKSPLSDWQRTQLFLNHQFVVIKTKNWWWSIEKNSEVILIQRSKHFKGYGGVLDCANNNKRKTPLLRVSSDVGQKTMKDLLEF-LHEEDELNKTYFWNVNNCKHFAKK 187          
BLAST of DUF862 domain-containing protein vs. TrEMBL
Match: A0A164JSN2 (Uncharacterized protein OS=Daphnia magna OX=35525 GN=APZ42_000269 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.414e-7
Identity = 37/123 (30.08%), Postives = 65/123 (52.85%), Query Frame = 1
Query:  307 LVDLTKAITNVWYYKTPLSALQLTQLIFYHAFLILKTEGHYYSLEKNDSGILMQKSRNVSDVVSKVEGKQR----NAVTKLNEKKVK---NKSMKELVAHXXXXXXXXXXXXXXNLHNCKGFA 654
            L+D  + I     Y  PLS+LQ T  + YHAF++++T   ++S+EKN  GI +Q+S+N+  V    + K+R     ++T +   K     N ++ EL+ ++   +         +  NC+GFA
Sbjct:   47 LIDTEERIQKASVYSNPLSSLQATNALLYHAFIVIETNDWWWSIEKNTEGITIQRSKNLKSVRDMYQRKKRTTGWTSLTSIRNNKTAQGGNTTISELINYVWRKDCVTNVYHVLS-ANCQGFA 168          
BLAST of DUF862 domain-containing protein vs. TrEMBL
Match: E9GQZ7 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_305262 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.879e-7
Identity = 26/80 (32.50%), Postives = 51/80 (63.75%), Query Frame = 1
Query:  280 WSYGTEIRYLVDLTKAITNVWYYKTPLSALQLTQLIFYHAFLILKTEGHYYSLEKNDSGILMQKSRNVSDVVSKVEGKQR 519
            W    +I  L D ++ I  V YY  PL+  Q+++ + +HAF++L+TE  ++S+EK++ GI +Q+S+++ +V+ +     R
Sbjct:   37 WELKEKIENLPDSSEKINEVRYYTHPLNWWQMSKYVLHHAFIVLETESWWWSIEKDEGGITIQRSKHLENVLDQCRRHGR 116          
BLAST of DUF862 domain-containing protein vs. TrEMBL
Match: E9GQ32 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_320721 PE=4 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 4.188e-7
Identity = 39/119 (32.77%), Postives = 67/119 (56.30%), Query Frame = 1
Query:  328 ITNVWYYKTPLSALQLTQLIFYHAFLILKTEGHYYSLEKNDSGILMQKSRNVSDVVSKVEGKQRNAVTKLN------EKK---VKNKSMKELVAHXXXXXXXXXXXXXXNLHNCKGFAD 657
            I  V YY  PL  +Q+TQL+ +HAF++  TE  ++S+E+N+ G+ +Q+S+ +  V  K   ++++  T L       EK+   + N ++KEL+ HI   +   E       +NCK FA+
Sbjct:   54 ILEVRYYTNPLYGVQVTQLVLHHAFIVFLTERAWWSIERNELGVTIQRSKKIEFVRDKF--RRQDRTTDLFGSGIHWEKRCFGITNVTLKELLTHICREDYLNEDYDLLE-NNCKHFAE 169          
BLAST of DUF862 domain-containing protein vs. Planmine SMEST
Match: SMESG000024772.1 (SMESG000024772.1)

HSP 1 Score: 114.775 bits (286), Expect = 3.077e-32
Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 1
Query:  463 MQKSRNVSDVVSKVEGKQRNAVTKLNEKKVKNKSMKELVAHXXXXXXXXXXXXXXNLHNCKGFADRALKLLDS 681
            MQKSRNVSDVVSKVEGKQRNAVTKLNEKKVKNKSMKELVAHIEESEIGIEYISSSN+HNCKGFADRALKLLDS
Sbjct:    1 MQKSRNVSDVVSKVEGKQRNAVTKLNEKKVKNKSMKELVAHIEESEIGIEYISSSNIHNCKGFADRALKLLDS 73          
BLAST of DUF862 domain-containing protein vs. Planmine SMEST
Match: SMESG000024661.1 (SMESG000024661.1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.234e-23
Identity = 53/140 (37.86%), Postives = 85/140 (60.71%), Query Frame = 1
Query:  250 NLSANSDTYSWSYGTEIRYLVDLTKAITNVWYYKTPLSALQLTQLIFYHAFLILKTEGHYYSLEKNDSGILMQKSRNVSDVVSKVEGKQRNAVTKLNEKKVKNKSMKELVAHXXXXXXXXXXXXXXNLHNCKGFADRALK 669
            N SA +D +    G+E+R L+D ++ I   W YK  L   Q+T    YHAF+I +T+  Y+S+EKN SGI +QKS++ +++V+K  G +RN+ T L+ +     ++ EL+  +E +E+   Y       NC+GFADRA +
Sbjct:   23 NTSAPNDVFK---GSEMRKLIDTSETIIQAWKYKQKLVWFQITSFFLYHAFVIFETKDWYWSIEKNGSGIWIQKSKSKNELVTKNGGNERNSTTLLDSEFGNFITIGELIEWVENNELINRYFYIETYFNCQGFADRAYQ 159          
BLAST of DUF862 domain-containing protein vs. Planmine SMEST
Match: SMESG000024663.1 (SMESG000024663.1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.910e-23
Identity = 52/138 (37.68%), Postives = 87/138 (63.04%), Query Frame = 1
Query:  250 NLSANSDTYSWSYGTEIRYLVDLTKAITNVWYYKTPLSALQLTQLIFYHAFLILKTEGHYYSLEKNDSGILMQKSRNVSDVVSKVEGKQRNAVTKLNEKKVKNKSMKELVAHXXXXXXXXXXXXXXNLHNCKGFADRA 663
            N SA ++ ++   G+E+R L+D ++ I  VW YK  L   Q+T    YHAF+I +T   Y+S+EKN SGI +QKS++  ++V+K+ G +RN+ T L+  + +  ++K ++  IE+ E+   Y   ++  NC+GFADR 
Sbjct:   23 NTSAPNEVFN---GSEMRKLIDTSETIVKVWKYKEKLVWWQITSFYLYHAFVIFETNDWYWSMEKNGSGIWIQKSKSKDNLVAKIGGNERNSTTLLDSCQGRFVTIKNIIEWIEKEELKSAYWYMNSDDNCQGFADRG 157          
BLAST of DUF862 domain-containing protein vs. Planmine SMEST
Match: SMESG000024649.1 (SMESG000024649.1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.139e-22
Identity = 51/134 (38.06%), Postives = 86/134 (64.18%), Query Frame = 1
Query:  286 YGTEIRYLVDLTKAITNVWYYKTPLSALQLTQLIFYHAFLILKTEGHYYSLEKNDSGILMQKSRNVSDVVSKVEGKQRNAVTKLNEKKVKNKSMKELVAHXXXXXXXXXXXXXXNLHNCKGFADRALKLLDS*F 687
            YG++++ + +L++ I  VW YK PL + QLT +IFYH FL+L+T+   +S+EKN +GI +QKS N ++++ K  G +R +V+ L  +      +K L   I ++E+ I+Y    + +NCKGF +RA K + + F
Sbjct:   28 YGSQMKQMGNLSERIQQVWRYKEPLKSWQLTSVIFYHIFLVLQTDKWNWSIEKNGTGIWVQKSENHNELLKKKGGVERKSVSLLGHRIGNFVRIKSLFDWIIKNELKIKYYWLDSYYNCKGFVERAFKFITNTF 161          
BLAST of DUF862 domain-containing protein vs. Planmine SMEST
Match: SMESG000024669.1 (SMESG000024669.1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.044e-21
Identity = 49/125 (39.20%), Postives = 77/125 (61.60%), Query Frame = 1
Query:  289 GTEIRYLVDLTKAITNVWYYKTPLSALQLTQLIFYHAFLILKTEGHYYSLEKNDSGILMQKSRNVSDVVSKVEGKQRNAVTKLNEKKVKNKSMKELVAHXXXXXXXXXXXXXXNLHNCKGFADRA 663
            G E++   DL+K I +VW YKTP+  +QLT   FYH F++++T+  ++S+EKN+ GI +QK R  +DV+SK+ G++RN V  L + +      + LV  IE +E+   Y  +    N KGF D+ 
Sbjct:   27 GGEMKRQFDLSKPILHVWKYKTPMHWIQLTSFYFYHIFIVIETDEFFWSVEKNNLGIWIQKGRFKNDVISKMAGEERNLVICLEDLQGDFGQFRNLVDWIEINELQKGYSCNDYDFNSKGFGDKV 151          
The following BLAST results are available for this feature:
BLAST of DUF862 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF862 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF862 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF862 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF862 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF862 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF862 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF862 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A164QG111.661e-932.23DUF862 domain-containing protein OS=Daphnia magna ... [more]
A0A3M6TN791.177e-832.23Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A164JSN21.414e-730.08Uncharacterized protein OS=Daphnia magna OX=35525 ... [more]
E9GQZ71.879e-732.50Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
E9GQ324.188e-732.77Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
back to top
BLAST of DUF862 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF862 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF862 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF862 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF862 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF862 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024772.13.077e-3298.63SMESG000024772.1[more]
SMESG000024661.11.234e-2337.86SMESG000024661.1[more]
SMESG000024663.11.910e-2337.68SMESG000024663.1[more]
SMESG000024649.11.139e-2238.06SMESG000024649.1[more]
SMESG000024669.11.044e-2139.20SMESG000024669.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007270 ID=SMED30007270|Name=DUF862 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=912bp
AGACATTCAATAATATCCGATGCTATAAATAGAATTATGGAGGTTATTCA
TTTCTATTCTTTGATATTTGTATTTACAAGAACCAATTAATCCGATTGAG
TACAATCACAAAAATCTGATGCAGTAAAACAAAAATCAAAATTGTCACAA
TTATAAAAGATGTCATTTGGAAGCCAATCAAACAGTAAGAGCACAGGATC
CAGTAGATCCAATTGTCCAAGCACATCTGGGGATTCTCGGAGCACGGCCA
ATCTCAGTGCCAATTCAGACACCTATTCATGGAGTTATGGAACTGAAATC
AGGTACTTGGTTGACCTGACGAAAGCGATTACAAACGTATGGTATTATAA
AACTCCTTTGTCTGCCTTGCAATTAACTCAATTAATATTCTATCATGCCT
TTCTCATCTTGAAGACGGAAGGGCATTATTATTCGTTGGAGAAAAATGAC
AGTGGGATCTTGATGCAGAAGTCCAGAAATGTATCTGATGTCGTTTCGAA
GGTGGAGGGCAAGCAAAGAAATGCAGTGACAAAATTGAATGAGAAAAAAG
TAAAGAACAAGTCAATGAAAGAACTTGTTGCTCATATCGAGGAAAGCGAG
ATTGGCATTGAATATATAAGCAGTTCTAATTTACACAACTGCAAAGGATT
TGCCGATCGAGCTTTAAAGTTATTGGATTCATGATTTTTGATAATTATAA
TGGGGAAATTATATTCTCTGATTTGACTTTTATTAAAACCATATTTGAAT
TTGTGAAAATATATTAAGAATAAATCTTTTATTCTCTTTAGGTTGATTGT
GATCACGCTTATACATAAACATTGCTCCTCCATCTTACCCAGGGAAATCA
GTATTTCTCAACTTTTTGCGGCAAAATTTTCGAGTTTTGATGTGTTAGAA
TTTAAGATCAAC
back to top

protein sequence of SMED30007270-orf-1

>SMED30007270-orf-1 ID=SMED30007270-orf-1|Name=SMED30007270-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=175bp
MSFGSQSNSKSTGSSRSNCPSTSGDSRSTANLSANSDTYSWSYGTEIRYL
VDLTKAITNVWYYKTPLSALQLTQLIFYHAFLILKTEGHYYSLEKNDSGI
LMQKSRNVSDVVSKVEGKQRNAVTKLNEKKVKNKSMKELVAHIEESEIGI
EYISSSNLHNCKGFADRALKLLDS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000429neoblast
PLANA:0002032epidermal cell