Meiosis regulator and mRNA stability factor 1

Overview
NameMeiosis regulator and mRNA stability factor 1
Smed IDSMED30007267
Length (bp)4680
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Meiosis regulator and mRNA stability factor 1 (SMED30007267) t-SNE clustered cells

Violin plots show distribution of expression levels for Meiosis regulator and mRNA stability factor 1 (SMED30007267) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Meiosis regulator and mRNA stability factor 1 (SMED30007267) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Meiosis regulator and mRNA stability factor 1 (SMED30007267) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007267

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30007267SMESG000007325.1 PL06012A2H04_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Human
Match: MARF1 (meiosis regulator and mRNA stability factor 1 [Source:HGNC Symbol;Acc:HGNC:29562])

HSP 1 Score: 448.358 bits (1152), Expect = 2.194e-131
Identity = 274/860 (31.86%), Postives = 462/860 (53.72%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL--TNTAINSITQATNPSELGET------MESL-----VCIQHC--KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEP---------NLMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKDLMR-FNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            D+ V+N+DY +S KE ++LL   F    K V SV +    D     +V++ +++DA  A++  HR KIG K+I V+L +  A  S + +  E  ++L+      L ++KF ++YEKK+   + +SD Y++ D V I++ G   N +++ L  ++ A  S   ++   +   T       E L     VC QHC  K+ +E      +S  +P V +SLK F  QV+ +LQ+H+G+V L+SF  CY +EF D+++++                               E   GVPLEH + C+ G+ I  +Q+GIK ++W                  PN+    +     +   +L QFSREV+DL+K QP+C + +S FIP+YHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F KD+ + +YGVC + D+++EIPD+T+ +   D+++ + +PKR +T +E ERT QF+ +V+DLL+  P  R+PFNKFIPSYHHHF RQCK+A YGFTKL+EL +A+P  +Q++E   EK + LT+ E  +ALA Q + LL    +  + +++    Y KT+GY   L+DY V S+  L +K+  + ++                A +ES  Q+                     L +R  ++ +  ++L++L+     +    + L+++       P          L  +   +  ++++  +  + +        ++L SL LF+++++ L+  ++  ++ L +    Y ++ G  L+ + YG+ S+  L+ A   VV +KG G +  +VL  D 
Sbjct:  627 DVQVSNIDYRLSRKELQQLLQEAFARHGK-VKSVELSPHTDYQLKAVVQMENLQDAIGAVNSLHRYKIGSKKILVSLATGAASKSLSLLSAETMSVLQDAPACCLPLFKFTDIYEKKFGHKLNVSDLYKLTDTVAIREQG---NGRLVCLLPSSQARQSPLGSSQSHDGSSTNCSPIIFEELEYHEPVCRQHCSNKDFSEHEFDP-DSYKIPFVILSLKTFAPQVHSLLQTHEGTVPLLSFPDCYIAEFGDLEVVQ-------------------------------ENQGGVPLEHFITCVPGVNIATAQNGIKVVKWIH-----------NKPPPPNTDPWLLRSKSPVGNPQLIQFSREVIDLLKSQPSCVIPISHFIPSYHHHFAKQCRVSDYGYSKLIELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVREFSQAYHWCFSKDWDVTEYGVCELIDIVSEIPDTTICLSQQDNEMVICIPKRERTQDEIERTKQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELFEAIPDTLQVLECGEEKILTLTEVERFKALAAQFVKLLRSQKDNCLMMTDLLTEYAKTFGYTFRLQDYDVSSISALTQKLCHVVKV----------------ADIESGRQIQ--------------------LINRKSLRSLTAQLLVLLMSWEGTTHLSVEELKRHYESTHNTPLNPCEYGFMTLTELLKSLPYLVEVFTNDKMEEC-------VKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYTKYVGETLQPKTYGHSSVEELLGAIPQVVWIKGHGHKRIVVLKNDM 1396          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Human
Match: MARF1 (meiosis regulator and mRNA stability factor 1 [Source:HGNC Symbol;Acc:HGNC:29562])

HSP 1 Score: 448.358 bits (1152), Expect = 2.194e-131
Identity = 274/860 (31.86%), Postives = 462/860 (53.72%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL--TNTAINSITQATNPSELGET------MESL-----VCIQHC--KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEP---------NLMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKDLMR-FNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            D+ V+N+DY +S KE ++LL   F    K V SV +    D     +V++ +++DA  A++  HR KIG K+I V+L +  A  S + +  E  ++L+      L ++KF ++YEKK+   + +SD Y++ D V I++ G   N +++ L  ++ A  S   ++   +   T       E L     VC QHC  K+ +E      +S  +P V +SLK F  QV+ +LQ+H+G+V L+SF  CY +EF D+++++                               E   GVPLEH + C+ G+ I  +Q+GIK ++W                  PN+    +     +   +L QFSREV+DL+K QP+C + +S FIP+YHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F KD+ + +YGVC + D+++EIPD+T+ +   D+++ + +PKR +T +E ERT QF+ +V+DLL+  P  R+PFNKFIPSYHHHF RQCK+A YGFTKL+EL +A+P  +Q++E   EK + LT+ E  +ALA Q + LL    +  + +++    Y KT+GY   L+DY V S+  L +K+  + ++                A +ES  Q+                     L +R  ++ +  ++L++L+     +    + L+++       P          L  +   +  ++++  +  + +        ++L SL LF+++++ L+  ++  ++ L +    Y ++ G  L+ + YG+ S+  L+ A   VV +KG G +  +VL  D 
Sbjct:  627 DVQVSNIDYRLSRKELQQLLQEAFARHGK-VKSVELSPHTDYQLKAVVQMENLQDAIGAVNSLHRYKIGSKKILVSLATGAASKSLSLLSAETMSVLQDAPACCLPLFKFTDIYEKKFGHKLNVSDLYKLTDTVAIREQG---NGRLVCLLPSSQARQSPLGSSQSHDGSSTNCSPIIFEELEYHEPVCRQHCSNKDFSEHEFDP-DSYKIPFVILSLKTFAPQVHSLLQTHEGTVPLLSFPDCYIAEFGDLEVVQ-------------------------------ENQGGVPLEHFITCVPGVNIATAQNGIKVVKWIH-----------NKPPPPNTDPWLLRSKSPVGNPQLIQFSREVIDLLKSQPSCVIPISHFIPSYHHHFAKQCRVSDYGYSKLIELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVREFSQAYHWCFSKDWDVTEYGVCELIDIVSEIPDTTICLSQQDNEMVICIPKRERTQDEIERTKQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELFEAIPDTLQVLECGEEKILTLTEVERFKALAAQFVKLLRSQKDNCLMMTDLLTEYAKTFGYTFRLQDYDVSSISALTQKLCHVVKV----------------ADIESGRQIQ--------------------LINRKSLRSLTAQLLVLLMSWEGTTHLSVEELKRHYESTHNTPLNPCEYGFMTLTELLKSLPYLVEVFTNDKMEEC-------VKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYTKYVGETLQPKTYGHSSVEELLGAIPQVVWIKGHGHKRIVVLKNDM 1396          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Human
Match: MARF1 (meiosis regulator and mRNA stability factor 1 [Source:HGNC Symbol;Acc:HGNC:29562])

HSP 1 Score: 448.743 bits (1153), Expect = 1.097e-130
Identity = 274/860 (31.86%), Postives = 462/860 (53.72%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL--TNTAINSITQATNPSELGET------MESL-----VCIQHC--KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEP---------NLMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKDLMR-FNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            D+ V+N+DY +S KE ++LL   F    K V SV +    D     +V++ +++DA  A++  HR KIG K+I V+L +  A  S + +  E  ++L+      L ++KF ++YEKK+   + +SD Y++ D V I++ G   N +++ L  ++ A  S   ++   +   T       E L     VC QHC  K+ +E      +S  +P V +SLK F  QV+ +LQ+H+G+V L+SF  CY +EF D+++++                               E   GVPLEH + C+ G+ I  +Q+GIK ++W                  PN+    +     +   +L QFSREV+DL+K QP+C + +S FIP+YHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F KD+ + +YGVC + D+++EIPD+T+ +   D+++ + +PKR +T +E ERT QF+ +V+DLL+  P  R+PFNKFIPSYHHHF RQCK+A YGFTKL+EL +A+P  +Q++E   EK + LT+ E  +ALA Q + LL    +  + +++    Y KT+GY   L+DY V S+  L +K+  + ++                A +ES  Q+                     L +R  ++ +  ++L++L+     +    + L+++       P          L  +   +  ++++  +  + +        ++L SL LF+++++ L+  ++  ++ L +    Y ++ G  L+ + YG+ S+  L+ A   VV +KG G +  +VL  D 
Sbjct:  789 DVQVSNIDYRLSRKELQQLLQEAFARHGK-VKSVELSPHTDYQLKAVVQMENLQDAIGAVNSLHRYKIGSKKILVSLATGAASKSLSLLSAETMSVLQDAPACCLPLFKFTDIYEKKFGHKLNVSDLYKLTDTVAIREQG---NGRLVCLLPSSQARQSPLGSSQSHDGSSTNCSPIIFEELEYHEPVCRQHCSNKDFSEHEFDP-DSYKIPFVILSLKTFAPQVHSLLQTHEGTVPLLSFPDCYIAEFGDLEVVQ-------------------------------ENQGGVPLEHFITCVPGVNIATAQNGIKVVKWIH-----------NKPPPPNTDPWLLRSKSPVGNPQLIQFSREVIDLLKSQPSCVIPISHFIPSYHHHFAKQCRVSDYGYSKLIELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVREFSQAYHWCFSKDWDVTEYGVCELIDIVSEIPDTTICLSQQDNEMVICIPKRERTQDEIERTKQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELFEAIPDTLQVLECGEEKILTLTEVERFKALAAQFVKLLRSQKDNCLMMTDLLTEYAKTFGYTFRLQDYDVSSISALTQKLCHVVKV----------------ADIESGRQIQ--------------------LINRKSLRSLTAQLLVLLMSWEGTTHLSVEELKRHYESTHNTPLNPCEYGFMTLTELLKSLPYLVEVFTNDKMEEC-------VKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYTKYVGETLQPKTYGHSSVEELLGAIPQVVWIKGHGHKRIVVLKNDM 1558          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Human
Match: MARF1 (meiosis regulator and mRNA stability factor 1 [Source:HGNC Symbol;Acc:HGNC:29562])

HSP 1 Score: 448.743 bits (1153), Expect = 1.097e-130
Identity = 274/860 (31.86%), Postives = 462/860 (53.72%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL--TNTAINSITQATNPSELGET------MESL-----VCIQHC--KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEP---------NLMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKDLMR-FNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            D+ V+N+DY +S KE ++LL   F    K V SV +    D     +V++ +++DA  A++  HR KIG K+I V+L +  A  S + +  E  ++L+      L ++KF ++YEKK+   + +SD Y++ D V I++ G   N +++ L  ++ A  S   ++   +   T       E L     VC QHC  K+ +E      +S  +P V +SLK F  QV+ +LQ+H+G+V L+SF  CY +EF D+++++                               E   GVPLEH + C+ G+ I  +Q+GIK ++W                  PN+    +     +   +L QFSREV+DL+K QP+C + +S FIP+YHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F KD+ + +YGVC + D+++EIPD+T+ +   D+++ + +PKR +T +E ERT QF+ +V+DLL+  P  R+PFNKFIPSYHHHF RQCK+A YGFTKL+EL +A+P  +Q++E   EK + LT+ E  +ALA Q + LL    +  + +++    Y KT+GY   L+DY V S+  L +K+  + ++                A +ES  Q+                     L +R  ++ +  ++L++L+     +    + L+++       P          L  +   +  ++++  +  + +        ++L SL LF+++++ L+  ++  ++ L +    Y ++ G  L+ + YG+ S+  L+ A   VV +KG G +  +VL  D 
Sbjct:  789 DVQVSNIDYRLSRKELQQLLQEAFARHGK-VKSVELSPHTDYQLKAVVQMENLQDAIGAVNSLHRYKIGSKKILVSLATGAASKSLSLLSAETMSVLQDAPACCLPLFKFTDIYEKKFGHKLNVSDLYKLTDTVAIREQG---NGRLVCLLPSSQARQSPLGSSQSHDGSSTNCSPIIFEELEYHEPVCRQHCSNKDFSEHEFDP-DSYKIPFVILSLKTFAPQVHSLLQTHEGTVPLLSFPDCYIAEFGDLEVVQ-------------------------------ENQGGVPLEHFITCVPGVNIATAQNGIKVVKWIH-----------NKPPPPNTDPWLLRSKSPVGNPQLIQFSREVIDLLKSQPSCVIPISHFIPSYHHHFAKQCRVSDYGYSKLIELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVREFSQAYHWCFSKDWDVTEYGVCELIDIVSEIPDTTICLSQQDNEMVICIPKRERTQDEIERTKQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELFEAIPDTLQVLECGEEKILTLTEVERFKALAAQFVKLLRSQKDNCLMMTDLLTEYAKTFGYTFRLQDYDVSSISALTQKLCHVVKV----------------ADIESGRQIQ--------------------LINRKSLRSLTAQLLVLLMSWEGTTHLSVEELKRHYESTHNTPLNPCEYGFMTLTELLKSLPYLVEVFTNDKMEEC-------VKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYTKYVGETLQPKTYGHSSVEELLGAIPQVVWIKGHGHKRIVVLKNDM 1558          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Human
Match: MARF1 (meiosis regulator and mRNA stability factor 1 [Source:HGNC Symbol;Acc:HGNC:29562])

HSP 1 Score: 448.743 bits (1153), Expect = 1.120e-130
Identity = 274/860 (31.86%), Postives = 462/860 (53.72%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL--TNTAINSITQATNPSELGET------MESL-----VCIQHC--KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEP---------NLMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKDLMR-FNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            D+ V+N+DY +S KE ++LL   F    K V SV +    D     +V++ +++DA  A++  HR KIG K+I V+L +  A  S + +  E  ++L+      L ++KF ++YEKK+   + +SD Y++ D V I++ G   N +++ L  ++ A  S   ++   +   T       E L     VC QHC  K+ +E      +S  +P V +SLK F  QV+ +LQ+H+G+V L+SF  CY +EF D+++++                               E   GVPLEH + C+ G+ I  +Q+GIK ++W                  PN+    +     +   +L QFSREV+DL+K QP+C + +S FIP+YHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F KD+ + +YGVC + D+++EIPD+T+ +   D+++ + +PKR +T +E ERT QF+ +V+DLL+  P  R+PFNKFIPSYHHHF RQCK+A YGFTKL+EL +A+P  +Q++E   EK + LT+ E  +ALA Q + LL    +  + +++    Y KT+GY   L+DY V S+  L +K+  + ++                A +ES  Q+                     L +R  ++ +  ++L++L+     +    + L+++       P          L  +   +  ++++  +  + +        ++L SL LF+++++ L+  ++  ++ L +    Y ++ G  L+ + YG+ S+  L+ A   VV +KG G +  +VL  D 
Sbjct:  792 DVQVSNIDYRLSRKELQQLLQEAFARHGK-VKSVELSPHTDYQLKAVVQMENLQDAIGAVNSLHRYKIGSKKILVSLATGAASKSLSLLSAETMSVLQDAPACCLPLFKFTDIYEKKFGHKLNVSDLYKLTDTVAIREQG---NGRLVCLLPSSQARQSPLGSSQSHDGSSTNCSPIIFEELEYHEPVCRQHCSNKDFSEHEFDP-DSYKIPFVILSLKTFAPQVHSLLQTHEGTVPLLSFPDCYIAEFGDLEVVQ-------------------------------ENQGGVPLEHFITCVPGVNIATAQNGIKVVKWIH-----------NKPPPPNTDPWLLRSKSPVGNPQLIQFSREVIDLLKSQPSCVIPISHFIPSYHHHFAKQCRVSDYGYSKLIELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVREFSQAYHWCFSKDWDVTEYGVCELIDIVSEIPDTTICLSQQDNEMVICIPKRERTQDEIERTKQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELFEAIPDTLQVLECGEEKILTLTEVERFKALAAQFVKLLRSQKDNCLMMTDLLTEYAKTFGYTFRLQDYDVSSISALTQKLCHVVKV----------------ADIESGRQIQ--------------------LINRKSLRSLTAQLLVLLMSWEGTTHLSVEELKRHYESTHNTPLNPCEYGFMTLTELLKSLPYLVEVFTNDKMEEC-------VKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYTKYVGETLQPKTYGHSSVEELLGAIPQVVWIKGHGHKRIVVLKNDM 1561          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Fly
Match: Marf1 (gene:FBgn0039972 transcript:FBtr0306235)

HSP 1 Score: 344.739 bits (883), Expect = 9.168e-98
Identity = 210/645 (32.56%), Postives = 348/645 (53.95%), Query Frame = 3
Query:  954 LLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLV--CIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQW----DDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDS---TVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQI-IEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKR---IQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKI 2849
            L +TNLDY++     R  LLNQ +     V  V      +GS+   V +  +  A+  +S  HRKKIG+KR+ V+   ++++   N+++ +VA LLK V   +L +YKF EL++ ++  SI + D Y+M+D   I     N   K ISL    +N++    + S L E ++  V  C  H K+         E   LPNV +S+   ++ +Y +L+ H G + + + L C K E  ++ IM                      ++EN          GV LEH++ C+QGI++  +  GIK + W     +   G++ AS +  + + +      +     + D L Q SREV++L+K  P   M  ++FIP YH+HFGKQCRVADYG++KL EL EAL  VV ++G G  R + L H++Q+RRFT+++++VL++    +  LS+ P  +    +K F I DYGVC + D+L+ +  S   T+    +  DI ++MPKR QT+ E E+T  FA E+++L + + +  + F KF+ SYH+HF+ QC++++YGF KL +LLDA+  ++++ +    +K ++L+     R  AEQ  NL+  +       ++L +   L+ K YGY +  +   VM +    E +P +
Sbjct:  226 LQITNLDYSLDESHIRSFLLNQLKPITPVVSLVF-----EGSSYAKVTVPDLYFAKQVVSNLHRKKIGHKRMLVSYTRDSSLTEVNTLRCQVAGLLKDVPFNTLPMYKFRELFQSRFKTSISVLDLYKMQDICTIN--SDNNEEKFISLNPELVNTL----DISPLMEGLQHSVPYCSIHFKKEQHKGWAEQEIEPLPNVFMSISEIQKLIYPLLKVHTGDIPVATLLHCVKEEL-NVSIM----------------------ANEN----------GVNLEHLICCVQGIQVRANNFGIKILGWLEINKEMQSGTFNASSNTCSLTASDRTNCGSYFKNSVADPLFQISREVIELLKMSPKSTMKFNRFIPAYHNHFGKQCRVADYGYTKLIELFEALSNVVQIMGDGENRQITLSHRIQIRRFTSDLLRVLRANGNNSVLLSQLPLVFTQTQNKTFDITDYGVCDLIDILDGLVSSNIVTLGAAQNGKDILISMPKRKQTNSELEKTCVFAGEMVELFQNALQYTILFQKFVRSYHYHFAYQCRLSDYGFLKLADLLDAINGLVEMKLTSDEDKKIVLSPQVARRVFAEQCENLIRNATGNSSHCMKLEQVLVLHKKKYGYQIQPKTLGVMDMATAVELLPYV 826          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Fly
Match: Marf1 (gene:FBgn0039972 transcript:FBtr0085956)

HSP 1 Score: 344.739 bits (883), Expect = 9.168e-98
Identity = 210/645 (32.56%), Postives = 348/645 (53.95%), Query Frame = 3
Query:  954 LLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLV--CIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQW----DDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDS---TVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQI-IEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKR---IQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKI 2849
            L +TNLDY++     R  LLNQ +     V  V      +GS+   V +  +  A+  +S  HRKKIG+KR+ V+   ++++   N+++ +VA LLK V   +L +YKF EL++ ++  SI + D Y+M+D   I     N   K ISL    +N++    + S L E ++  V  C  H K+         E   LPNV +S+   ++ +Y +L+ H G + + + L C K E  ++ IM                      ++EN          GV LEH++ C+QGI++  +  GIK + W     +   G++ AS +  + + +      +     + D L Q SREV++L+K  P   M  ++FIP YH+HFGKQCRVADYG++KL EL EAL  VV ++G G  R + L H++Q+RRFT+++++VL++    +  LS+ P  +    +K F I DYGVC + D+L+ +  S   T+    +  DI ++MPKR QT+ E E+T  FA E+++L + + +  + F KF+ SYH+HF+ QC++++YGF KL +LLDA+  ++++ +    +K ++L+     R  AEQ  NL+  +       ++L +   L+ K YGY +  +   VM +    E +P +
Sbjct:  226 LQITNLDYSLDESHIRSFLLNQLKPITPVVSLVF-----EGSSYAKVTVPDLYFAKQVVSNLHRKKIGHKRMLVSYTRDSSLTEVNTLRCQVAGLLKDVPFNTLPMYKFRELFQSRFKTSISVLDLYKMQDICTIN--SDNNEEKFISLNPELVNTL----DISPLMEGLQHSVPYCSIHFKKEQHKGWAEQEIEPLPNVFMSISEIQKLIYPLLKVHTGDIPVATLLHCVKEEL-NVSIM----------------------ANEN----------GVNLEHLICCVQGIQVRANNFGIKILGWLEINKEMQSGTFNASSNTCSLTASDRTNCGSYFKNSVADPLFQISREVIELLKMSPKSTMKFNRFIPAYHNHFGKQCRVADYGYTKLIELFEALSNVVQIMGDGENRQITLSHRIQIRRFTSDLLRVLRANGNNSVLLSQLPLVFTQTQNKTFDITDYGVCDLIDILDGLVSSNIVTLGAAQNGKDILISMPKRKQTNSELEKTCVFAGEMVELFQNALQYTILFQKFVRSYHYHFAYQCRLSDYGFLKLADLLDAINGLVEMKLTSDEDKKIVLSPQVARRVFAEQCENLIRNATGNSSHCMKLEQVLVLHKKKYGYQIQPKTLGVMDMATAVELLPYV 826          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Fly
Match: Marf1 (gene:FBgn0039972 transcript:FBtr0085957)

HSP 1 Score: 344.354 bits (882), Expect = 1.593e-97
Identity = 210/645 (32.56%), Postives = 348/645 (53.95%), Query Frame = 3
Query:  954 LLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLV--CIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQW----DDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDS---TVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQI-IEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKR---IQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKI 2849
            L +TNLDY++     R  LLNQ +     V  V      +GS+   V +  +  A+  +S  HRKKIG+KR+ V+   ++++   N+++ +VA LLK V   +L +YKF EL++ ++  SI + D Y+M+D   I     N   K ISL    +N++    + S L E ++  V  C  H K+         E   LPNV +S+   ++ +Y +L+ H G + + + L C K E  ++ IM                      ++EN          GV LEH++ C+QGI++  +  GIK + W     +   G++ AS +  + + +      +     + D L Q SREV++L+K  P   M  ++FIP YH+HFGKQCRVADYG++KL EL EAL  VV ++G G  R + L H++Q+RRFT+++++VL++    +  LS+ P  +    +K F I DYGVC + D+L+ +  S   T+    +  DI ++MPKR QT+ E E+T  FA E+++L + + +  + F KF+ SYH+HF+ QC++++YGF KL +LLDA+  ++++ +    +K ++L+     R  AEQ  NL+  +       ++L +   L+ K YGY +  +   VM +    E +P +
Sbjct:  248 LQITNLDYSLDESHIRSFLLNQLKPITPVVSLVF-----EGSSYAKVTVPDLYFAKQVVSNLHRKKIGHKRMLVSYTRDSSLTEVNTLRCQVAGLLKDVPFNTLPMYKFRELFQSRFKTSISVLDLYKMQDICTIN--SDNNEEKFISLNPELVNTL----DISPLMEGLQHSVPYCSIHFKKEQHKGWAEQEIEPLPNVFMSISEIQKLIYPLLKVHTGDIPVATLLHCVKEEL-NVSIM----------------------ANEN----------GVNLEHLICCVQGIQVRANNFGIKILGWLEINKEMQSGTFNASSNTCSLTASDRTNCGSYFKNSVADPLFQISREVIELLKMSPKSTMKFNRFIPAYHNHFGKQCRVADYGYTKLIELFEALSNVVQIMGDGENRQITLSHRIQIRRFTSDLLRVLRANGNNSVLLSQLPLVFTQTQNKTFDITDYGVCDLIDILDGLVSSNIVTLGAAQNGKDILISMPKRKQTNSELEKTCVFAGEMVELFQNALQYTILFQKFVRSYHYHFAYQCRLSDYGFLKLADLLDAINGLVEMKLTSDEDKKIVLSPQVARRVFAEQCENLIRNATGNSSHCMKLEQVLVLHKKKYGYQIQPKTLGVMDMATAVELLPYV 848          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Fly
Match: Marf1 (gene:FBgn0039972 transcript:FBtr0306236)

HSP 1 Score: 344.739 bits (883), Expect = 1.626e-97
Identity = 210/645 (32.56%), Postives = 348/645 (53.95%), Query Frame = 3
Query:  954 LLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLV--CIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQW----DDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDS---TVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQI-IEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKR---IQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKI 2849
            L +TNLDY++     R  LLNQ +     V  V      +GS+   V +  +  A+  +S  HRKKIG+KR+ V+   ++++   N+++ +VA LLK V   +L +YKF EL++ ++  SI + D Y+M+D   I     N   K ISL    +N++    + S L E ++  V  C  H K+         E   LPNV +S+   ++ +Y +L+ H G + + + L C K E  ++ IM                      ++EN          GV LEH++ C+QGI++  +  GIK + W     +   G++ AS +  + + +      +     + D L Q SREV++L+K  P   M  ++FIP YH+HFGKQCRVADYG++KL EL EAL  VV ++G G  R + L H++Q+RRFT+++++VL++    +  LS+ P  +    +K F I DYGVC + D+L+ +  S   T+    +  DI ++MPKR QT+ E E+T  FA E+++L + + +  + F KF+ SYH+HF+ QC++++YGF KL +LLDA+  ++++ +    +K ++L+     R  AEQ  NL+  +       ++L +   L+ K YGY +  +   VM +    E +P +
Sbjct:  259 LQITNLDYSLDESHIRSFLLNQLKPITPVVSLVF-----EGSSYAKVTVPDLYFAKQVVSNLHRKKIGHKRMLVSYTRDSSLTEVNTLRCQVAGLLKDVPFNTLPMYKFRELFQSRFKTSISVLDLYKMQDICTIN--SDNNEEKFISLNPELVNTL----DISPLMEGLQHSVPYCSIHFKKEQHKGWAEQEIEPLPNVFMSISEIQKLIYPLLKVHTGDIPVATLLHCVKEEL-NVSIM----------------------ANEN----------GVNLEHLICCVQGIQVRANNFGIKILGWLEINKEMQSGTFNASSNTCSLTASDRTNCGSYFKNSVADPLFQISREVIELLKMSPKSTMKFNRFIPAYHNHFGKQCRVADYGYTKLIELFEALSNVVQIMGDGENRQITLSHRIQIRRFTSDLLRVLRANGNNSVLLSQLPLVFTQTQNKTFDITDYGVCDLIDILDGLVSSNIVTLGAAQNGKDILISMPKRKQTNSELEKTCVFAGEMVELFQNALQYTILFQKFVRSYHYHFAYQCRLSDYGFLKLADLLDAINGLVEMKLTSDEDKKIVLSPQVARRVFAEQCENLIRNATGNSSHCMKLEQVLVLHKKKYGYQIQPKTLGVMDMATAVELLPYV 859          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Fly
Match: Marf1 (gene:FBgn0039972 transcript:FBtr0085958)

HSP 1 Score: 344.739 bits (883), Expect = 1.626e-97
Identity = 210/645 (32.56%), Postives = 348/645 (53.95%), Query Frame = 3
Query:  954 LLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLV--CIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQW----DDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDS---TVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQI-IEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKR---IQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKI 2849
            L +TNLDY++     R  LLNQ +     V  V      +GS+   V +  +  A+  +S  HRKKIG+KR+ V+   ++++   N+++ +VA LLK V   +L +YKF EL++ ++  SI + D Y+M+D   I     N   K ISL    +N++    + S L E ++  V  C  H K+         E   LPNV +S+   ++ +Y +L+ H G + + + L C K E  ++ IM                      ++EN          GV LEH++ C+QGI++  +  GIK + W     +   G++ AS +  + + +      +     + D L Q SREV++L+K  P   M  ++FIP YH+HFGKQCRVADYG++KL EL EAL  VV ++G G  R + L H++Q+RRFT+++++VL++    +  LS+ P  +    +K F I DYGVC + D+L+ +  S   T+    +  DI ++MPKR QT+ E E+T  FA E+++L + + +  + F KF+ SYH+HF+ QC++++YGF KL +LLDA+  ++++ +    +K ++L+     R  AEQ  NL+  +       ++L +   L+ K YGY +  +   VM +    E +P +
Sbjct:  259 LQITNLDYSLDESHIRSFLLNQLKPITPVVSLVF-----EGSSYAKVTVPDLYFAKQVVSNLHRKKIGHKRMLVSYTRDSSLTEVNTLRCQVAGLLKDVPFNTLPMYKFRELFQSRFKTSISVLDLYKMQDICTIN--SDNNEEKFISLNPELVNTL----DISPLMEGLQHSVPYCSIHFKKEQHKGWAEQEIEPLPNVFMSISEIQKLIYPLLKVHTGDIPVATLLHCVKEEL-NVSIM----------------------ANEN----------GVNLEHLICCVQGIQVRANNFGIKILGWLEINKEMQSGTFNASSNTCSLTASDRTNCGSYFKNSVADPLFQISREVIELLKMSPKSTMKFNRFIPAYHNHFGKQCRVADYGYTKLIELFEALSNVVQIMGDGENRQITLSHRIQIRRFTSDLLRVLRANGNNSVLLSQLPLVFTQTQNKTFDITDYGVCDLIDILDGLVSSNIVTLGAAQNGKDILISMPKRKQTNSELEKTCVFAGEMVELFQNALQYTILFQKFVRSYHYHFAYQCRLSDYGFLKLADLLDAINGLVEMKLTSDEDKKIVLSPQVARRVFAEQCENLIRNATGNSSHCMKLEQVLVLHKKKYGYQIQPKTLGVMDMATAVELLPYV 859          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Zebrafish
Match: MARF1 (meiosis regulator and mRNA stability factor 1 [Source:NCBI gene;Acc:100005105])

HSP 1 Score: 450.284 bits (1157), Expect = 4.395e-133
Identity = 285/864 (32.99%), Postives = 451/864 (52.20%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAI------NSITQATNPSE-----LGETME--SLVCIQHCKEGTEDYITA---LESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEG-VPLEHMLNCIQGIKIVNSQSGIKKIQW-DDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPS--GSLPDYQFLEKYRYKYREEPN--------LMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKD-LMRFNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            DL V+NLDY +   E ++ L + F     RV SV +    D      V + S++ A  A+S  HR KIG KRIQV+LV+  +  S   +  E+ ++L+      L +YKF E YE+K+   + + D YR+ + V +++ GG +   +  L+NT I      +S T   + S      L E +E    VC +H  +  +D+  A    +S ++P V  SLK+    V+ +LQSH+G + L+SF  CY +EF  + +                         E  Q      LEG VPLEH++ CI G+ IV +Q+G K I+W  +K          Q + SP    Q            L QFSRE+VDLM+ QP+C M +S+FIP YHHHF KQCRV+DYG++KL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LK + +K   L  + + Y   F +D+++ DYG+C + DLL+EIPDST+ V   D D+ +++PKR +++EE ERT QF  EV+DLL+  P  R+ F++FIP+YHHHF RQCK++ YGF+KL+EL +A+P ++Q++E   E+ ++LT+ E ++ALA Q + LL    +  + +      Y KT+GY L L+DY   +L  L  ++  + ++ +                             E KE         V L +R  ++ +  ++L +++ +P     +   +   +Y   Y    N        L  +   +  ++Q+  D       G     +RL  L  F+R ++  L+ F+  ++ L +    + +H G  L   NYGY +L  L+ A   VV +KG G +  +VL  D 
Sbjct:  567 DLQVSNLDYRLPRTELQQSLRDAFARH-GRVKSVDLSPHTDYQLKARVHMSSLQQAISAVSLLHRYKIGSKRIQVSLVTGASNKSLTCLSSEIISILQDAPANCLPLYKFTETYERKFGHKLAVGDLYRLPELVCVREQGGGR--LVCLLSNTQIRQSPLGSSHTHTHDSSNTASPVLFEELEYHEPVCKRHSAQ--QDFSEADFDPDSYMIPFVLESLKVLAAHVHSLLQSHEGMLPLLSFPDCYAAEFSALSVA------------------------EEGQ------LEGSVPLEHLITCIPGVTIVTAQNGFKVIKWIHNKPPPPNADLWLQRSKSPVGNPQ------------LIQFSREMVDLMRSQPSCLMPVSRFIPAYHHHFAKQCRVSDYGYTKLLELLEAVPHVLQILGLGSKRLLTLTHRAQVKRFTQDLLKLLKMQASKQVSLQGFGSAYHWCFSRDWQVVDYGMCDLMDLLSEIPDSTISVCQQDADVIISVPKRERSAEEAERTRQFGREVVDLLRHQPHFRMAFSRFIPTYHHHFGRQCKLSYYGFSKLMELFEAIPDILQVLECGEERLLVLTEVERVKALAAQLVKLLRAQRDSGLPVCRLLGEYSKTFGYCLRLQDYEASTLPALLHRLCHVVKVVDTP---------------------------EGKE---------VQLINRKSLRALTSQLLALMMSLPEERSDVCVEELRCQYELSYGAPLNPCEYGFISLAELLKSLPYLLQLSEDE------GGGNERVRLTRLYQFARRVRALLLTFHYSQLFLSEFSSAFSKHSGETLHTHNYGYNTLEELLAAIPQVVWIKGHGHKKIIVLKNDM 1341          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Zebrafish
Match: MARF1 (meiosis regulator and mRNA stability factor 1 [Source:NCBI gene;Acc:100005105])

HSP 1 Score: 449.129 bits (1154), Expect = 1.196e-132
Identity = 285/864 (32.99%), Postives = 450/864 (52.08%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAI------NSITQATNPSE-----LGETME--SLVCIQHCKEGTEDYITA---LESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEG-VPLEHMLNCIQGIKIVNSQSGIKKIQW-DDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPS--GSLPDYQFLEKYRYKYREEPN--------LMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKD-LMRFNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            DL V+NLDY +   E ++ L + F     RV SV +    D      V + S++ A  A+S  HR KIG KRIQV+LV+  +  S   +  E+ ++L+      L +YKF E YE+K+   + + D YR+ + V +++ GG +   +  L+NT I      +S T   + S      L E +E    VC +H     +D+  A    +S ++P V  SLK+    V+ +LQSH+G + L+SF  CY +EF  + +                         E  Q      LEG VPLEH++ CI G+ IV +Q+G K I+W  +K          Q + SP    Q            L QFSRE+VDLM+ QP+C M +S+FIP YHHHF KQCRV+DYG++KL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LK + +K   L  + + Y   F +D+++ DYG+C + DLL+EIPDST+ V   D D+ +++PKR +++EE ERT QF  EV+DLL+  P  R+ F++FIP+YHHHF RQCK++ YGF+KL+EL +A+P ++Q++E   E+ ++LT+ E ++ALA Q + LL    +  + +      Y KT+GY L L+DY   +L  L  ++  + ++ +                             E KE         V L +R  ++ +  ++L +++ +P     +   +   +Y   Y    N        L  +   +  ++Q+  D       G     +RL  L  F+R ++  L+ F+  ++ L +    + +H G  L   NYGY +L  L+ A   VV +KG G +  +VL  D 
Sbjct:  568 DLQVSNLDYRLPRTELQQSLRDAFARH-GRVKSVDLSPHTDYQLKARVHMSSLQQAISAVSLLHRYKIGSKRIQVSLVTGASNKSLTCLSSEIISILQDAPANCLPLYKFTETYERKFGHKLAVGDLYRLPELVCVREQGGGR--LVCLLSNTQIRQSPLGSSHTHTHDSSNTASPVLFEELEYHEPVCKRH--SAQQDFSEADFDPDSYMIPFVLESLKVLAAHVHSLLQSHEGMLPLLSFPDCYAAEFSALSVA------------------------EEGQ------LEGSVPLEHLITCIPGVTIVTAQNGFKVIKWIHNKPPPPNADLWLQRSKSPVGNPQ------------LIQFSREMVDLMRSQPSCLMPVSRFIPAYHHHFAKQCRVSDYGYTKLLELLEAVPHVLQILGLGSKRLLTLTHRAQVKRFTQDLLKLLKMQASKQVSLQGFGSAYHWCFSRDWQVVDYGMCDLMDLLSEIPDSTISVCQQDADVIISVPKRERSAEEAERTRQFGREVVDLLRHQPHFRMAFSRFIPTYHHHFGRQCKLSYYGFSKLMELFEAIPDILQVLECGEERLLVLTEVERVKALAAQLVKLLRAQRDSGLPVCRLLGEYSKTFGYCLRLQDYEASTLPALLHRLCHVVKVVDTP---------------------------EGKE---------VQLINRKSLRALTSQLLALMMSLPEERSDVCVEELRCQYELSYGAPLNPCEYGFISLAELLKSLPYLLQLSEDE------GGGNERVRLTRLYQFARRVRALLLTFHYSQLFLSEFSSAFSKHSGETLHTHNYGYNTLEELLAAIPQVVWIKGHGHKKIIVLKNDM 1342          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Xenopus
Match: marf1 (meiosis regulator and mRNA stability factor 1 [Source:NCBI gene;Acc:733745])

HSP 1 Score: 443.736 bits (1140), Expect = 2.491e-129
Identity = 246/654 (37.61%), Postives = 376/654 (57.49%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL-TNTAINSITQATNPSELGET-------MESL-----VCIQHC---KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQN 2864
            D+ + NLDY +S KE ++ L + F    K + +V +    D      V++ ++++A  A++  HR KIG KRIQV+L +     S + +     ++L+      L ++KF E+YEKK+   + +SD YR+ D V I+D G   N +++ L  +         ++ S  G +        E L     +C +HC   K    D+    +S I+P V ISLK F  QV+ +LQ+H+G+V L+SF  CY +EF  +K ++                               E   GVPLEH++ CI G+ I  +Q+GIK ++W                  PNS    +     +   +L QFSREV+DL+K+QP+C M ++KFIPTYHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F +D+ + +YGVC + D+++EIPD+T+ V   D +  +++PKR +T EE ERT QF+ EV+DLL+  P  R+PFNKFIPSYHHHF RQCK+  YGFTKL++L +A+P V+Q++E   EK + LT+ E ++ALA Q + LL    +  I + +    Y KT+GY L L DY V S+  L +K+  + +I +
Sbjct:  781 DIQIGNLDYRMSRKELQQTLHDIFSRHGK-IKNVELSPHTDYQLKATVQMENLQEAICAVNSLHRYKIGSKRIQVSLATGATNKSLSLLSFGTVSILQDAPACCLPLFKFTEIYEKKFGHKLIVSDLYRLTDTVTIRDQG---NGRLVCLLPSVQARQSPMGSSQSHDGSSANCSPVVFEELEYHEPICRRHCSNRKFSGHDFDP--DSYIIPFVIISLKTFAPQVHSLLQTHEGTVPLLSFPDCYAAEFSALKEVQ-------------------------------EGQGGVPLEHLITCIPGVNIAFAQNGIKVVKWIH-----------NKPPPPNSDPWLLRSKSPVGNPQLIQFSREVIDLLKNQPSCIMPVTKFIPTYHHHFAKQCRVSDYGYSKLLELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVREFSQAYHWCFSRDWNVTEYGVCDLVDIVSEIPDTTICVSQQDGESVISIPKRERTPEEVERTKQFSKEVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLTYYGFTKLLDLFEAIPDVLQVLECGEEKILALTEMERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKLCHVVKIMD 1386          

HSP 2 Score: 158.688 bits (400), Expect = 3.399e-38
Identity = 97/303 (32.01%), Postives = 163/303 (53.80%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQI-IEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNY 2867
            V+R  QFS+EVVDL++HQP+ RM  +KFIP+YHHHFG+QC++  YGF+KL +L EA+P V+ V+  G  ++L L    +++   ++++K+L+S+   +  + +  T+Y   F    R+ DY V  +  L+ ++    V+++++D      + K+IQ    K   S  A  +I L+       L   +    Y           EYGF  L ELL ++P ++++   +  E  V LT    L   A+   +LL     ++I L EFPN Y K  G VL  + Y   SL+++   +P++  I+ +
Sbjct: 1246 VERTKQFSKEVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLTYYGFTKLLDLFEAIPDVLQVLECGEEKILALTEMERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKL-CHVVKIMDTD------LGKQIQLINRKSLRSLTAQLLILLMSWDESSSLTVEQLCQVYQSVHGIPLNPCEYGFVSLAELLKSLPYLVEVHTNDLCEDSVQLTS---LYVFAKNVRSLLHTYHYQQIFLHEFPNAYSKYVGEVLQPKQYGYSSLEEILGAIPQVVWIKGH 1538          

HSP 3 Score: 59.3066 bits (142), Expect = 6.606e-8
Identity = 54/240 (22.50%), Postives = 112/240 (46.67%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQ-YKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEM 2678
            ++R+   + ++V L++ Q +  +++   +  Y   FG   R+ DY  S +  L++ L  VV ++ T   + + L ++  +R  T +++ +L S    +    E   Q Y+ +        +YG   + +LL  +P   VEV  +D           + S +      FA  V  LL      ++  ++F  +Y  +     +  +YG++ L E+L A+P+V+  I+ HG K +++ + +M
Sbjct: 1322 MERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKLCHVVKIMDTDLGKQIQLINRKSLRSLTAQLLILLMSWDESSSLTVEQLCQVYQSVHGIPLNPCEYGFVSLAELLKSLP-YLVEVHTND---------LCEDSVQLTSLYVFAKNVRSLLHTYHYQQIFLHEFPNAYSKYVGEVLQPKQYGYSSLEEILGAIPQVV-WIKGHGHKRIVVLKNDM 1550          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Xenopus
Match: marf1 (meiosis regulator and mRNA stability factor 1 [Source:NCBI gene;Acc:733745])

HSP 1 Score: 443.351 bits (1139), Expect = 3.067e-129
Identity = 246/654 (37.61%), Postives = 376/654 (57.49%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL-TNTAINSITQATNPSELGET-------MESL-----VCIQHC---KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQN 2864
            D+ + NLDY +S KE ++ L + F    K + +V +    D      V++ ++++A  A++  HR KIG KRIQV+L +     S + +     ++L+      L ++KF E+YEKK+   + +SD YR+ D V I+D G   N +++ L  +         ++ S  G +        E L     +C +HC   K    D+    +S I+P V ISLK F  QV+ +LQ+H+G+V L+SF  CY +EF  +K ++                               E   GVPLEH++ CI G+ I  +Q+GIK ++W                  PNS    +     +   +L QFSREV+DL+K+QP+C M ++KFIPTYHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F +D+ + +YGVC + D+++EIPD+T+ V   D +  +++PKR +T EE ERT QF+ EV+DLL+  P  R+PFNKFIPSYHHHF RQCK+  YGFTKL++L +A+P V+Q++E   EK + LT+ E ++ALA Q + LL    +  I + +    Y KT+GY L L DY V S+  L +K+  + +I +
Sbjct:  748 DIQIGNLDYRMSRKELQQTLHDIFSRHGK-IKNVELSPHTDYQLKATVQMENLQEAICAVNSLHRYKIGSKRIQVSLATGATNKSLSLLSFGTVSILQDAPACCLPLFKFTEIYEKKFGHKLIVSDLYRLTDTVTIRDQG---NGRLVCLLPSVQARQSPMGSSQSHDGSSANCSPVVFEELEYHEPICRRHCSNRKFSGHDFDP--DSYIIPFVIISLKTFAPQVHSLLQTHEGTVPLLSFPDCYAAEFSALKEVQ-------------------------------EGQGGVPLEHLITCIPGVNIAFAQNGIKVVKWIH-----------NKPPPPNSDPWLLRSKSPVGNPQLIQFSREVIDLLKNQPSCIMPVTKFIPTYHHHFAKQCRVSDYGYSKLLELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVREFSQAYHWCFSRDWNVTEYGVCDLVDIVSEIPDTTICVSQQDGESVISIPKRERTPEEVERTKQFSKEVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLTYYGFTKLLDLFEAIPDVLQVLECGEEKILALTEMERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKLCHVVKIMD 1353          

HSP 2 Score: 158.688 bits (400), Expect = 3.452e-38
Identity = 97/303 (32.01%), Postives = 163/303 (53.80%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQI-IEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNY 2867
            V+R  QFS+EVVDL++HQP+ RM  +KFIP+YHHHFG+QC++  YGF+KL +L EA+P V+ V+  G  ++L L    +++   ++++K+L+S+   +  + +  T+Y   F    R+ DY V  +  L+ ++    V+++++D      + K+IQ    K   S  A  +I L+       L   +    Y           EYGF  L ELL ++P ++++   +  E  V LT    L   A+   +LL     ++I L EFPN Y K  G VL  + Y   SL+++   +P++  I+ +
Sbjct: 1213 VERTKQFSKEVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLTYYGFTKLLDLFEAIPDVLQVLECGEEKILALTEMERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKL-CHVVKIMDTD------LGKQIQLINRKSLRSLTAQLLILLMSWDESSSLTVEQLCQVYQSVHGIPLNPCEYGFVSLAELLKSLPYLVEVHTNDLCEDSVQLTS---LYVFAKNVRSLLHTYHYQQIFLHEFPNAYSKYVGEVLQPKQYGYSSLEEILGAIPQVVWIKGH 1505          

HSP 3 Score: 59.6918 bits (143), Expect = 5.820e-8
Identity = 54/240 (22.50%), Postives = 112/240 (46.67%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQ-YKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEM 2678
            ++R+   + ++V L++ Q +  +++   +  Y   FG   R+ DY  S +  L++ L  VV ++ T   + + L ++  +R  T +++ +L S    +    E   Q Y+ +        +YG   + +LL  +P   VEV  +D           + S +      FA  V  LL      ++  ++F  +Y  +     +  +YG++ L E+L A+P+V+  I+ HG K +++ + +M
Sbjct: 1289 MERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKLCHVVKIMDTDLGKQIQLINRKSLRSLTAQLLILLMSWDESSSLTVEQLCQVYQSVHGIPLNPCEYGFVSLAELLKSLP-YLVEVHTND---------LCEDSVQLTSLYVFAKNVRSLLHTYHYQQIFLHEFPNAYSKYVGEVLQPKQYGYSSLEEILGAIPQVVW-IKGHGHKRIVVLKNDM 1517          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Xenopus
Match: marf1 (meiosis regulator and mRNA stability factor 1 [Source:NCBI gene;Acc:733745])

HSP 1 Score: 442.58 bits (1137), Expect = 5.576e-129
Identity = 246/654 (37.61%), Postives = 376/654 (57.49%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL-TNTAINSITQATNPSELGET-------MESL-----VCIQHC---KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQN 2864
            D+ + NLDY +S KE ++ L + F    K + +V +    D      V++ ++++A  A++  HR KIG KRIQV+L +     S + +     ++L+      L ++KF E+YEKK+   + +SD YR+ D V I+D G   N +++ L  +         ++ S  G +        E L     +C +HC   K    D+    +S I+P V ISLK F  QV+ +LQ+H+G+V L+SF  CY +EF  +K ++                               E   GVPLEH++ CI G+ I  +Q+GIK ++W                  PNS    +     +   +L QFSREV+DL+K+QP+C M ++KFIPTYHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F +D+ + +YGVC + D+++EIPD+T+ V   D +  +++PKR +T EE ERT QF+ EV+DLL+  P  R+PFNKFIPSYHHHF RQCK+  YGFTKL++L +A+P V+Q++E   EK + LT+ E ++ALA Q + LL    +  I + +    Y KT+GY L L DY V S+  L +K+  + +I +
Sbjct:  737 DIQIGNLDYRMSRKELQQTLHDIFSRHGK-IKNVELSPHTDYQLKATVQMENLQEAICAVNSLHRYKIGSKRIQVSLATGATNKSLSLLSFGTVSILQDAPACCLPLFKFTEIYEKKFGHKLIVSDLYRLTDTVTIRDQG---NGRLVCLLPSVQARQSPMGSSQSHDGSSANCSPVVFEELEYHEPICRRHCSNRKFSGHDFDP--DSYIIPFVIISLKTFAPQVHSLLQTHEGTVPLLSFPDCYAAEFSALKEVQ-------------------------------EGQGGVPLEHLITCIPGVNIAFAQNGIKVVKWIH-----------NKPPPPNSDPWLLRSKSPVGNPQLIQFSREVIDLLKNQPSCIMPVTKFIPTYHHHFAKQCRVSDYGYSKLLELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVREFSQAYHWCFSRDWNVTEYGVCDLVDIVSEIPDTTICVSQQDGESVISIPKRERTPEEVERTKQFSKEVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLTYYGFTKLLDLFEAIPDVLQVLECGEEKILALTEMERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKLCHVVKIMD 1342          

HSP 2 Score: 158.688 bits (400), Expect = 3.908e-38
Identity = 97/303 (32.01%), Postives = 163/303 (53.80%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQI-IEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNY 2867
            V+R  QFS+EVVDL++HQP+ RM  +KFIP+YHHHFG+QC++  YGF+KL +L EA+P V+ V+  G  ++L L    +++   ++++K+L+S+   +  + +  T+Y   F    R+ DY V  +  L+ ++    V+++++D      + K+IQ    K   S  A  +I L+       L   +    Y           EYGF  L ELL ++P ++++   +  E  V LT    L   A+   +LL     ++I L EFPN Y K  G VL  + Y   SL+++   +P++  I+ +
Sbjct: 1202 VERTKQFSKEVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLTYYGFTKLLDLFEAIPDVLQVLECGEEKILALTEMERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKL-CHVVKIMDTD------LGKQIQLINRKSLRSLTAQLLILLMSWDESSSLTVEQLCQVYQSVHGIPLNPCEYGFVSLAELLKSLPYLVEVHTNDLCEDSVQLTS---LYVFAKNVRSLLHTYHYQQIFLHEFPNAYSKYVGEVLQPKQYGYSSLEEILGAIPQVVWIKGH 1494          

HSP 3 Score: 59.3066 bits (142), Expect = 7.060e-8
Identity = 54/240 (22.50%), Postives = 112/240 (46.67%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQ-YKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEM 2678
            ++R+   + ++V L++ Q +  +++   +  Y   FG   R+ DY  S +  L++ L  VV ++ T   + + L ++  +R  T +++ +L S    +    E   Q Y+ +        +YG   + +LL  +P   VEV  +D           + S +      FA  V  LL      ++  ++F  +Y  +     +  +YG++ L E+L A+P+V+  I+ HG K +++ + +M
Sbjct: 1278 MERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKLCHVVKIMDTDLGKQIQLINRKSLRSLTAQLLILLMSWDESSSLTVEQLCQVYQSVHGIPLNPCEYGFVSLAELLKSLP-YLVEVHTND---------LCEDSVQLTSLYVFAKNVRSLLHTYHYQQIFLHEFPNAYSKYVGEVLQPKQYGYSSLEEILGAIPQVVW-IKGHGHKRIVVLKNDM 1506          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Xenopus
Match: marf1 (meiosis regulator and mRNA stability factor 1 [Source:NCBI gene;Acc:733745])

HSP 1 Score: 442.58 bits (1137), Expect = 6.229e-129
Identity = 246/654 (37.61%), Postives = 376/654 (57.49%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL-TNTAINSITQATNPSELGET-------MESL-----VCIQHC---KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQN 2864
            D+ + NLDY +S KE ++ L + F    K + +V +    D      V++ ++++A  A++  HR KIG KRIQV+L +     S + +     ++L+      L ++KF E+YEKK+   + +SD YR+ D V I+D G   N +++ L  +         ++ S  G +        E L     +C +HC   K    D+    +S I+P V ISLK F  QV+ +LQ+H+G+V L+SF  CY +EF  +K ++                               E   GVPLEH++ CI G+ I  +Q+GIK ++W                  PNS    +     +   +L QFSREV+DL+K+QP+C M ++KFIPTYHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F +D+ + +YGVC + D+++EIPD+T+ V   D +  +++PKR +T EE ERT QF+ EV+DLL+  P  R+PFNKFIPSYHHHF RQCK+  YGFTKL++L +A+P V+Q++E   EK + LT+ E ++ALA Q + LL    +  I + +    Y KT+GY L L DY V S+  L +K+  + +I +
Sbjct:  752 DIQIGNLDYRMSRKELQQTLHDIFSRHGK-IKNVELSPHTDYQLKATVQMENLQEAICAVNSLHRYKIGSKRIQVSLATGATNKSLSLLSFGTVSILQDAPACCLPLFKFTEIYEKKFGHKLIVSDLYRLTDTVTIRDQG---NGRLVCLLPSVQARQSPMGSSQSHDGSSANCSPVVFEELEYHEPICRRHCSNRKFSGHDFDP--DSYIIPFVIISLKTFAPQVHSLLQTHEGTVPLLSFPDCYAAEFSALKEVQ-------------------------------EGQGGVPLEHLITCIPGVNIAFAQNGIKVVKWIH-----------NKPPPPNSDPWLLRSKSPVGNPQLIQFSREVIDLLKNQPSCIMPVTKFIPTYHHHFAKQCRVSDYGYSKLLELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVREFSQAYHWCFSRDWNVTEYGVCDLVDIVSEIPDTTICVSQQDGESVISIPKRERTPEEVERTKQFSKEVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLTYYGFTKLLDLFEAIPDVLQVLECGEEKILALTEMERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKLCHVVKIMD 1357          

HSP 2 Score: 158.303 bits (399), Expect = 4.522e-38
Identity = 97/303 (32.01%), Postives = 163/303 (53.80%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQI-IEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNY 2867
            V+R  QFS+EVVDL++HQP+ RM  +KFIP+YHHHFG+QC++  YGF+KL +L EA+P V+ V+  G  ++L L    +++   ++++K+L+S+   +  + +  T+Y   F    R+ DY V  +  L+ ++    V+++++D      + K+IQ    K   S  A  +I L+       L   +    Y           EYGF  L ELL ++P ++++   +  E  V LT    L   A+   +LL     ++I L EFPN Y K  G VL  + Y   SL+++   +P++  I+ +
Sbjct: 1217 VERTKQFSKEVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLTYYGFTKLLDLFEAIPDVLQVLECGEEKILALTEMERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKL-CHVVKIMDTD------LGKQIQLINRKSLRSLTAQLLILLMSWDESSSLTVEQLCQVYQSVHGIPLNPCEYGFVSLAELLKSLPYLVEVHTNDLCEDSVQLTS---LYVFAKNVRSLLHTYHYQQIFLHEFPNAYSKYVGEVLQPKQYGYSSLEEILGAIPQVVWIKGH 1509          

HSP 3 Score: 59.3066 bits (142), Expect = 7.556e-8
Identity = 54/240 (22.50%), Postives = 112/240 (46.67%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQ-YKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEM 2678
            ++R+   + ++V L++ Q +  +++   +  Y   FG   R+ DY  S +  L++ L  VV ++ T   + + L ++  +R  T +++ +L S    +    E   Q Y+ +        +YG   + +LL  +P   VEV  +D           + S +      FA  V  LL      ++  ++F  +Y  +     +  +YG++ L E+L A+P+V+  I+ HG K +++ + +M
Sbjct: 1293 MERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKLCHVVKIMDTDLGKQIQLINRKSLRSLTAQLLILLMSWDESSSLTVEQLCQVYQSVHGIPLNPCEYGFVSLAELLKSLP-YLVEVHTND---------LCEDSVQLTSLYVFAKNVRSLLHTYHYQQIFLHEFPNAYSKYVGEVLQPKQYGYSSLEEILGAIPQVVW-IKGHGHKRIVVLKNDM 1521          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Xenopus
Match: marf1 (meiosis regulator and mRNA stability factor 1 [Source:NCBI gene;Acc:733745])

HSP 1 Score: 416.772 bits (1070), Expect = 4.036e-120
Identity = 242/654 (37.00%), Postives = 365/654 (55.81%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL-TNTAINSITQATNPSELGET-------MESL-----VCIQHC---KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQN 2864
            D+ + NLDY +S KE ++ L + F    K + +V +    D      V++ ++++A  A++  HR KIG KRIQV+L +                        SLS+ +F        H+ I +SD YR+ D V I+D G   N +++ L  +         ++ S  G +        E L     +C +HC   K    D+    +S I+P V ISLK F  QV+ +LQ+H+G+V L+SF  CY +EF  +K ++                               E   GVPLEH++ CI G+ I  +Q+GIK ++W                  PNS    +     +   +L QFSREV+DL+K+QP+C M ++KFIPTYHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F +D+ + +YGVC + D+++EIPD+T+ V   D +  +++PKR +T EE ERT QF+ EV+DLL+  P  R+PFNKFIPSYHHHF RQCK+  YGFTKL++L +A+P V+Q++E   EK + LT+ E ++ALA Q + LL    +  I + +    Y KT+GY L L DY V S+  L +K+  + +I +
Sbjct:  781 DIQIGNLDYRMSRKELQQTLHDIFSRHGK-IKNVELSPHTDYQLKATVQMENLQEAICAVNSLHRYKIGSKRIQVSLATG-------------------ATNKSLSLLRFG-------HKLI-VSDLYRLTDTVTIRDQG---NGRLVCLLPSVQARQSPMGSSQSHDGSSANCSPVVFEELEYHEPICRRHCSNRKFSGHDFDP--DSYIIPFVIISLKTFAPQVHSLLQTHEGTVPLLSFPDCYAAEFSALKEVQ-------------------------------EGQGGVPLEHLITCIPGVNIAFAQNGIKVVKWIH-----------NKPPPPNSDPWLLRSKSPVGNPQLIQFSREVIDLLKNQPSCIMPVTKFIPTYHHHFAKQCRVSDYGYSKLLELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVREFSQAYHWCFSRDWNVTEYGVCDLVDIVSEIPDTTICVSQQDGESVISIPKRERTPEEVERTKQFSKEVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLTYYGFTKLLDLFEAIPDVLQVLECGEEKILALTEMERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKLCHVVKIMD 1359          

HSP 2 Score: 158.688 bits (400), Expect = 3.358e-38
Identity = 97/303 (32.01%), Postives = 163/303 (53.80%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQI-IEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNY 2867
            V+R  QFS+EVVDL++HQP+ RM  +KFIP+YHHHFG+QC++  YGF+KL +L EA+P V+ V+  G  ++L L    +++   ++++K+L+S+   +  + +  T+Y   F    R+ DY V  +  L+ ++    V+++++D      + K+IQ    K   S  A  +I L+       L   +    Y           EYGF  L ELL ++P ++++   +  E  V LT    L   A+   +LL     ++I L EFPN Y K  G VL  + Y   SL+++   +P++  I+ +
Sbjct: 1219 VERTKQFSKEVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLTYYGFTKLLDLFEAIPDVLQVLECGEEKILALTEMERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKL-CHVVKIMDTD------LGKQIQLINRKSLRSLTAQLLILLMSWDESSSLTVEQLCQVYQSVHGIPLNPCEYGFVSLAELLKSLPYLVEVHTNDLCEDSVQLTS---LYVFAKNVRSLLHTYHYQQIFLHEFPNAYSKYVGEVLQPKQYGYSSLEEILGAIPQVVWIKGH 1511          

HSP 3 Score: 59.3066 bits (142), Expect = 6.478e-8
Identity = 54/240 (22.50%), Postives = 112/240 (46.67%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQ-YKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEM 2678
            ++R+   + ++V L++ Q +  +++   +  Y   FG   R+ DY  S +  L++ L  VV ++ T   + + L ++  +R  T +++ +L S    +    E   Q Y+ +        +YG   + +LL  +P   VEV  +D           + S +      FA  V  LL      ++  ++F  +Y  +     +  +YG++ L E+L A+P+V+  I+ HG K +++ + +M
Sbjct: 1295 MERIKALASQLVKLLRSQKDSSINMPDLLTEYSKTFGYSLRLHDYDVSSVPALMQKLCHVVKIMDTDLGKQIQLINRKSLRSLTAQLLILLMSWDESSSLTVEQLCQVYQSVHGIPLNPCEYGFVSLAELLKSLP-YLVEVHTND---------LCEDSVQLTSLYVFAKNVRSLLHTYHYQQIFLHEFPNAYSKYVGEVLQPKQYGYSSLEEILGAIPQVV-WIKGHGHKRIVVLKNDM 1523          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Mouse
Match: Marf1 (meiosis regulator and mRNA stability 1 [Source:MGI Symbol;Acc:MGI:2444505])

HSP 1 Score: 456.833 bits (1174), Expect = 8.637e-134
Identity = 279/859 (32.48%), Postives = 466/859 (54.25%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL--TNTAINS--------ITQATNPSE-LGETME--SLVCIQHCK-EGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGS-LPDYQFLEKYRYKYREEPN--------LMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKDLMR-FNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            D+ V+N+DY +S KE ++LL   F     +V SV +    D     IV++ ++ +A  A++  HR KIG K+I V+L +  A  S + +  E  ++L+      L ++KF+++YEKKY   + +SD Y++ D + I++ G   N +++ L  +N A  S           ++N S  L E +E    VC QHC  +   + +   +S  +P V +SLK+F  QV+ +LQ+H+G+V L+SF  CY +EF D++I +                               +  +GVPLEH + CI G+ I  +Q+G+K ++W                  PN+    +     +   +L QFSREV+DL+K QP+C + +S FIP+YHHHFGKQCRV+DYG+SKL EL+EA+P V+ ++G G  R++ L H+ QV+RFT +++K+LKS+ +K   + ++   Y   F KD+ + +YGVC + D+++EIPD+T+ +   DDD+ + + KR +T +E ERT QF+ +V+DLL+  P  R+PFNKFIPSYHHHF RQCK+A YGFTKL+ELL+A+P+++Q++E   EK + LT+ E  +ALA Q + LL       + +++    Y KT+GY   L+DY V S+  L +K+  + ++                A +ES  Q+                     L +R  ++ +  ++L++L+     + LP  +    Y   +    N        L  +   +  ++++  +    +Y       ++L SL LF+++++ L+  ++  ++ L +    Y ++ G  L+ + YGY S+  L+ A   VV +KG G +  +VL  D 
Sbjct:  790 DIQVSNVDYRLSRKELQQLLQEAFSKH-GQVKSVELSPHTDYQLKAIVQMRNLHEAICAVNSLHRHKIGSKKILVSLSTGAANKSLSLLSTETMSILQDAPACCLPLFKFIDIYEKKYGHKLNVSDLYKLTDTIAIREQG---NGRLVCLLPSNQARQSPLGSSQSHDGSSSNCSPVLFEELEYHEPVCKQHCSNKDFSELVFDPDSYKIPFVVLSLKVFAPQVHSLLQTHQGTVPLLSFPDCYAAEFGDLEITQ-------------------------------DSHKGVPLEHFITCIPGVNIATAQNGVKVVKWI-----------HNKPPPPNTDPWLLRSKSPVRNPQLIQFSREVIDLLKTQPSCILPVSNFIPSYHHHFGKQCRVSDYGYSKLIELLEAVPHVLQILGMGSKRLMTLTHRAQVKRFTQDLLKLLKSQASKQVIVRDFSQAYHWCFSKDWDVTEYGVCDLIDIISEIPDTTICLSQQDDDMVICIRKRERTQDEIERTKQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELLEAIPEILQVLECGEEKILTLTEVERFKALAAQFVKLLRSQKGNCLMMTDLFTEYAKTFGYTFRLQDYDVSSVSALTQKLCHVVKV----------------ADMESGKQIQ--------------------LINRKSLRSLTAQLLVLLMSWEGDAYLPVDELRRHYETTHSTPLNPCEYGFMTLTELLKSLPYLVEVCTNDKAEEY-------VKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYNKYVGETLQPKTYGYSSVEELLGAIPQVVWIKGHGHKRIVVLKNDM 1559          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. UniProt/SwissProt
Match: sp|Q8VIG2|MARF1_RAT (Meiosis regulator and mRNA stability factor 1 OS=Rattus norvegicus OX=10116 GN=Marf1 PE=1 SV=2)

HSP 1 Score: 461.84 bits (1187), Expect = 1.041e-134
Identity = 289/860 (33.60%), Postives = 468/860 (54.42%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL--TNTAINSI--------TQATNPSE-LGETME--SLVCIQHCK-EGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGS-LPDYQFLEKYRYKYREEPN-----LMLIQNEMQDIIQIV----NDSSLLQYPGSSGLHIRLKSLILFSRDLKDLMR-FNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            D+ V+N+DY +S KE ++LL   F     +V SV +    D     IV++ ++ DA  A++  HR KIG K+I V+L +  A  S + +  E  ++L+      L ++KF+++YEKKY   + +SD Y++ D + I++ G   N +++ L  +N A  S           +TN S  L E +E    VC QHC  +   + +   +S  +P V +SLK+F  QV+ +LQ+H+G+V L+SF  CY +EF D++I                           TQ  D    +GVPLEH + CI G+ I  +Q+G+K ++W                  PN+    +     +   +L QFSREV+DL+K+QP+C + +S FIP YHHHFGKQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   +S++   Y   F KD+ + +YGVC + D+++EIPD+T+ +   DDD+ + + KR +T +E ERT QF+ +V+DLL+  P  R+PFNKFIPSYHHHF RQCK+A YGFTKL+ELL+A+P+++Q++E   EK + LT+ E  +ALA Q + LL       + +++    Y KT+GY   L+DY V S+  L +K+  + ++                A +ES  Q+ L +                    R  ++ +  ++L+VL+     + LP  +    Y   +    N      M +   ++ +  +V    ND         +   ++L SL LF+++++ L+  ++  ++ L +    Y ++ G  L+ + YGY S+  L+ A   VV +KG G +  +VL  D 
Sbjct:  789 DIQVSNVDYRLSRKELQQLLQEAFSKH-GQVKSVELSPHTDYQLKAIVQMRNLHDAICAVNSLHRYKIGSKKILVSLSTGAANKSLSLLSTETMSILQDAPACCLPLFKFIDIYEKKYGHKLNVSDLYKLTDMIAIREQG---NGRLVCLLPSNQARQSPLGSSQSHDGSSTNCSPVLFEELEYHESVCKQHCSNKDFSELVFDPDSYKVPFVVLSLKVFAPQVHSLLQTHEGTVPLLSFPDCYAAEFGDLEI---------------------------TQDRD----KGVPLEHFITCIPGVNIATAQNGVKVVKWIH-----------NKPPPPNTDPWLLRSKSPVRNPQLIQFSREVIDLLKNQPSCILPISNFIPLYHHHFGKQCRVSDYGYSKLIELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVSDFSQAYHWCFSKDWDVTEYGVCDLIDIISEIPDTTICLSQQDDDMVICIRKRERTQDEIERTKQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELLEAIPEILQVLECGEEKILTLTEVERFKALAAQFVKLLRSQKGNCLMMTDLFTEYAKTFGYTFRLQDYDVSSVSALTQKLCHVVKV----------------ADMESGKQIQLIT--------------------RKSLRPLTVQLLVVLMSWEGDAYLPVDELKRHYETTHSTPLNPCEYGFMTLTELLKSLPSLVEVFMND--------KAEECVKLTSLYLFAKNVRSLLHTYHYQQIFLHEFAMAYTKYVGETLQPKTYGYSSVEELLGAIPQVVWIKGHGHKRIVVLKNDM 1558          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. UniProt/SwissProt
Match: sp|E1BZ85|MARF1_CHICK (Meiosis regulator and mRNA stability factor 1 OS=Gallus gallus OX=9031 GN=MARF1 PE=3 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 1.154e-133
Identity = 283/851 (33.25%), Postives = 470/851 (55.23%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKII--------SLTNTAINSITQATNPSELGETME--SLVCIQHC--KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPGSSGL---HIRLKSLILFSRDLKDLMR-FNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            D+ ++N+DY +S KE ++ L   F    K V  V +    D      V++ ++++A  A++  HR KIG KRIQV+L +  A  S + +  E  ++L+      L ++KF E+YEKK+ R + +SD Y++ D V I+D GG +   ++         L ++  +  + A     + E +E    VC QHC  K+  E      +S  +P   +SLK F  QV+ +LQ+H+G+V L+SF  CY SEF+D++++                             P+ +   GVPLEH++ C+ G+ I  +Q+GIK I+W       +      TT  P    +S + +G     +L QFSREV+DL+K QP+C + +SKFIPTYHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F KD+ + +YGVC + D+++EIPD+T+ +   D+++ + +PKR +T EE ERT QF+ EV+DLL+  P  R+PF+KFIPSYHHHF RQCK+A YGFTKL+EL +A+P+V+Q++E   EK + LT+ E ++A+A Q + LL    +  + +S+  + Y KT+GY L L DY V S+  L +K+  + ++                   ES  Q+                     L +R  ++ +  ++L++L+     S    + L+++ Y+     +L   +     + +++     L    ++G    ++RL +L +F+++++ L+  ++  ++ L +    Y ++ G  L+ + YG  +L  L+ A   VV +KG G +  +VL  D 
Sbjct:  789 DIQISNIDYRLSRKELQQTLQETFSRHGK-VKCVELSPHTDYQLKATVQMENLQEAISAVNSLHRYKIGSKRIQVSLATGAANKSLSLLSSETVSILQDAPACCLPMFKFTEIYEKKFGRKLMVSDLYKLTDTVAIRDQGGGRLVCLLPSSQARQSPLGSSQSHDGSSANCSPIIFEELEYHEPVCKQHCLNKDVIEHEFDP-DSYRIPFAILSLKTFAPQVHSLLQTHEGTVPLLSFPDCYMSEFNDLEMV-----------------------------PEGQ--GGVPLEHLITCVPGVNIATAQNGIKVIKW------IHNKPPPPTTVDP-WLLRSKSPVGN---PQLIQFSREVIDLLKSQPSCIIPVSKFIPTYHHHFAKQCRVSDYGYSKLMELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVKEFLQAYHWCFSKDWDVTEYGVCELADIISEIPDTTICLSQQDNEMVICIPKRERTQEEIERTKQFSKEVVDLLRHQPHFRMPFSKFIPSYHHHFGRQCKLAYYGFTKLLELFEAIPEVLQVLECGEEKILTLTEVEQVKAVAAQFVKLLRSQKDNCLMMSDLLSEYSKTFGYTLRLHDYDVSSVPALMQKLCHVVKV----------------VDTESGKQIQ--------------------LINRKSLRTLTAQLLVLLMSWDGASFLSVEQLKQH-YETIHSTSLNPCEYGFMTLTELLKSLPYLVEVFTNGAEEEYVRLTNLYMFAKNVRSLLHTYHYQQIFLHEFLVAYSKYTGEVLQPKAYGCNNLEELLGAIPQVVWIKGHGHKRIVVLKNDM 1559          

HSP 2 Score: 61.6178 bits (148), Expect = 7.157e-8
Identity = 62/281 (22.06%), Postives = 123/281 (43.77%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQP-NCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKT-CRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLE 2798
            V+++   + + V L++ Q  NC M +S  +  Y   FG   R+ DY  S +  L++ L  VV V+ T   + + L ++  +R  T +++ +L S    +   + +    Y+ +        +YG   + +LL  +P       N  ++ YV +               FA  V  LL      ++  ++F+ +Y  +     +   YG   L ELL A+P+V+  I+ HG K +++ + +M    +  +  L +   +   QL +     ++T G   ++E
Sbjct: 1331 VEQVKAVAAQFVKLLRSQKDNCLM-MSDLLSEYSKTFGYTLRLHDYDVSSVPALMQKLCHVVKVVDTESGKQIQLINRKSLRTLTAQLLVLLMSWDGASFLSVEQLKQHYETIHSTSLNPCEYGFMTLTELLKSLPYLVEVFTNGAEEEYVRL----------TNLYMFAKNVRSLLHTYHYQQIFLHEFLVAYSKYTGEVLQPKAYGCNNLEELLGAIPQVVW-IKGHGHKRIVVLKNDMKTRFSSPSFPLADHVDDHGNQLDDHNGHIMETPGSTSSME 1599          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. UniProt/SwissProt
Match: sp|Q8BJ34|MARF1_MOUSE (Meiosis regulator and mRNA stability factor 1 OS=Mus musculus OX=10090 GN=Marf1 PE=1 SV=3)

HSP 1 Score: 456.833 bits (1174), Expect = 6.360e-133
Identity = 279/859 (32.48%), Postives = 466/859 (54.25%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL--TNTAINS--------ITQATNPSE-LGETME--SLVCIQHCK-EGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGS-LPDYQFLEKYRYKYREEPN--------LMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKDLMR-FNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            D+ V+N+DY +S KE ++LL   F     +V SV +    D     IV++ ++ +A  A++  HR KIG K+I V+L +  A  S + +  E  ++L+      L ++KF+++YEKKY   + +SD Y++ D + I++ G   N +++ L  +N A  S           ++N S  L E +E    VC QHC  +   + +   +S  +P V +SLK+F  QV+ +LQ+H+G+V L+SF  CY +EF D++I +                               +  +GVPLEH + CI G+ I  +Q+G+K ++W                  PN+    +     +   +L QFSREV+DL+K QP+C + +S FIP+YHHHFGKQCRV+DYG+SKL EL+EA+P V+ ++G G  R++ L H+ QV+RFT +++K+LKS+ +K   + ++   Y   F KD+ + +YGVC + D+++EIPD+T+ +   DDD+ + + KR +T +E ERT QF+ +V+DLL+  P  R+PFNKFIPSYHHHF RQCK+A YGFTKL+ELL+A+P+++Q++E   EK + LT+ E  +ALA Q + LL       + +++    Y KT+GY   L+DY V S+  L +K+  + ++                A +ES  Q+                     L +R  ++ +  ++L++L+     + LP  +    Y   +    N        L  +   +  ++++  +    +Y       ++L SL LF+++++ L+  ++  ++ L +    Y ++ G  L+ + YGY S+  L+ A   VV +KG G +  +VL  D 
Sbjct:  782 DIQVSNVDYRLSRKELQQLLQEAFSKH-GQVKSVELSPHTDYQLKAIVQMRNLHEAICAVNSLHRHKIGSKKILVSLSTGAANKSLSLLSTETMSILQDAPACCLPLFKFIDIYEKKYGHKLNVSDLYKLTDTIAIREQG---NGRLVCLLPSNQARQSPLGSSQSHDGSSSNCSPVLFEELEYHEPVCKQHCSNKDFSELVFDPDSYKIPFVVLSLKVFAPQVHSLLQTHQGTVPLLSFPDCYAAEFGDLEITQ-------------------------------DSHKGVPLEHFITCIPGVNIATAQNGVKVVKWI-----------HNKPPPPNTDPWLLRSKSPVRNPQLIQFSREVIDLLKTQPSCILPVSNFIPSYHHHFGKQCRVSDYGYSKLIELLEAVPHVLQILGMGSKRLMTLTHRAQVKRFTQDLLKLLKSQASKQVIVRDFSQAYHWCFSKDWDVTEYGVCDLIDIISEIPDTTICLSQQDDDMVICIRKRERTQDEIERTKQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELLEAIPEILQVLECGEEKILTLTEVERFKALAAQFVKLLRSQKGNCLMMTDLFTEYAKTFGYTFRLQDYDVSSVSALTQKLCHVVKV----------------ADMESGKQIQ--------------------LINRKSLRSLTAQLLVLLMSWEGDAYLPVDELRRHYETTHSTPLNPCEYGFMTLTELLKSLPYLVEVCTNDKAEEY-------VKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYNKYVGETLQPKTYGYSSVEELLGAIPQVVWIKGHGHKRIVVLKNDM 1551          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. UniProt/SwissProt
Match: sp|E1BP74|MARF1_BOVIN (Meiosis regulator and mRNA stability factor 1 OS=Bos taurus OX=9913 GN=MARF1 PE=3 SV=2)

HSP 1 Score: 451.055 bits (1159), Expect = 6.816e-131
Identity = 273/861 (31.71%), Postives = 464/861 (53.89%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL--TNTAINSITQATNPSELGET------MESL-----VCIQHC--KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEP------NLMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKDLMR-FNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDFVGKL 3467
            D+ ++NLDY +S KE ++L+   F    K V SV +    D     +V++ ++++A  A++  HR KIG K+I V+L +  A  S + +  E  ++L+      L ++KF ++YEKK+   + +SD Y++ D V I++ G   N +++ L  ++ A  S   ++   +   T       E L     VC QHC  K+ +E      +S  +P V +SLK F  QV+ +LQ+H+G+V L+SF  CY +EF +++I++                       EN          GVPLEH++ C+ G+ I  +Q+G+K ++W                  PN+    +     +   +L QFSREV+DL+K+QP+C + +S FIP+YHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F KD+ + +YGVC + D+++EIPD+T+ +   D +  + +P+R +T +E ERT QF+ +V+DLL+  P  R+PFNKFIPSYHHHF RQCK+A YGFTKL+EL +A+P ++Q++E   EK + LT+ E  +ALA Q + LL    +  + +++    Y KT+GY   L+DY V S+  L +K+  + ++                A +ES  Q+                     L +R  ++ +  ++L++L+     +      L+++       P        M +   ++ +  +V D         +   ++L SL LF+++++ L+  ++  ++ L +    Y ++ G  L+ + YG+ S+  L+ A   VV +KG G +  +VL  D   ++
Sbjct:  789 DVQISNLDYRLSRKELQQLMQEAFSRHGK-VKSVELSPHTDYQLKAVVQMENLQEAIGAVNSLHRYKIGSKKILVSLATGAANKSLSLLSAETMSILQDAPACCLPLFKFTDIYEKKFGHRLNVSDLYKLTDTVAIREQG---NGRLVCLLPSSQARQSPLGSSQSHDGSSTNCSPIIFEELEYHEPVCRQHCPNKDFSEHEFDP-DSYKIPFVILSLKTFAPQVHSLLQTHEGTVPLLSFPDCYAAEFGELEIVQ-----------------------ENRGG-------GVPLEHLITCVPGVNIATAQNGVKVVKWIH-----------NKPPPPNTDPWLLRSKSPVGNPQLIQFSREVIDLLKNQPSCVIPISNFIPSYHHHFAKQCRVSDYGYSKLIELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVKEFAQAYHWCFSKDWDVTEYGVCELIDIISEIPDTTICLSQQDSEAMICIPRRERTQDEIERTKQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELFEAIPDILQVLECGEEKILTLTEVERFKALAAQFVKLLRSQKDNCLMMTDLLKEYAKTFGYTFRLQDYDVSSVSALTQKLCHVVKV----------------ADMESGKQIQ--------------------LINRKSLRALTAQLLVLLMSWEGTTHLSVDELKRHYESTHSTPLNPCEYGFMTLTELLKSLPYLVEDQVFTN--DKTEECVKLTSLYLFAKNVRSLLHTYHYQQLFLHEFSMAYSKYVGETLQPKTYGFSSVEELLGAIPQVVWIKGHGHKRIVVLKNDMKSRV 1565          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. UniProt/SwissProt
Match: sp|Q9Y4F3|MARF1_HUMAN (Meiosis regulator and mRNA stability factor 1 OS=Homo sapiens OX=9606 GN=MARF1 PE=1 SV=6)

HSP 1 Score: 448.743 bits (1153), Expect = 5.379e-130
Identity = 274/860 (31.86%), Postives = 462/860 (53.72%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISL--TNTAINSITQATNPSELGET------MESL-----VCIQHC--KEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEP---------NLMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKDLMR-FNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            D+ V+N+DY +S KE ++LL   F    K V SV +    D     +V++ +++DA  A++  HR KIG K+I V+L +  A  S + +  E  ++L+      L ++KF ++YEKK+   + +SD Y++ D V I++ G   N +++ L  ++ A  S   ++   +   T       E L     VC QHC  K+ +E      +S  +P V +SLK F  QV+ +LQ+H+G+V L+SF  CY +EF D+++++                               E   GVPLEH + C+ G+ I  +Q+GIK ++W                  PN+    +     +   +L QFSREV+DL+K QP+C + +S FIP+YHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LKS+ +K   + E+   Y   F KD+ + +YGVC + D+++EIPD+T+ +   D+++ + +PKR +T +E ERT QF+ +V+DLL+  P  R+PFNKFIPSYHHHF RQCK+A YGFTKL+EL +A+P  +Q++E   EK + LT+ E  +ALA Q + LL    +  + +++    Y KT+GY   L+DY V S+  L +K+  + ++                A +ES  Q+                     L +R  ++ +  ++L++L+     +    + L+++       P          L  +   +  ++++  +  + +        ++L SL LF+++++ L+  ++  ++ L +    Y ++ G  L+ + YG+ S+  L+ A   VV +KG G +  +VL  D 
Sbjct:  792 DVQVSNIDYRLSRKELQQLLQEAFARHGK-VKSVELSPHTDYQLKAVVQMENLQDAIGAVNSLHRYKIGSKKILVSLATGAASKSLSLLSAETMSVLQDAPACCLPLFKFTDIYEKKFGHKLNVSDLYKLTDTVAIREQG---NGRLVCLLPSSQARQSPLGSSQSHDGSSTNCSPIIFEELEYHEPVCRQHCSNKDFSEHEFDP-DSYKIPFVILSLKTFAPQVHSLLQTHEGTVPLLSFPDCYIAEFGDLEVVQ-------------------------------ENQGGVPLEHFITCVPGVNIATAQNGIKVVKWIH-----------NKPPPPNTDPWLLRSKSPVGNPQLIQFSREVIDLLKSQPSCVIPISHFIPSYHHHFAKQCRVSDYGYSKLIELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVREFSQAYHWCFSKDWDVTEYGVCELIDIVSEIPDTTICLSQQDNEMVICIPKRERTQDEIERTKQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELFEAIPDTLQVLECGEEKILTLTEVERFKALAAQFVKLLRSQKDNCLMMTDLLTEYAKTFGYTFRLQDYDVSSISALTQKLCHVVKV----------------ADIESGRQIQ--------------------LINRKSLRSLTAQLLVLLMSWEGTTHLSVEELKRHYESTHNTPLNPCEYGFMTLTELLKSLPYLVEVFTNDKMEEC-------VKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYTKYVGETLQPKTYGHSSVEELLGAIPQVVWIKGHGHKRIVVLKNDM 1561          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. TrEMBL
Match: A0A4E0RB91 (Limkain-b1 OS=Fasciola hepatica OX=6192 GN=D915_003078 PE=4 SV=1)

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 457/1040 (43.94%), Postives = 638/1040 (61.35%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIM--------------KIPVATNA------------PDQVESEPLNNIRES----------------DENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTD------------------------GSYKA------SQDQTTGSPNSYNQSV---NGLG--GILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNY-------------STISPTSKTKTYNASVESEDQVSLSSDLEDKEALV-----------------------------EQSEM--------FVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQI-------------------------VNDSSLLQYPGSSGLH------------------------------------IRLKSLILFSRDLKDLMRFNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDFVGKLAYRIAYNTQPILK 3506
            +LLV+NLDYNI AKEWRK+L  Q Q+ +K VHS++IQTQ DGSN  I+++GS+EDARLAIS FHRKKIGYKRIQVN+VS N       +K EV +LL+SV+  +L V KF++L+EK+YHRSI +SD Y+M+D +EIK+  G+Q  ++I+L+  A     Q  + +E   + + ++C +HC EG++DY+ A++ A+LPNV++SL +F++ V K+LQ H GS+ L+SF +CYK+EF ++ ++              K P  TN             P      P+ N   S                D  T++     L GVPLEH+L C+  ++I   Q+G++K+ +D   D                        G+ K+      +    T S +S N S    NG    G+L+D+LHQFSREVVDL+KHQP C++ LSKFIP+YHHHFGKQCRVADYG+SKLHELI+ALP VVHV+G+G+VR+L L H+VQVRRFTNE++KVLKS+ TK+CRL++Y   Y+ ++ KDFRI DYGVC++ D+L E+ DS VEV  ++ +  +++PKR+QT EE+ERT  FAIEV DLL QSPRCRLPFNKFIPSYHHHFSRQC+VA+YGFTKLI+LL+AVP V+QI+EEHGEK+V L +   LR +AEQ L++LE +  KRI L+E PN+Y+K  GY L LED+   S+++L  K+P++ RI+               S    TS   T   S+ S+ + + S D  D E+                               E SE         +VCLADR  +K++ HKVLLVLLE  SG+L   QF E++R  +R+EPNL LI +E+ DI++                          +N+S++L  P S+ +                                     I L+ LI+F+R+L++L+R NQ K+ L+QL   Y++ +G+PL+ Q Y YPSL +L+QA DFV  ++GRG+R  LVLCQDF+GKL+YR+AYNT+P+L+
Sbjct:  272 ELLVSNLDYNIGAKEWRKILFTQLQSIVKNVHSIVIQTQADGSNYAIIKVGSIEDARLAISHFHRKKIGYKRIQVNIVSQNGTFGTRGLKNEVVSLLRSVSSNALPVCKFIDLFEKRYHRSISVSDLYKMRDVIEIKEQPGSQGGRLITLSVRA-----QRYDGTEAAPSTDPVLCRRHCVEGSQDYLQAMDCAMLPNVQVSLNVFRQHVLKLLQDHGGSMPLLSFPACYKAEFGELTVIPTSPSGNTETNGTPKQPPTTNTESNLSPTHDPGRPSSTTPVPVGNANASRTSAVSDSALETDPNHDRTTENVSTNNLNGVPLEHLLTCVPSVRIQVEQNGVRKLVFDPGLDQMQSLHALNGFSGSNPLASNLDLLGNTKSQLADPLNSTSPTVSQSSANLSSVCPNGASSPGVLLDQLHQFSREVVDLLKHQPGCQILLSKFIPSYHHHFGKQCRVADYGYSKLHELIDALPTVVHVMGSGHVRLLTLSHRVQVRRFTNELIKVLKSQSTKSCRLTDYAAIYRRIYRKDFRITDYGVCYLPDMLMEVSDSAVEVSQTNGETTISLPKRVQTMEERERTELFAIEVADLLCQSPRCRLPFNKFIPSYHHHFSRQCRVADYGFTKLIDLLEAVPNVVQIVEEHGEKFVALVRQRHLRIVAEQLLSMLEAAPGKRIPLNELPNVYVKHQGYALCLEDFEFNSVRELLSKLPRLVRIETVCLDQSGLQAALTSSDGDSTSVVLTSADSLPSDKKSATSQDSNDDESTADASHDEGSTTPTAHTKVVSRDPEAKAETKETSETKPGSCTVDYVCLADRAQIKHLAHKVLLVLLEAQSGTLSIAQFSERFRCTFRDEPNLNLIHDELGDIVEFKKLTNRSADDALLATASSTRWNDRAMNESAVLGTPSSTTVAEQDSNIGANEILLTTSFSDAVDSSESVTNWEATTSTISLRPLIMFARELRELLRQNQGKLLLVQLCAVYQRRFGVPLRPQRYNYPSLATLLQAVDFVAMMRGRGVRCMLVLCQDFLGKLSYRVAYNTKPVLE 1306          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. TrEMBL
Match: A0A504YH88 (Limkain-b1 OS=Fasciola gigantica OX=46835 GN=FGIG_09855 PE=4 SV=1)

HSP 1 Score: 846.269 bits (2185), Expect = 0.000e+0
Identity = 439/963 (45.59%), Postives = 613/963 (63.66%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNY-------------STISPTSKTKTYNASVESEDQVSLSSDLEDKEALV-----------------------------EQSEM--------FVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQI-------------------------VNDSSLLQYPGSSGLH------------------------------------IRLKSLILFSRDLKDLMRFNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDFVGKLAYRIAYNTQPILK 3506
            +LLV+NLDYNI AKEWRK+L  Q Q+ +K VHS++IQTQ DGSN  I+++GS+EDARLAIS FHRKKIGYKRIQVN+VS N       +K EV +LL+SV+  +L V KF++L+EK+YHRSI +SD Y+M+D +EIK+  G+Q  ++I+L+  A     Q  + +E   + + ++C +HC EG++DY+ A++ A+LPNV++SL +F++ V K+LQ H GS+ L+SF +CYK+EF               DQ++S  L+ +           N F    PL   L+ +          G  K Q  D  + S   +  Q++ + +S   +     G+L+D+LHQFSREVVDL+KHQP C++ LSKFIP+YHHHFGKQCRVADYG+SKLHELI+ALP VVHV+G+G+VR+L L H+VQVRRFTNE++KVLKS+ TK+CRL++Y   Y+ ++ KDFRI DYGVC++ D+L E+ DS VEV  ++ +  +++PKR+QT EE+ERT  FAIEV DLL QSPRCRLPFNKFIPSYHHHFSRQC+VA+YGFTKLI+LL+AVP V+QI+EEHGEK+V L +   LR +AEQ L++LE +  KRI L+E PN+Y+K  GY L LED+   S+++L  K+P++ RI+               S    T+   T   S+ S+ + + S D+ D E+                               E SE         +VCLADR  +K++ HKVLLVLLE  SG+L   QF E++R  +R+EPNL LI +E+ DI++                          VN+S++L    S+ +                                     I L+ LI+F+R+L++L+R NQ K+ L+QL   Y++ +GIPL+ Q Y YPSL +L+QA DFV  ++GRG+R  LVLCQDF+GKL+YR+AYNT+P+L+
Sbjct:  228 ELLVSNLDYNIGAKEWRKILFTQLQSIVKNVHSIVIQTQADGSNYAIIKVGSIEDARLAISHFHRKKIGYKRIQVNIVSQNGTFGTRGLKNEVVSLLRSVSSNALPVCKFIDLFEKRYHRSISVSDLYKMRDVIEIKEQPGSQGGRLITLSVRA-----QRYDGTEAAPSTDPVLCRRHCVEGSQDYLQAMDCAMLPNVQVSLNVFRQHVLKLLQDHGGSMPLLSFPACYKAEF-------------GLDQMQS--LHAL-----------NGFSGSNPLASTLDLL----------GNTKSQLADPLN-STSPTVSQSSANLSSVCPNGASSPGVLLDQLHQFSREVVDLLKHQPGCQILLSKFIPSYHHHFGKQCRVADYGYSKLHELIDALPTVVHVMGSGHVRLLTLSHRVQVRRFTNELIKVLKSQSTKSCRLADYAAIYRRIYRKDFRITDYGVCYLPDMLMEVSDSAVEVSQTNGETTISLPKRVQTMEERERTELFAIEVADLLCQSPRCRLPFNKFIPSYHHHFSRQCRVADYGFTKLIDLLEAVPNVVQIVEEHGEKFVALVRQRHLRIVAEQLLSMLEAAPGKRIPLNELPNVYVKHQGYALCLEDFEFNSVRELLSKLPRLVRIETICLDQSGLQASLTSSDGDSTNVVLTSTDSLPSDKKSATSQDVNDDESTADASHDEGSTTPTAHTNVVSRDPEAKAETKESSETKPGNCTVDYVCLADRAQIKHLAHKVLLVLLEAQSGTLSITQFSERFRCTFRDEPNLNLIHDELGDIVEFKKLTNRSADDALLATANSTRWNDRAVNESAVLGTSSSTTVAEQDSNIGANEILLTTSFSDAVDSSEPVTNWEATTSTISLRPLIMFARELRELLRQNQGKLLLVQLCAVYQRRFGIPLRPQRYNYPSLATLLQAVDFVAMMRGRGVRCMLVLCQDFLGKLSYRVAYNTKPVLE 1148          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. TrEMBL
Match: A0A2H1CIW0 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_05236 PE=4 SV=1)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 399/868 (45.97%), Postives = 551/868 (63.48%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIM--------------KIPVATNA------------PDQVESEPLNNIRES----------------DENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTD------------------------GSYKA------SQDQTTGSPNSYNQSV---NGLG--GILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNY-------------STISPTSKTKTYNASVESEDQVSLSSDLEDKEALV-----------------------------EQSEM--------FVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIV 3173
            +LLV+NLDYNI AKEWRK+L  Q Q+ +K VHS++IQTQ DGSN  I+++GS+EDARLAIS FHRKKIGYKRIQVN+VS N       +K EV +LL+SV+  +L V KF++L+EK+YHRSI +SD Y+M+D +EIK+  G+Q  ++I+L+  A     Q  + +E   + + ++C +HC EG++DY+ A++ A+LPNV++SL +F++ V K+LQ H GS+ L+SF +CYK+EF ++ ++              K P  TN             P      P+ N   S                D  T++     L GVPLEH+L C+  ++I   Q+G++K+ +D   D                        G+ K+      +    T S +S N S    NG    G+L+D+LHQFSREVVDL+KHQP C++ LSKFIP+YHHHFGKQCRVADYG+SKLHELI+ALP VVHV+G+G+VR+L L H+VQVRRFTNE++KVLKS+ TK+CRL++Y   Y+ ++ KDFRI DYGVC++ D+L E+ DS VEV  ++ +  +++PKR+QT EE+ERT  FAIEV DLL QSPRCRLPFNKFIPSYHHHFSRQC+VA+YGFTKLI+LL+AVP V+QI+EEHGEK+V L +   LR +AEQ L++LE +  KRI L+E PN+Y+K  GY L LED+   S+++L  K+P++ RI+               S    TS   T   S+ S+ + + S D  D E+                               E SE         +VCLADR  +K++ HKVLLVLLE  SG+L   QF E++R  +R+EPNL LI +E+ DI++++
Sbjct:  272 ELLVSNLDYNIGAKEWRKILFTQLQSIVKNVHSIVIQTQADGSNYAIIKVGSIEDARLAISHFHRKKIGYKRIQVNIVSQNGTFGTRGLKNEVVSLLRSVSSNALPVCKFIDLFEKRYHRSISVSDLYKMRDVIEIKEQPGSQGGRLITLSVRA-----QRYDGTEAAPSTDPVLCRRHCVEGSQDYLQAMDCAMLPNVQVSLNVFRQHVLKLLQDHGGSMPLLSFPACYKAEFGELTVIPTSPSGNTETNGTPKQPPTTNTESNLSPTHDPGRPSSTTPVPVGNANASRTSAVSDSALETDPNHDRTTENVSTNNLNGVPLEHLLTCVPSVRIQVEQNGVRKLVFDPGLDQMQSLHALNGFSGSNPLASNLDLLGNTKSQLADPLNSTSPTVSQSSANLSSVCPNGASSPGVLLDQLHQFSREVVDLLKHQPGCQILLSKFIPSYHHHFGKQCRVADYGYSKLHELIDALPTVVHVMGSGHVRLLTLSHRVQVRRFTNELIKVLKSQSTKSCRLTDYAAIYRRIYRKDFRITDYGVCYLPDMLMEVSDSAVEVSQTNGETTISLPKRVQTMEERERTELFAIEVADLLCQSPRCRLPFNKFIPSYHHHFSRQCRVADYGFTKLIDLLEAVPNVVQIVEEHGEKFVALVRQRHLRIVAEQLLSMLEAAPGKRIPLNELPNVYVKHQGYALCLEDFEFNSVRELLSKLPRLVRIETVCLDQSGLQAALTSSDGDSTSVVLTSADSLPSDKKSATSQDSNDDESTADASHDEGSTTPTAHTKVVSRDPEAKAETKETSETKPGSCTVDYVCLADRAQIKHLAHKVLLVLLEAQSGTLSIAQFSERFRCTFRDEPNLNLIHDELGDIVEVI 1134          

HSP 2 Score: 113.235 bits (282), Expect = 3.292e-21
Identity = 84/343 (24.49%), Postives = 159/343 (46.36%), Query Frame = 3
Query: 2457 QFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREE--------PNLMLIQNEMQDIIQIVNDSSLLQYPGSSGLH-IRLKSLILFSRDLKDLMRFNQCK-MPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFV-----VTLKGRGIRASLV 3440
            QF+ EV+DLLK  P C++  +KFIPSYHHHF +QC+VA+YG++KL EL+DA+P V+ ++     + + L+    +R    + + +L+    K  +L+++  +Y + Y     + DY V  L  +  +V               S +    +    E  +SL   ++  E   E++E+F              +V  +L + P   LP  +F+  Y + +  +          L+ +   + +++QIV +       G   +  +R + L + +  L  ++     K +PL +L   Y +H G  L  +++ + S+  L+     +     V L   G++A+L 
Sbjct:  686 QFSREVVDLLKHQPGCQILLSKFIPSYHHHFGKQCRVADYGYSKLHELIDALPTVVHVMGSGHVRLLTLSHRVQVRRFTNELIKVLKSQSTKSCRLTDYAAIYRRIYRKDFRITDYGVCYLPDMLMEV---------------SDSAVEVSQTNGETTISLPKRVQTMEER-ERTELFAI------------EVADLLCQSPRCRLPFNKFIPSYHHHFSRQCRVADYGFTKLIDLLEAVPNVVQIVEEH------GEKFVALVRQRHLRIVAEQLLSMLEAAPGKRIPLNELPNVYVKHQGYALCLEDFEFNSVRELLSKLPRLVRIETVCLDQSGLQAALT 994          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. TrEMBL
Match: A0A419PPF6 (Meiosis arrest female protein 1-like protein OS=Clonorchis sinensis OX=79923 GN=MARF1 PE=4 SV=1)

HSP 1 Score: 768.074 bits (1982), Expect = 0.000e+0
Identity = 391/858 (45.57%), Postives = 548/858 (63.87%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQV--------------ESEPLNNI-------------------RESDENTQSPDN---EFLEGVPLEHMLNCIQGIKIVNSQSGIKKI--------------QWDDKTDGSYKASQDQ-----------------TTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNY------------------------STISPTSKTKTYNASV-----ESEDQVSLSSDLEDKEALVEQSEM-------FVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPGSSGL 3215
            DLLV+NLDYNIS KEWRK+L  Q Q  +K V SV++QTQ DGSNC I+R+GS+EDARLAIS FHRKKIGYKRIQ+N+++ N       +K +V +LL+SV+G +L V KF++L+ K++HR+I  SD Y+M+D +EIKD  G+Q  +I+SL+   +      T P       E +VC +HC EG+ +Y+ A+E ++LP+V+I L LF++QV  ILQ H GS+ L+SF +CYK+EF D+  +   ++ N+  +V              E++P  N+                     +D N  S +    E+  GVPLEH+L C+  ++I    +G++KI              Q    T+     SQ +                 T G PN+ N S     G+L+D LHQFSREVVDL+KHQP C++ L KFIP+YHHHFGKQCRVADYG+SKLHELI+ALP VVHV+G+G++R+L L H+VQVRRFTNE++KVLKS+ TK+C+L++Y + Y+ ++ KDFRI DYGVCF+ D+L E+ D+ VEV + + D  +++PKR+QT+EE+ERT  FAIEV DLL QSPRCRLPFNKFIPSYHHHFSRQC+VA+YGFTKL++LL+A+P V++I+EEHGEKYV L ++  LR +AE  L LLE +  KRI L++ PN+Y+K +GY L LED+   S+ +L  K+P++ R+Q+                          T+S   +T T  A+V        +Q+  S     +  +VE +         +VCLADR  +K++ HKVLL+LLE PSG+L    F E++R  +R+EPN+ LI  E+ DI+Q    +S  +  G SG+
Sbjct:  340 DLLVSNLDYNISPKEWRKMLFTQLQTLVKSVQSVMLQTQADGSNCAIIRVGSIEDARLAISHFHRKKIGYKRIQMNIIAPNGPFVTKGLKADVVSLLRSVSGSALPVSKFIDLFAKRFHRNISASDLYKMRDVIEIKDQPGSQGGRIVSLSLRGMRFDGVETTP-----LSEPVVCQRHCLEGSPEYLQAVECSMLPSVQIPLGLFRQQVLTILQDHDGSLPLLSFPACYKAEFGDLPTVSSQISGNSQLEVCSKTMNHSGSKEHSETDPTGNLISCTGSQQPNVSSNSQDSESSADPNLSSGNEILAEYPAGVPLEHLLTCVPSVRIHTDVTGVRKIILEPEVSSASGSISQQPATTNSVMDLSQKKRQFGEILSPGTSTPGSSTPGVPNTTNTS-----GVLLDHLHQFSREVVDLLKHQPGCQILLGKFIPSYHHHFGKQCRVADYGYSKLHELIDALPNVVHVMGSGHMRLLTLSHRVQVRRFTNELIKVLKSQSTKSCKLTDYTSLYRRIYRKDFRITDYGVCFLSDMLMEVSDNAVEVSHIESDCVISLPKRVQTTEERERTELFAIEVADLLCQSPRCRLPFNKFIPSYHHHFSRQCRVADYGFTKLVDLLEAIPNVVRIVEEHGEKYVSLVRHRHLRIVAEHLLTLLESAPGKRILLNDLPNVYVKQHGYPLCLEDFQFTSVNELLSKLPRLVRMQSVPIDYPKEANSSSLEKCDKMLALRSETVSDRPETTTAPAAVGDGKSNEAEQIDESKGATTEPLIVESTGSADRNVVDYVCLADRTQIKHLAHKVLLILLEAPSGALSVPLFSERFRCTFRDEPNIRLIYEELGDIVQFRTTAS--KTTGDSGV 1185          

HSP 2 Score: 130.954 bits (328), Expect = 1.838e-26
Identity = 54/100 (54.00%), Postives = 82/100 (82.00%), Query Frame = 3
Query: 3219 IRLKSLILFSRDLKDLMRFNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDFVGKLAYRIAYNTQPILKSNEE 3518
            I L+ LI+F+R+L++L+R NQ K+ L+QL   Y++ +G+PLK Q Y YPSL +L+QA DFV  ++GRG+R +LVLCQDF+GKL+YR+AYNT+P+L+++ +
Sbjct: 1259 IVLRPLIMFARELRELLRQNQGKLLLVQLCAVYQRRFGLPLKPQRYNYPSLATLLQAVDFVAVMRGRGVRCTLVLCQDFLGKLSYRVAYNTKPVLEADPD 1358          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. TrEMBL
Match: G7YMV8 (Limkain-b1 OS=Clonorchis sinensis OX=79923 GN=CLF_113568 PE=4 SV=1)

HSP 1 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 391/858 (45.57%), Postives = 548/858 (63.87%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQV--------------ESEPLNNI-------------------RESDENTQSPDN---EFLEGVPLEHMLNCIQGIKIVNSQSGIKKI--------------QWDDKTDGSYKASQDQ-----------------TTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNY------------------------STISPTSKTKTYNASV-----ESEDQVSLSSDLEDKEALVEQSEM-------FVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPGSSGL 3215
            DLLV+NLDYNIS KEWRK+L  Q Q  +K V SV++QTQ DGSNC I+R+GS+EDARLAIS FHRKKIGYKRIQ+N+++ N       +K +V +LL+SV+G +L V KF++L+ K++HR+I  SD Y+M+D +EIKD  G+Q  +I+SL+   +      T P       E +VC +HC EG+ +Y+ A+E ++LP+V+I L LF++QV  ILQ H GS+ L+SF +CYK+EF D+  +   ++ N+  +V              E++P  N+                     +D N  S +    E+  GVPLEH+L C+  ++I    +G++KI              Q    T+     SQ +                 T G PN+ N S     G+L+D LHQFSREVVDL+KHQP C++ L KFIP+YHHHFGKQCRVADYG+SKLHELI+ALP VVHV+G+G++R+L L H+VQVRRFTNE++KVLKS+ TK+C+L++Y + Y+ ++ KDFRI DYGVCF+ D+L E+ D+ VEV + + D  +++PKR+QT+EE+ERT  FAIEV DLL QSPRCRLPFNKFIPSYHHHFSRQC+VA+YGFTKL++LL+A+P V++I+EEHGEKYV L ++  LR +AE  L LLE +  KRI L++ PN+Y+K +GY L LED+   S+ +L  K+P++ R+Q+                          T+S   +T T  A+V        +Q+  S     +  +VE +         +VCLADR  +K++ HKVLL+LLE PSG+L    F E++R  +R+EPN+ LI  E+ DI+Q    +S  +  G SG+
Sbjct:  246 DLLVSNLDYNISPKEWRKMLFTQLQTLVKSVQSVMLQTQADGSNCAIIRVGSIEDARLAISHFHRKKIGYKRIQMNIIAPNGQFVTKGLKADVVSLLRSVSGSALPVSKFIDLFAKRFHRNISASDLYKMRDVIEIKDQPGSQGGRIVSLSLRGMRFDGVETTP-----LSEPVVCQRHCLEGSPEYLQAVECSMLPSVQIPLGLFRQQVLTILQDHDGSLPLLSFPACYKAEFGDLPTVSSQISGNSQLEVCSKTMNHSGSKEHSETDPTGNLISCTGSQQPNVSSNSQDSESSADPNLSSGNEILAEYPAGVPLEHLLTCVPSVRIHTDVTGVRKIILEPEVSSASGSISQQPATTNSVMDLSQKKRQFGEILSPGTSTPGSSTPGVPNTTNTS-----GVLLDHLHQFSREVVDLLKHQPGCQILLGKFIPSYHHHFGKQCRVADYGYSKLHELIDALPNVVHVMGSGHMRLLTLSHRVQVRRFTNELIKVLKSQSTKSCKLTDYTSLYRRIYRKDFRITDYGVCFLSDMLMEVSDNAVEVSHIESDCVISLPKRVQTTEERERTELFAIEVADLLCQSPRCRLPFNKFIPSYHHHFSRQCRVADYGFTKLVDLLEAIPNVVRIVEEHGEKYVSLVRHRHLRIVAEHLLTLLESAPGKRILLNDLPNVYVKQHGYPLCLEDFQFTSVNELLSKLPRLVRMQSVPIDYPKEANSSSLEKCDKMLALRSETVSDRPETTTAPAAVGDGKSNEAEQIDESKGATTEPLIVESTGSADRNVVDYVCLADRTQIKHLAHKVLLILLEAPSGALSVPLFSERFRCTFRDEPNIRLIYEELGDIVQFRTTAS--KTTGDSGV 1091          

HSP 2 Score: 130.954 bits (328), Expect = 1.693e-26
Identity = 54/100 (54.00%), Postives = 82/100 (82.00%), Query Frame = 3
Query: 3219 IRLKSLILFSRDLKDLMRFNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDFVGKLAYRIAYNTQPILKSNEE 3518
            I L+ LI+F+R+L++L+R NQ K+ L+QL   Y++ +G+PLK Q Y YPSL +L+QA DFV  ++GRG+R +LVLCQDF+GKL+YR+AYNT+P+L+++ +
Sbjct: 1165 IVLRPLIMFARELRELLRQNQGKLLLVQLCAVYQRRFGLPLKPQRYNYPSLATLLQAVDFVAVMRGRGVRCTLVLCQDFLGKLSYRVAYNTKPVLEADPD 1264          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Cavefish
Match: MARF1 (meiosis regulator and mRNA stability factor 1 [Source:NCBI gene;Acc:103042911])

HSP 1 Score: 453.751 bits (1166), Expect = 1.172e-133
Identity = 288/865 (33.29%), Postives = 464/865 (53.64%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIIS--------LTNTAINSITQATNPSELGETME--SLVCIQHCKEGTEDYITA---LESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEG-VPLEHMLNCIQGIKIVNSQSGIKKIQW-DDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYR---EEP---------NLMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKDLM---RFNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDF 3455
            D+ V NLDY +S KE +++LL+ F     RV +V +    D      V++GS++ A  AIS  HR KIG KRI V+L++     S   +  E+ ++L+      L ++KF E+YEKK+ R + +S+ YR+ + V +++ GG++   ++S        L+++  +  +  +    + E +E    VC +H  +  +D+  A    ++  +P V +SLK     V+ +LQSH+G+V L+SFL CY +EF  + +                        +E T       LEG VPLEH++ CI GI IV +Q+G K I+W  +K   S      Q   SP    Q            L QFSRE+VDLMK QP+C M ++KFIP YHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LK + +K   + ++   Y   F +++ + DYG+C + DLL EIPD+T+ +   D D  +++PKR +T EE ERT QF  EV+DLL+  P  R+PF+KFIP+YHHHF RQCK+  YGF+KL+EL +A+P V+Q++E   EK + LT+ E ++ALA Q + LL    +  + +++    Y KT+GY L L+DY   +L  L  K+  + ++                  V+  D          KE         V L +R  ++ +  ++L +++ +P     ++  +E  R +Y    + P         +L  +   +  +++  ND+   +        +RL  L  F+R+++ L+    +NQ  + L +  G + ++ G   + + YGY +L  L+ A   VV +KG G +  +VL  D 
Sbjct:  675 DIQVANLDYRMSRKELQQILLDTFAKH-GRVKNVELSPHTDYQLKAKVQMGSLQQAIGAISILHRFKIGNKRIHVSLLTGANSKSLACLSSEIISILQDSPANCLPLFKFTEIYEKKFGRKLVVSELYRLPEVVAVREQGGSRLVCLLSSSIARHSPLSSSQSHDGSSTSGSPVVFEELEYHEPVCKRHYTQ--QDFSEADYDPDTYKIPFVVVSLKALSAHVHCLLQSHEGTVPLLSFLECYAAEFSPLTV-----------------------GEEGT-------LEGSVPLEHLITCIPGITIVTAQNGFKVIKWIHNKPPPSNADPWLQRCKSPVGNPQ------------LIQFSREIVDLMKSQPSCLMPITKFIPAYHHHFAKQCRVSDYGYSKLLELLEAVPHVLQILGLGSKRLLTLTHRAQVKRFTQDLLKLLKFQASKQVVIRDFMQAYHWCFSRNWHVVDYGMCDLMDLLTEIPDTTISITQQDSDTVISVPKRERTPEEVERTKQFGKEVVDLLRHQPHFRMPFSKFIPTYHHHFGRQCKLTYYGFSKLMELFEAIPDVLQVLECGEEKVLALTEVERVKALAAQLVKLLRAQRDCSLSVNQLLAEYSKTFGYGLRLQDYDACTLPALLAKLCHVVKV------------------VDGAD---------GKE---------VQLINRKSLRALTSQLLAIMMSLPDEH--NWLEVEALRRQYELMFDIPLNPWEYGFVSLCELLKSLPYLVECDNDAKPEE-------GVRLTRLYQFARNVRALLHTYHYNQ--IFLTEFWGAFSKYTGREFQPREYGYSTLDELLAAIPQVVWIKGHGHKKIIVLRNDM 1447          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Cavefish
Match: MARF1 (meiosis regulator and mRNA stability factor 1 [Source:NCBI gene;Acc:103042911])

HSP 1 Score: 444.506 bits (1142), Expect = 7.079e-130
Identity = 247/651 (37.94%), Postives = 380/651 (58.37%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIIS--------LTNTAINSITQATNPSELGETME--SLVCIQHCKEGTEDYITA---LESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEG-VPLEHMLNCIQGIKIVNSQSGIKKIQW-DDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARI 2858
            D+ V NLDY +S KE +++LL+ F     RV +V +    D      V++GS++ A  AIS  HR KIG KRI V+L++     S   +  E+ ++L+      L ++KF E+YEKK+ R + +S+ YR+ + V +++ GG++   ++S        L+++  +  +  +    + E +E    VC +H  +  +D+  A    ++  +P V +SLK     V+ +LQSH+G+V L+SFL CY +EF  + +                        +E T       LEG VPLEH++ CI GI IV +Q+G K I+W  +K   S      Q   SP    Q            L QFSRE+VDLMK QP+C M ++KFIP YHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LK + +K   + ++   Y   F +++ + DYG+C + DLL EIPD+T+ +   D D  +++PKR +T EE ERT QF  EV+DLL+  P  R+PF+KFIP+YHHHF RQCK+  YGF+KL+EL +A+P V+Q++E   EK + LT+ E ++ALA Q + LL    +  + +++    Y KT+GY L L+DY   +L  L  K+  + ++
Sbjct:  681 DIQVANLDYRMSRKELQQILLDTFAKH-GRVKNVELSPHTDYQLKAKVQMGSLQQAIGAISILHRFKIGNKRIHVSLLTGANSKSLACLSSEIISILQDSPANCLPLFKFTEIYEKKFGRKLVVSELYRLPEVVAVREQGGSRLVCLLSSSIARHSPLSSSQSHDGSSTSGSPVVFEELEYHEPVCKRHYTQ--QDFSEADYDPDTYKIPFVVVSLKALSAHVHCLLQSHEGTVPLLSFLECYAAEFSPLTV-----------------------GEEGT-------LEGSVPLEHLITCIPGITIVTAQNGFKVIKWIHNKPPPSNADPWLQRCKSPVGNPQ------------LIQFSREIVDLMKSQPSCLMPITKFIPAYHHHFAKQCRVSDYGYSKLLELLEAVPHVLQILGLGSKRLLTLTHRAQVKRFTQDLLKLLKFQASKQVVIRDFMQAYHWCFSRNWHVVDYGMCDLMDLLTEIPDTTISITQQDSDTVISVPKRERTPEEVERTKQFGKEVVDLLRHQPHFRMPFSKFIPTYHHHFGRQCKLTYYGFSKLMELFEAIPDVLQVLECGEEKVLALTEVERVKALAAQLVKLLRAQRDCSLSVNQLLAEYSKTFGYGLRLQDYDACTLPALLAKLCHVVKV 1286          

HSP 2 Score: 72.7886 bits (177), Expect = 2.781e-12
Identity = 62/243 (25.51%), Postives = 118/243 (48.56%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITK--TCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVE--VINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEM 2678
            V+R+   + ++V L++ Q +C +S+++ +  Y   FG   R+ DY    L  L+  L  VV V+     + + L ++  +R  T++++ ++ S   +     +     QY+++F       +YG   + +LL  +P   VE  V   D+D       R+       R  QFA  V  LL      ++   +F  ++  +  R+ +  EYG++ L ELL A+P+V+  I+ HG K +I+ + +M
Sbjct: 1224 VERVKALAAQLVKLLRAQRDCSLSVNQLLAEYSKTFGYGLRLQDYDACTLPALLAKLCHVVKVVDGADGKEVQLINRKSLRALTSQLLAIMMSLPDEHNWLEVEALRRQYELMFDIPLNPWEYGFVSLCELLKSLP-YLVEMFVGECDNDAKPEEGVRLT------RLYQFARNVRALLHTYHYNQIFLTEFWGAFSKYTGREFQPREYGYSTLDELLAAIPQVV-WIKGHGHKKIIVLRNDM 1458          

HSP 3 Score: 51.6026 bits (122), Expect = 8.204e-6
Identity = 26/84 (30.95%), Postives = 52/84 (61.90%), Query Frame = 3
Query: 1953 GILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVR 2204
            G+ + RL+QF+R V  L+      ++ L++F   +  + G++ +  +YG+S L EL+ A+PQVV + G G+ +++ L + ++ R
Sbjct: 1378 GVRLTRLYQFARNVRALLHTYHYNQIFLTEFWGAFSKYTGREFQPREYGYSTLDELLAAIPQVVWIKGHGHKKIIVLRNDMKAR 1461          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Cavefish
Match: MARF1 (meiosis regulator and mRNA stability factor 1 [Source:NCBI gene;Acc:103042911])

HSP 1 Score: 443.736 bits (1140), Expect = 3.229e-129
Identity = 247/651 (37.94%), Postives = 380/651 (58.37%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIIS--------LTNTAINSITQATNPSELGETME--SLVCIQHCKEGTEDYITA---LESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEG-VPLEHMLNCIQGIKIVNSQSGIKKIQW-DDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARI 2858
            D+ V NLDY +S KE +++LL+ F     RV +V +    D      V++GS++ A  AIS  HR KIG KRI V+L++     S   +  E+ ++L+      L ++KF E+YEKK+ R + +S+ YR+ + V +++ GG++   ++S        L+++  +  +  +    + E +E    VC +H  +  +D+  A    ++  +P V +SLK     V+ +LQSH+G+V L+SFL CY +EF  + +                        +E T       LEG VPLEH++ CI GI IV +Q+G K I+W  +K   S      Q   SP    Q            L QFSRE+VDLMK QP+C M ++KFIP YHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LK + +K   + ++   Y   F +++ + DYG+C + DLL EIPD+T+ +   D D  +++PKR +T EE ERT QF  EV+DLL+  P  R+PF+KFIP+YHHHF RQCK+  YGF+KL+EL +A+P V+Q++E   EK + LT+ E ++ALA Q + LL    +  + +++    Y KT+GY L L+DY   +L  L  K+  + ++
Sbjct:  779 DIQVANLDYRMSRKELQQILLDTFAKH-GRVKNVELSPHTDYQLKAKVQMGSLQQAIGAISILHRFKIGNKRIHVSLLTGANSKSLACLSSEIISILQDSPANCLPLFKFTEIYEKKFGRKLVVSELYRLPEVVAVREQGGSRLVCLLSSSIARHSPLSSSQSHDGSSTSGSPVVFEELEYHEPVCKRHYTQ--QDFSEADYDPDTYKIPFVVVSLKALSAHVHCLLQSHEGTVPLLSFLECYAAEFSPLTV-----------------------GEEGT-------LEGSVPLEHLITCIPGITIVTAQNGFKVIKWIHNKPPPSNADPWLQRCKSPVGNPQ------------LIQFSREIVDLMKSQPSCLMPITKFIPAYHHHFAKQCRVSDYGYSKLLELLEAVPHVLQILGLGSKRLLTLTHRAQVKRFTQDLLKLLKFQASKQVVIRDFMQAYHWCFSRNWHVVDYGMCDLMDLLTEIPDTTISITQQDSDTVISVPKRERTPEEVERTKQFGKEVVDLLRHQPHFRMPFSKFIPTYHHHFGRQCKLTYYGFSKLMELFEAIPDVLQVLECGEEKVLALTEVERVKALAAQLVKLLRAQRDCSLSVNQLLAEYSKTFGYGLRLQDYDACTLPALLAKLCHVVKV 1384          

HSP 2 Score: 72.4034 bits (176), Expect = 3.688e-12
Identity = 62/243 (25.51%), Postives = 118/243 (48.56%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITK--TCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVE--VINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEM 2678
            V+R+   + ++V L++ Q +C +S+++ +  Y   FG   R+ DY    L  L+  L  VV V+     + + L ++  +R  T++++ ++ S   +     +     QY+++F       +YG   + +LL  +P   VE  V   D+D       R+       R  QFA  V  LL      ++   +F  ++  +  R+ +  EYG++ L ELL A+P+V+  I+ HG K +I+ + +M
Sbjct: 1322 VERVKALAAQLVKLLRAQRDCSLSVNQLLAEYSKTFGYGLRLQDYDACTLPALLAKLCHVVKVVDGADGKEVQLINRKSLRALTSQLLAIMMSLPDEHNWLEVEALRRQYELMFDIPLNPWEYGFVSLCELLKSLP-YLVEMFVGECDNDAKPEEGVRLT------RLYQFARNVRALLHTYHYNQIFLTEFWGAFSKYTGREFQPREYGYSTLDELLAAIPQVV-WIKGHGHKKIIVLRNDM 1556          

HSP 3 Score: 51.6026 bits (122), Expect = 8.551e-6
Identity = 26/84 (30.95%), Postives = 52/84 (61.90%), Query Frame = 3
Query: 1953 GILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVR 2204
            G+ + RL+QF+R V  L+      ++ L++F   +  + G++ +  +YG+S L EL+ A+PQVV + G G+ +++ L + ++ R
Sbjct: 1476 GVRLTRLYQFARNVRALLHTYHYNQIFLTEFWGAFSKYTGREFQPREYGYSTLDELLAAIPQVVWIKGHGHKKIIVLRNDMKAR 1559          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Cavefish
Match: MARF1 (meiosis regulator and mRNA stability factor 1 [Source:NCBI gene;Acc:103042911])

HSP 1 Score: 443.736 bits (1140), Expect = 5.187e-129
Identity = 247/651 (37.94%), Postives = 380/651 (58.37%), Query Frame = 3
Query:  951 DLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIIS--------LTNTAINSITQATNPSELGETME--SLVCIQHCKEGTEDYITA---LESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEG-VPLEHMLNCIQGIKIVNSQSGIKKIQW-DDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARI 2858
            D+ V NLDY +S KE +++LL+ F     RV +V +    D      V++GS++ A  AIS  HR KIG KRI V+L++     S   +  E+ ++L+      L ++KF E+YEKK+ R + +S+ YR+ + V +++ GG++   ++S        L+++  +  +  +    + E +E    VC +H  +  +D+  A    ++  +P V +SLK     V+ +LQSH+G+V L+SFL CY +EF  + +                        +E T       LEG VPLEH++ CI GI IV +Q+G K I+W  +K   S      Q   SP    Q            L QFSRE+VDLMK QP+C M ++KFIP YHHHF KQCRV+DYG+SKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LK + +K   + ++   Y   F +++ + DYG+C + DLL EIPD+T+ +   D D  +++PKR +T EE ERT QF  EV+DLL+  P  R+PF+KFIP+YHHHF RQCK+  YGF+KL+EL +A+P V+Q++E   EK + LT+ E ++ALA Q + LL    +  + +++    Y KT+GY L L+DY   +L  L  K+  + ++
Sbjct:  837 DIQVANLDYRMSRKELQQILLDTFAKH-GRVKNVELSPHTDYQLKAKVQMGSLQQAIGAISILHRFKIGNKRIHVSLLTGANSKSLACLSSEIISILQDSPANCLPLFKFTEIYEKKFGRKLVVSELYRLPEVVAVREQGGSRLVCLLSSSIARHSPLSSSQSHDGSSTSGSPVVFEELEYHEPVCKRHYTQ--QDFSEADYDPDTYKIPFVVVSLKALSAHVHCLLQSHEGTVPLLSFLECYAAEFSPLTV-----------------------GEEGT-------LEGSVPLEHLITCIPGITIVTAQNGFKVIKWIHNKPPPSNADPWLQRCKSPVGNPQ------------LIQFSREIVDLMKSQPSCLMPITKFIPAYHHHFAKQCRVSDYGYSKLLELLEAVPHVLQILGLGSKRLLTLTHRAQVKRFTQDLLKLLKFQASKQVVIRDFMQAYHWCFSRNWHVVDYGMCDLMDLLTEIPDTTISITQQDSDTVISVPKRERTPEEVERTKQFGKEVVDLLRHQPHFRMPFSKFIPTYHHHFGRQCKLTYYGFSKLMELFEAIPDVLQVLECGEEKVLALTEVERVKALAAQLVKLLRAQRDCSLSVNQLLAEYSKTFGYGLRLQDYDACTLPALLAKLCHVVKV 1442          

HSP 2 Score: 72.7886 bits (177), Expect = 3.137e-12
Identity = 62/243 (25.51%), Postives = 118/243 (48.56%), Query Frame = 3
Query: 1962 VDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITK--TCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVE--VINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEM 2678
            V+R+   + ++V L++ Q +C +S+++ +  Y   FG   R+ DY    L  L+  L  VV V+     + + L ++  +R  T++++ ++ S   +     +     QY+++F       +YG   + +LL  +P   VE  V   D+D       R+       R  QFA  V  LL      ++   +F  ++  +  R+ +  EYG++ L ELL A+P+V+  I+ HG K +I+ + +M
Sbjct: 1380 VERVKALAAQLVKLLRAQRDCSLSVNQLLAEYSKTFGYGLRLQDYDACTLPALLAKLCHVVKVVDGADGKEVQLINRKSLRALTSQLLAIMMSLPDEHNWLEVEALRRQYELMFDIPLNPWEYGFVSLCELLKSLP-YLVEMFVGECDNDAKPEEGVRLT------RLYQFARNVRALLHTYHYNQIFLTEFWGAFSKYTGREFQPREYGYSTLDELLAAIPQVV-WIKGHGHKKIIVLRNDM 1614          

HSP 3 Score: 51.6026 bits (122), Expect = 8.732e-6
Identity = 26/84 (30.95%), Postives = 52/84 (61.90%), Query Frame = 3
Query: 1953 GILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVR 2204
            G+ + RL+QF+R V  L+      ++ L++F   +  + G++ +  +YG+S L EL+ A+PQVV + G G+ +++ L + ++ R
Sbjct: 1534 GVRLTRLYQFARNVRALLHTYHYNQIFLTEFWGAFSKYTGREFQPREYGYSTLDELLAAIPQVVWIKGHGHKKIIVLRNDMKAR 1617          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Cavefish
Match: wu:fj29h11 (uncharacterized LOC103022917 [Source:NCBI gene;Acc:103022917])

HSP 1 Score: 54.6842 bits (130), Expect = 1.235e-6
Identity = 58/229 (25.33%), Postives = 105/229 (45.85%), Query Frame = 3
Query: 1965 DR-LHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVI-GTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYG--VCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEE 2639
            DR + + S+ VV L+KH P   + LS+    Y   + +    AD GF+ + +LI +L + + V  GT + R     H+ Q  +   +M+++LKS   +   LS+    +K  + ++F ++ +     FI+ L  E+      V +           R  T          + EV+DL+K+ P+  +P  K    Y   + R   VAE GF+ +   +D++ K + +  E
Sbjct:   34 DRNMDKTSKNVVRLLKHNPEG-IPLSRVAVFYSQRYHRNLTAADLGFNSIADLITSLSEHLEVQNGTVFHRK----HRPQ-NQDAEDMVQLLKS-CPEGIPLSKLAVSFKQRYKRNFVLSGFSTMAAFIDSLSEELCVKGGVVHH-----------RNHTPSTDGDMDAVSQEVVDLVKEHPKG-IPMKKLAVFYSQQYKRNLIVAELGFSSVNAFVDSLSKDLLVDNE 243          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005078.1 (pep scaffold:Pmarinus_7.0:GL484458:107:8678:1 gene:ENSPMAG00000004619.1 transcript:ENSPMAT00000005078.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.785 bits (434), Expect = 8.804e-46
Identity = 76/188 (40.43%), Postives = 125/188 (66.49%), Query Frame = 3
Query: 2295 FHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARI 2858
            F +++ + +YG+C + DLL E+PD+ V +   +    +++P +++T EE+ RT  FA EV+ LL+Q PR R+ F++FIP+YHHH+ RQCK+A YGFTKL +L +A+P+V+ ++E   +K ++LT+ E L+ALA Q   LL     + +  SE P  Y +  G+ L L+DY V S+ +L  K+P + ++
Sbjct:    2 FSREWDVREYGMCELSDLLAEVPDAVVAMTPQEGGPVLSIPIKVRTEEERSRTRVFAREVVKLLRQMPRGRMAFSRFIPAYHHHYGRQCKLAHYGFTKLTDLFEAIPEVVTMLERGEDKLLVLTETEQLKALACQISQLLRVHKAEGLAPSELPAEYARAVGHPLYLQDYDVSSVTELLSKIPHVVKV 189          

HSP 2 Score: 119.398 bits (298), Expect = 2.786e-28
Identity = 79/274 (28.83%), Postives = 137/274 (50.00%), Query Frame = 3
Query: 1968 RLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQT---SEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYG 2780
            R   F+REVV L++  P  RM+ S+FIP YHHH+G+QC++A YGF+KL +L EA+P+VV ++  G  ++L L    Q++    ++ ++L+    +    SE P +Y         + DY V  + +LL++IP   V+V+++       + +RIQ      +K  T+Q    ++ L+ Q P   +        YH  F       ++GF  L ++L  +  + ++  E G    +  +   L   A     LL      +I L++FP+ Y +  G
Sbjct:   53 RTRVFAREVVKLLRQMPRGRMAFSRFIPAYHHHYGRQCKLAHYGFTKLTDLFEAIPEVVTMLERGEDKLLVLTETEQLKALACQISQLLRVHKAEGLAPSELPAEYARAVGHPLYLQDYDVSSVTELLSKIPH-VVKVVDTP------VGRRIQLLCHKSQKVATTQL---LLLLMSQRPGALVKLALLEQLYHAVFGAPLAPHDFGFLCLADMLRTMHSMFELETESGT--AVGVRLTPLLQFAACVRALLLTYHYHQISLADFPSAYAQFTG 314          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Medaka
Match: MARF1 (meiosis regulator and mRNA stability factor 1 [Source:NCBI gene;Acc:101158257])

HSP 1 Score: 451.825 bits (1161), Expect = 8.772e-132
Identity = 285/874 (32.61%), Postives = 455/874 (52.06%), Query Frame = 3
Query:  960 VTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIIS--------LTNTAINSITQATNPSELG-ETME--SLVCIQH-CKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEG-VPLEHMLNCIQGIKIVNSQSGIKKIQW-DDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYRE----------------------EPNLMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKDLM---RFNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRGIRASLVLCQDFVGK 3464
            V NLDY +S K+ ++ L + F     +VHSV +    D      V++ S++ A  A+S  HR KIG KR+QV+LV+     S  S+  E+ ++L+      L V+KF+E+YEKKY R I +SD Y++ D V +++ GG++   ++         L ++     + + N S +  E +E  + VC QH  K+   +     ES  +P V +SL     ++  +L+SH G++ L+SF  CY +EF  + +                                +E  EG VPLEH++ C+  + IV +Q+G K I+W   +          Q   SP    Q            L QFSRE++DL+K QP+C M +SKFIP YHHHF KQCRV+DYGFSKL EL+EA+P V+ ++G G  R+L L H+ QV+RFT +++K+LK + +K   + ++   Y   F +D+R+ DYG C + DLL EIPD+T+ + +   D  +++PKR +T+EE ERT QF  EV+DLL+  P CR+PF+KFIP+YHHHF RQCK++ YGFTKL+EL +A+P ++Q++E   EK + LT+ E ++ALA Q + +L    N  + +S+    Y +T+GY L L+D+   SL  L  K+  + ++ + +                           E +E         V L +R  ++ + +++L +L+   +  LP    +E+   +Y+                        PNLM + +E  +      D            ++RL  L  F+R+++ L+    +NQ  + L + +G Y +  G  L+ ++Y   S+  L+ A   VV +KG G +  +VL  D   K
Sbjct:  864 VANLDYRMSRKDLQQTLRDTFSR-FGQVHSVELSPHTDYQLKAAVQMSSLQQAISAVSGLHRFKIGSKRVQVSLVTGG---SNKSLSLEIISILQDSPANCLPVFKFLEIYEKKYSRKIAVSDLYKLPDLVSVREQGGSRLVCLLPHSQIRQSPLGSSPSQEGSSSLNGSPVVFEELEYHNPVCEQHYSKQNFSEADFDPESYKIPFVVMSLSTLASELNHLLESHGGTLPLLSFPDCYAAEFSPLIL-------------------------------GSEMTEGAVPLEHLITCVPTVTIVIAQNGFKVIKWLHSRPPAHISEPWIQRCKSPVGNPQ------------LIQFSREIIDLLKGQPSCIMPISKFIPAYHHHFAKQCRVSDYGFSKLLELLEAVPHVLQILGMGTKRLLTLTHRAQVKRFTQDLLKLLKFQASKRVAVKDFMQAYHWCFSRDWRVTDYGTCDLMDLLAEIPDTTITISHQSSDTVISVPKRERTTEEVERTKQFGKEVVDLLRHQPHCRMPFSKFIPTYHHHFGRQCKLSYYGFTKLVELFEAIPDILQLLECGEEKVLALTEVERIKALAAQLVKVLRAQKNYSLPVSQLLTEYSRTFGYSLRLQDFDTPSLSTLLAKLSHVVKVVDSA---------------------------EGRE---------VQLINRKSLRTLTYQLLALLMSQETDQLPKGMKVEELSQRYQAVHGSPLNPCEYGFLSLSELLKSLPNLMQLYHEDNEENGKAGDE-----------YVRLTRLFQFARNVRALLHTYHYNQ--IFLTEFQGAYSKFMGSSLEPRSYECVSVDDLLNAIPQVVWIKGHGHKRIIVLKNDMKAK 1641          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Planmine SMEST
Match: SMESG000007325.1 (SMESG000007325.1)

HSP 1 Score: 1942.93 bits (5032), Expect = 0.000e+0
Identity = 1006/1027 (97.96%), Postives = 1010/1027 (98.34%), Query Frame = 3
Query:  123 MNYTTQPMYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQSIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYXXXXXXXXXXXXXXXXYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNYQSNQIAVLNNIQVNSIEPTXXXXXXXXXXXXXXXXXXKAASNEMNQIIQKRIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKSTTIHRTANLPXXXXXXXXXXXXXXXXDLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPG 3203
            MNYTTQPMYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQSIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYPIPNINPIPNANNAINYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNYQSNQIAVLNNIQVNSIEPTNYLNSNYINVSSNNIESVKAASNEMNQIIQKRIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKSTTIHRTANLPITNESSESNISNGQSIDLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQV+KILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITK+CRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIY+AMPKRIQTSEEKERTSQFAIEVIDLLKQSP                 SRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESE+QVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPG
Sbjct:    1 MNYTTQPMYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQSIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYPIPNINPIPNANNAINYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNYQSNQIAVLNNIQVNSIEPTNYLNSNYINVSSNNIESVKAASNEMNQIIQKRIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKSTTIHRTANLPITNESSESNISNGQSIDLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVHKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKSCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYIAMPKRIQTSEEKERTSQFAIEVIDLLKQSP-----------------SRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEEQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPG 1010          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Planmine SMEST
Match: SMESG000007325.1 (SMESG000007325.1)

HSP 1 Score: 1928.68 bits (4995), Expect = 0.000e+0
Identity = 999/1020 (97.94%), Postives = 1003/1020 (98.33%), Query Frame = 3
Query:  144 MYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQSIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYXXXXXXXXXXXXXXXXYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNYQSNQIAVLNNIQVNSIEPTXXXXXXXXXXXXXXXXXXKAASNEMNQIIQKRIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKSTTIHRTANLPXXXXXXXXXXXXXXXXDLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPG 3203
            MYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQSIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYPIPNINPIPNANNAINYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNYQSNQIAVLNNIQVNSIEPTNYLNSNYINVSSNNIESVKAASNEMNQIIQKRIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKSTTIHRTANLPITNESSESNISNGQSIDLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQV+KILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITK+CRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIY+AMPKRIQTSEEKERTSQFAIEVIDLLKQSP                 SRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESE+QVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPG
Sbjct:    1 MYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQSIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYPIPNINPIPNANNAINYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNYQSNQIAVLNNIQVNSIEPTNYLNSNYINVSSNNIESVKAASNEMNQIIQKRIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKSTTIHRTANLPITNESSESNISNGQSIDLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVHKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKSCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYIAMPKRIQTSEEKERTSQFAIEVIDLLKQSP-----------------SRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEEQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPG 1003          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Planmine SMEST
Match: SMESG000007325.1 (SMESG000007325.1)

HSP 1 Score: 1925.21 bits (4986), Expect = 0.000e+0
Identity = 1001/1027 (97.47%), Postives = 1005/1027 (97.86%), Query Frame = 3
Query:  123 MNYTTQPMYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQSIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYXXXXXXXXXXXXXXXXYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNYQSNQIAVLNNIQVNSIEPTXXXXXXXXXXXXXXXXXXKAASNEMNQIIQKRIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKSTTIHRTANLPXXXXXXXXXXXXXXXXDLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPG 3203
            MNYTTQPMYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQSIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYPIPNINPIPNANNAINYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNYQSNQIAVLNNIQVNSIEPTNYLNSNYINVSSNNIESVKAASNEMNQIIQKRIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKSTTIHRTANLPITNESSESNISNGQSIDLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQV+KILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSP     EGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITK+CRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIY+AMPKRIQTSEEKERTSQFAIEVIDLLKQSP                 SRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESE+QVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPG
Sbjct:    1 MNYTTQPMYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQSIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYPIPNINPIPNANNAINYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNYQSNQIAVLNNIQVNSIEPTNYLNSNYINVSSNNIESVKAASNEMNQIIQKRIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKSTTIHRTANLPITNESSESNISNGQSIDLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVHKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSP-----EGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKSCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYIAMPKRIQTSEEKERTSQFAIEVIDLLKQSP-----------------SRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEEQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPG 1005          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Planmine SMEST
Match: SMESG000007325.1 (SMESG000007325.1)

HSP 1 Score: 1909.03 bits (4944), Expect = 0.000e+0
Identity = 994/1020 (97.45%), Postives = 998/1020 (97.84%), Query Frame = 3
Query:  144 MYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQSIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYXXXXXXXXXXXXXXXXYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNYQSNQIAVLNNIQVNSIEPTXXXXXXXXXXXXXXXXXXKAASNEMNQIIQKRIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKSTTIHRTANLPXXXXXXXXXXXXXXXXDLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEFLEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNKFIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPG 3203
            MYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQSIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYPIPNINPIPNANNAINYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNYQSNQIAVLNNIQVNSIEPTNYLNSNYINVSSNNIESVKAASNEMNQIIQKRIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKSTTIHRTANLPITNESSESNISNGQSIDLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQV+KILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSP     EGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITK+CRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIY+AMPKRIQTSEEKERTSQFAIEVIDLLKQSP                 SRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESE+QVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPG
Sbjct:    1 MYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQSIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYPIPNINPIPNANNAINYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNYQSNQIAVLNNIQVNSIEPTNYLNSNYINVSSNNIESVKAASNEMNQIIQKRIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKSTTIHRTANLPITNESSESNISNGQSIDLLVTNLDYNISAKEWRKLLLNQFQNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQVNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICISDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESLVCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVHKILQSHKGSVHLISFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSP-----EGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPNSYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFGKQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEMMKVLKSKITKSCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDSTVEVINSDDDIYIAMPKRIQTSEEKERTSQFAIEVIDLLKQSP-----------------SRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQYEMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQQLFEKVPKIARIQNYSTISPTSKTKTYNASVESEEQVSLSSDLEDKEALVEQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREEPNLMLIQNEMQDIIQIVNDSSLLQYPG 998          
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Planmine SMEST
Match: SMESG000007326.1 (SMESG000007326.1)

HSP 1 Score: 493.041 bits (1268), Expect = 3.062e-163
Identity = 250/251 (99.60%), Postives = 250/251 (99.60%), Query Frame = 3
Query: 3576 MEDSDGNVTNYITMHNQLTPSVHSPKPCSVQSVYGHNMYPQNNFLPPLSSYPYFNAQPMYNPWFRQWYQPHSSYGYSPNLYSHPEYGVVSIAQPTVSAVPGPQSCLPYANASQDQKQIDELVETLAYDNSCSSTLTPPPVTTYQQIHPSLEANNSIINNPWVIYSPHHQMIPSNTILPGYITAISNGDSDDNDQPLDKVLTDSEGVQCTNNNNRFQSXXXXXXXXXXXXXMIRSARTVNKTCRRRHSKSIT 4328
            MEDSDGNVTNYITMHNQLTPSVHSPKPCSVQSVYGHNMYPQNNFLPPLSSYPYFNAQPMYNPWFRQWYQPHSSYGYSPNLYSHPEYGVVSIAQPTVSAVPGPQSCLPYANASQDQKQIDELVETLAYDNSCSSTLTPPPVTTYQQIHPSLEANNSIINNPWVIYSPHHQMIPSNTILPGYITAISNGDSDDNDQPLDKVLTDSEGVQCTNNNNRFQSKTKKL KRVKKLKMIRSARTVNKTCRRRHSKSIT
Sbjct:    1 MEDSDGNVTNYITMHNQLTPSVHSPKPCSVQSVYGHNMYPQNNFLPPLSSYPYFNAQPMYNPWFRQWYQPHSSYGYSPNLYSHPEYGVVSIAQPTVSAVPGPQSCLPYANASQDQKQIDELVETLAYDNSCSSTLTPPPVTTYQQIHPSLEANNSIINNPWVIYSPHHQMIPSNTILPGYITAISNGDSDDNDQPLDKVLTDSEGVQCTNNNNRFQSKTKKLTKRVKKLKMIRSARTVNKTCRRRHSKSIT 251          
The following BLAST results are available for this feature:
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MARF12.194e-13131.86meiosis regulator and mRNA stability factor 1 [Sou... [more]
MARF12.194e-13131.86meiosis regulator and mRNA stability factor 1 [Sou... [more]
MARF11.097e-13031.86meiosis regulator and mRNA stability factor 1 [Sou... [more]
MARF11.097e-13031.86meiosis regulator and mRNA stability factor 1 [Sou... [more]
MARF11.120e-13031.86meiosis regulator and mRNA stability factor 1 [Sou... [more]
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Marf19.168e-9832.56gene:FBgn0039972 transcript:FBtr0306235[more]
Marf19.168e-9832.56gene:FBgn0039972 transcript:FBtr0085956[more]
Marf11.593e-9732.56gene:FBgn0039972 transcript:FBtr0085957[more]
Marf11.626e-9732.56gene:FBgn0039972 transcript:FBtr0306236[more]
Marf11.626e-9732.56gene:FBgn0039972 transcript:FBtr0085958[more]
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MARF14.395e-13332.99meiosis regulator and mRNA stability factor 1 [Sou... [more]
MARF11.196e-13232.99meiosis regulator and mRNA stability factor 1 [Sou... [more]
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
marf12.491e-12937.61meiosis regulator and mRNA stability factor 1 [Sou... [more]
marf13.067e-12937.61meiosis regulator and mRNA stability factor 1 [Sou... [more]
marf15.576e-12937.61meiosis regulator and mRNA stability factor 1 [Sou... [more]
marf16.229e-12937.61meiosis regulator and mRNA stability factor 1 [Sou... [more]
marf14.036e-12037.00meiosis regulator and mRNA stability factor 1 [Sou... [more]
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Marf18.637e-13432.48meiosis regulator and mRNA stability 1 [Source:MGI... [more]
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VIG2|MARF1_RAT1.041e-13433.60Meiosis regulator and mRNA stability factor 1 OS=R... [more]
sp|E1BZ85|MARF1_CHICK1.154e-13333.25Meiosis regulator and mRNA stability factor 1 OS=G... [more]
sp|Q8BJ34|MARF1_MOUSE6.360e-13332.48Meiosis regulator and mRNA stability factor 1 OS=M... [more]
sp|E1BP74|MARF1_BOVIN6.816e-13131.71Meiosis regulator and mRNA stability factor 1 OS=B... [more]
sp|Q9Y4F3|MARF1_HUMAN5.379e-13031.86Meiosis regulator and mRNA stability factor 1 OS=H... [more]
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RB910.000e+043.94Limkain-b1 OS=Fasciola hepatica OX=6192 GN=D915_00... [more]
A0A504YH880.000e+045.59Limkain-b1 OS=Fasciola gigantica OX=46835 GN=FGIG_... [more]
A0A2H1CIW03.292e-2145.97Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A419PPF61.838e-2645.57Meiosis arrest female protein 1-like protein OS=Cl... [more]
G7YMV81.693e-2645.57Limkain-b1 OS=Clonorchis sinensis OX=79923 GN=CLF_... [more]
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MARF11.172e-13333.29meiosis regulator and mRNA stability factor 1 [Sou... [more]
MARF17.079e-13037.94meiosis regulator and mRNA stability factor 1 [Sou... [more]
MARF13.229e-12937.94meiosis regulator and mRNA stability factor 1 [Sou... [more]
MARF15.187e-12937.94meiosis regulator and mRNA stability factor 1 [Sou... [more]
wu:fj29h111.235e-625.33uncharacterized LOC103022917 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005078.18.804e-4640.43pep scaffold:Pmarinus_7.0:GL484458:107:8678:1 gene... [more]
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MARF18.772e-13232.61meiosis regulator and mRNA stability factor 1 [Sou... [more]
back to top
BLAST of Meiosis regulator and mRNA stability factor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007325.10.000e+097.96SMESG000007325.1[more]
SMESG000007325.10.000e+097.94SMESG000007325.1[more]
SMESG000007325.10.000e+097.47SMESG000007325.1[more]
SMESG000007325.10.000e+097.45SMESG000007325.1[more]
SMESG000007326.13.062e-16399.60SMESG000007326.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007267 ID=SMED30007267|Name=Meiosis regulator and mRNA stability factor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4680bp
TTACGCATAAAATTCAATAGCAAAAATCGAAAACATGCGTAATTGATCAT
CTGAAAATTTATTGTCTTAATAAATTGAATGTCAAAAGAAAATTCAATAC
ATCAGACAAGAAAGAAAGCTCCATGAATTATACAACACAACCGATGTATC
CAATTGGTCAGTCGAATCAGATCTCTAATAAGTCTGTTGAATATTTAAAA
CCGCCAATCCAGTCATTCATAAGTGAAGACGAAGCGTTTCAAAACTCGAA
TTTAATTGCAAATAATTTCCAATCAATCCAACAATCAAATGATTCTCAAT
TTCTTCATGTGTTTGATGCAAATTATCCTACATATGTGCCACAAAATCTC
AATGGACAGATCAACACTCCACTCTATCCAATCCCGAATATCAATCCTAT
TCCTAATGCTAATAATGCAATAAACTATCAATTTAATTACACAACTAACG
AAACCGGCCACGAAGGATACTATATAGGATTACAAAATACTAATTTCATT
AATAACTCTGATTATTATCGAACAATGGTCAACATGAATCACCTTCATTC
GTTTTTGCCACAAATGAATTACCAATCAAACCAAATAGCCGTTTTAAATA
ACATCCAAGTCAATTCCATTGAACCAACGAATTATCTGAACAGCAATTAC
ATTAATGTCAGCTCGAATAACATTGAATCGGTTAAGGCTGCATCAAACGA
AATGAATCAAATCATTCAAAAACGTATTGTCCAATATCAAGATAAAAATG
TTCCGTATAAATCTCAAGAAAATTTCAGAAAGACTTTCAAGTCAACTCGA
AATAAATCGAAATCGATTTCATTGAAAGCAAATCCAGTAAACTCTTCCGA
AAACATCAATAGAAACAAGTCAACAACAATTCATCGAACGGCAAATTTAC
CAATCACAAACGAGTCATCGGAATCGAATATTTCTAATGGACAAAGTATC
GATTTGCTTGTAACGAATCTTGATTATAATATAAGCGCGAAAGAATGGAG
GAAATTATTGCTCAATCAATTTCAAAATGCAATTAAACGAGTTCACAGTG
TTTTGATTCAAACTCAACCGGACGGATCGAACTGTGGAATCGTGCGATTG
GGCAGTATGGAAGACGCCAGATTGGCTATTTCTCAATTTCATCGAAAGAA
AATTGGATACAAACGAATACAGGTTAATCTCGTCAGTAATAATGCTATTC
CATCCCCAAATAGCATCAAACAAGAAGTAGCAACTTTATTGAAATCTGTC
GCTGGGTATTCTCTGTCGGTCTATAAATTCATGGAACTTTATGAAAAGAA
ATATCATCGAAGCATATGTATTTCAGATTTTTATCGAATGAAGGATTTTG
TGGAAATCAAGGATGTGGGAGGAAATCAAAATTGGAAAATAATCAGCTTG
ACCAATACTGCAATCAATTCCATTACGCAAGCGACAAATCCATCAGAATT
AGGTGAAACTATGGAGTCATTAGTTTGTATTCAACATTGTAAGGAAGGAA
CAGAAGATTACATTACAGCTCTGGAATCAGCTATTCTACCAAATGTCGAA
ATATCATTGAAATTATTCAAAGAACAAGTTTATAAAATCTTGCAATCTCA
TAAAGGATCTGTTCATTTAATAAGCTTCTTATCTTGTTACAAAAGTGAAT
TTCATGATATCAAAATTATGAAGATTCCAGTTGCTACAAACGCACCTGAT
CAAGTAGAGTCTGAACCATTGAATAACATTCGAGAATCCGATGAAAATAC
TCAATCACCTGATAATGAATTTTTAGAAGGAGTACCTTTAGAGCATATGT
TAAATTGCATTCAAGGGATCAAAATCGTAAATTCTCAATCTGGAATCAAG
AAAATTCAATGGGATGATAAAACAGATGGGTCTTACAAAGCCAGTCAGGA
TCAAACGACAGGTTCTCCAAATAGCTATAATCAATCTGTTAATGGTCTAG
GAGGAATTTTGGTAGACAGACTTCACCAATTCAGTAGAGAAGTGGTTGAT
TTAATGAAGCATCAGCCTAACTGTAGGATGTCTCTCAGTAAATTCATTCC
GACGTATCATCATCATTTTGGAAAACAATGTAGAGTAGCAGATTACGGAT
TTTCAAAATTGCATGAATTAATTGAAGCCCTTCCTCAAGTGGTGCATGTT
ATTGGAACTGGATATGTTCGAATGCTCTATTTGGGTCACAAAGTTCAAGT
TCGTCGATTCACAAACGAAATGATGAAAGTTTTAAAATCGAAAATCACAA
AAACCTGTAGATTATCTGAATATCCAACTCAATACAAAATGCTATTTCAC
AAAGATTTTCGTATAGCCGACTATGGTGTATGTTTCATTGAAGACTTGTT
AAACGAAATTCCGGATAGCACTGTTGAAGTTATTAATAGTGACGATGACA
TATATGTTGCAATGCCTAAACGAATACAGACATCTGAAGAAAAAGAGCGC
ACTTCTCAATTCGCTATAGAAGTTATAGACTTATTGAAACAATCACCTAG
GTGTCGATTACCATTTAATAAATTTATTCCGTCCTATCACCATCATTTTA
GCAGGCAATGTAAAGTAGCCGAATACGGATTTACAAAATTAATTGAATTA
TTAGACGCAGTGCCTAAAGTTATTCAGATTATTGAAGAACACGGAGAAAA
ATATGTTATACTCACTCAATACGAAATGTTACGAGCATTAGCAGAACAAA
CGCTAAATCTTTTAGAAAAGAGTTTTAATAAGCGAATTCAATTGTCTGAG
TTTCCTAACTTATATTTAAAAACTTATGGATATGTTCTAAATTTGGAGGA
TTATGCAGTTATGTCGTTGCAACAGTTGTTTGAAAAAGTTCCAAAAATCG
CTAGAATCCAGAACTATTCCACCATATCTCCAACTAGCAAAACGAAAACA
TATAATGCATCCGTCGAATCAGAAGATCAAGTATCCCTCTCATCCGATCT
CGAAGATAAAGAGGCATTAGTAGAACAGAGTGAAATGTTTGTTTGTCTTG
CAGATCGAAATCATGTCAAATACATTGTTCACAAAGTCTTATTAGTTTTA
CTAGAAATTCCATCTGGCTCTCTACCGGATTACCAATTTTTAGAAAAATA
TCGTTATAAATATCGGGAGGAACCAAATTTAATGCTAATTCAAAATGAAA
TGCAAGATATAATTCAAATAGTTAATGATAGTTCTCTCCTTCAATATCCA
GGTTCTAGTGGTTTACACATTCGATTGAAGTCTCTTATTTTGTTTTCAAG
GGATTTAAAAGATCTGATGCGATTTAATCAATGCAAAATGCCATTAATTC
AGTTGGAAGGATTTTATGAACAACATTACGGAATTCCGTTAAAATGCCAA
AACTATGGCTATCCGTCTTTGTTCAGTTTGATTCAAGCTTGTGATTTCGT
TGTTACTCTCAAAGGTAGAGGAATTCGAGCATCATTGGTTCTATGCCAGG
ATTTTGTAGGTAAATTAGCTTATCGAATTGCATACAACACTCAGCCTATT
TTAAAAAGTAATGAAGAAAATTATGATTTCACGAACTGTCCGAAGCCGAA
TTCTATTTCATTGAATGCAGCTCAAATGGAAGACTCAGATGGAAATGTAA
CCAATTATATAACCATGCACAACCAACTCACACCATCAGTTCATTCACCA
AAGCCTTGTTCGGTACAGTCTGTGTACGGCCATAATATGTATCCTCAAAA
CAATTTCCTACCACCATTGAGCTCTTATCCATATTTCAACGCACAGCCAA
TGTACAATCCGTGGTTTAGGCAATGGTATCAGCCTCATTCCTCATATGGG
TATTCACCAAATCTTTATTCTCATCCAGAATATGGAGTAGTTTCAATTGC
CCAGCCAACTGTATCAGCAGTTCCTGGGCCTCAATCTTGCTTACCTTATG
CAAATGCAAGCCAAGATCAAAAGCAGATAGATGAACTTGTCGAAACTCTA
GCATATGATAATTCCTGTTCTTCTACATTAACTCCACCACCGGTGACTAC
GTATCAACAAATTCATCCCAGTTTAGAAGCTAATAACTCTATAATTAACA
ATCCCTGGGTAATTTACTCTCCTCACCATCAAATGATTCCTTCCAATACG
ATTTTACCGGGGTATATTACCGCAATCTCTAATGGTGACAGTGATGACAA
CGACCAACCTCTGGATAAAGTACTTACCGATTCTGAAGGAGTTCAATGTA
CAAATAACAATAACAGGTTTCAATCCAAAACCAAAAAGCTGAAAAAAAGA
GTTAAAAAACTAAAAATGATCCGTTCAGCGCGAACGGTTAATAAAACGTG
CAGACGGAGGCATTCGAAATCTATTACCTAAACCTGTCTCTCATATATTT
TATTTTCCAAATTTCTCGAACAATGACTGTTGATCGTTGGTTTTTTCTTT
GAGATTTCACATTGCCTTGCAACTATCGGCCAACTGACGCGCGCAATTAC
CGTTTCCCTATTAGCAGAGCTGTGTGGGGAAAATGAGTCAACGTTGTTTA
TTGGTTGAAAATTAGAAAAATAATCCGGTAGAATTTAGTAATTTTTTATC
ACTAGATGCCGTTTGTGATAATTTTATAAAATAGAAACTCTCTCTTCTAA
TTTTGGTTATTATCAACCAAATATAAATGTATGCTTGATTTCGAAGCAAA
AATACACAGATATTTTATGTTAAAAAAAAA
back to top

protein sequence of SMED30007267-orf-1

>SMED30007267-orf-1 ID=SMED30007267-orf-1|Name=SMED30007267-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1403bp
MNYTTQPMYPIGQSNQISNKSVEYLKPPIQSFISEDEAFQNSNLIANNFQ
SIQQSNDSQFLHVFDANYPTYVPQNLNGQINTPLYPIPNINPIPNANNAI
NYQFNYTTNETGHEGYYIGLQNTNFINNSDYYRTMVNMNHLHSFLPQMNY
QSNQIAVLNNIQVNSIEPTNYLNSNYINVSSNNIESVKAASNEMNQIIQK
RIVQYQDKNVPYKSQENFRKTFKSTRNKSKSISLKANPVNSSENINRNKS
TTIHRTANLPITNESSESNISNGQSIDLLVTNLDYNISAKEWRKLLLNQF
QNAIKRVHSVLIQTQPDGSNCGIVRLGSMEDARLAISQFHRKKIGYKRIQ
VNLVSNNAIPSPNSIKQEVATLLKSVAGYSLSVYKFMELYEKKYHRSICI
SDFYRMKDFVEIKDVGGNQNWKIISLTNTAINSITQATNPSELGETMESL
VCIQHCKEGTEDYITALESAILPNVEISLKLFKEQVYKILQSHKGSVHLI
SFLSCYKSEFHDIKIMKIPVATNAPDQVESEPLNNIRESDENTQSPDNEF
LEGVPLEHMLNCIQGIKIVNSQSGIKKIQWDDKTDGSYKASQDQTTGSPN
SYNQSVNGLGGILVDRLHQFSREVVDLMKHQPNCRMSLSKFIPTYHHHFG
KQCRVADYGFSKLHELIEALPQVVHVIGTGYVRMLYLGHKVQVRRFTNEM
MKVLKSKITKTCRLSEYPTQYKMLFHKDFRIADYGVCFIEDLLNEIPDST
VEVINSDDDIYVAMPKRIQTSEEKERTSQFAIEVIDLLKQSPRCRLPFNK
FIPSYHHHFSRQCKVAEYGFTKLIELLDAVPKVIQIIEEHGEKYVILTQY
EMLRALAEQTLNLLEKSFNKRIQLSEFPNLYLKTYGYVLNLEDYAVMSLQ
QLFEKVPKIARIQNYSTISPTSKTKTYNASVESEDQVSLSSDLEDKEALV
EQSEMFVCLADRNHVKYIVHKVLLVLLEIPSGSLPDYQFLEKYRYKYREE
PNLMLIQNEMQDIIQIVNDSSLLQYPGSSGLHIRLKSLILFSRDLKDLMR
FNQCKMPLIQLEGFYEQHYGIPLKCQNYGYPSLFSLIQACDFVVTLKGRG
IRASLVLCQDFVGKLAYRIAYNTQPILKSNEENYDFTNCPKPNSISLNAA
QMEDSDGNVTNYITMHNQLTPSVHSPKPCSVQSVYGHNMYPQNNFLPPLS
SYPYFNAQPMYNPWFRQWYQPHSSYGYSPNLYSHPEYGVVSIAQPTVSAV
PGPQSCLPYANASQDQKQIDELVETLAYDNSCSSTLTPPPVTTYQQIHPS
LEANNSIINNPWVIYSPHHQMIPSNTILPGYITAISNGDSDDNDQPLDKV
LTDSEGVQCTNNNNRFQSKTKKLKKRVKKLKMIRSARTVNKTCRRRHSKS
IT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR041966LOTUS-like
IPR024768Marf1
IPR035979RBD_domain_sf
IPR025605OST-HTH/LOTUS_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005777peroxisome
Vocabulary: biological process
TermDefinition
GO:0010468regulation of gene expression
GO:0030154cell differentiation
GO:0048477oogenesis
GO:0051321meiotic cell cycle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025605OST-HTH/LOTUS domainPFAMPF12872OST-HTHcoord: 853..913
e-value: 4.1E-5
score: 23.3
coord: 778..845
e-value: 3.2E-10
score: 39.7
coord: 617..680
e-value: 1.4E-12
score: 47.2
coord: 701..756
e-value: 0.019
score: 14.8
coord: 1056..1102
e-value: 2.1E-6
score: 27.4
IPR025605OST-HTH/LOTUS domainPROSITEPS51644HTH_OSTcoord: 776..850
score: 14.767
IPR025605OST-HTH/LOTUS domainPROSITEPS51644HTH_OSTcoord: 1037..1112
score: 11.304
IPR025605OST-HTH/LOTUS domainPROSITEPS51644HTH_OSTcoord: 616..697
score: 15.973
IPR025605OST-HTH/LOTUS domainPROSITEPS51644HTH_OSTcoord: 852..931
score: 11.872
IPR025605OST-HTH/LOTUS domainPROSITEPS51644HTH_OSTcoord: 478..555
score: 7.439
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 274..353
e-value: 1.4E-15
score: 59.3
IPR041966LOTUS-like domainGENE3DG3DSA:1.10.10.1880coord: 615..686
e-value: 5.0E-14
score: 54.3
coord: 847..918
e-value: 4.2E-6
score: 28.9
coord: 770..846
e-value: 5.0E-12
score: 47.8
coord: 1040..1106
e-value: 1.1E-7
score: 33.9
IPR024768Meiosis regulator and mRNA stability factor 1PANTHERPTHR14379LIMKAIN B LKAPcoord: 201..515
coord: 543..914
NoneNo IPR availablePANTHERPTHR14379:SF10RE61489Pcoord: 201..515
coord: 543..914
NoneNo IPR availableCDDcd08824LOTUScoord: 853..914
e-value: 9.64686E-9
score: 51.0805
NoneNo IPR availableCDDcd08824LOTUScoord: 1038..1107
e-value: 6.83588E-8
score: 48.7693
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 272..361