Transposase, Tc1-like protein

Overview
NameTransposase, Tc1-like protein
Smed IDSMED30007264
Length (bp)5959
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transposase, Tc1-like protein (SMED30007264) t-SNE clustered cells

Violin plots show distribution of expression levels for Transposase, Tc1-like protein (SMED30007264) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transposase, Tc1-like protein (SMED30007264) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transposase, Tc1-like protein (SMED30007264) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30007264

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30007264h1SMcG0005109 SmedASXL_017456SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30007264h1SMcG0005109 SmedASXL_017455SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30007264h1SMcG0005109 dd_Smed_v4_8024_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transposase, Tc1-like protein vs. Ensembl Human
Match: FANCI (FA complementation group I [Source:HGNC Symbol;Acc:HGNC:25568])

HSP 1 Score: 68.5514 bits (166), Expect = 1.315e-10
Identity = 84/407 (20.64%), Postives = 184/407 (45.21%), Query Frame = 2
Query:  770 INVDSRRLISIQTSVLHHYYEIAKNNNEFVKEI---LKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFIL-KESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQFACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            + V S  L  ++ +++ H     K + E  +E+   LK+ +  ++  ++S F   +LL++  ++  + Q+LD++ + +   +KD +L   S F++  V     + ++++  +K   +   +H+++ L+ELGF+L+ S  P+  +      TS        +S M N        Q   + G  ++++ FK    +RQ I++ + N ++ + S  +S F  L+L ++++   P  +     + T     F+ L          L+ A+ PL++ S ++R+ LI ++   + + +  +R   V   L LLK  ++      ++   S +         +     A           N+  C +I+  +     Q  D + ++Y+G   V+ +N   A  V+  LL +L+
Sbjct:  257 VTVPSGELRHVEGTIILHIVFAIKLDYELGRELVKHLKVGQQGDSNNNLSPFSIALLLSVTRIQRFQDQVLDLLKTSVVKSFKDLQLLQGSKFLQNLVPHRSYVSTMILEVVKN-SVHSWDHVTQGLVELGFILMDSYGPKKVLDGKTIETSPS------LSRMPN--------QHACKLGANILLETFKIHEMIRQEILEQVLNRVVTRASSPISHF--LDLLSNIVMYAPLVLQSCSSKVTEA---FDYLSFLPLQTVQRLLKAVQPLLKVSMSMRDCLILVLRKAMFANQLDARKSAVAGFLLLLKNFKVLGSLSSSQCSQSLSVSQVHVDVHSHYNSVA-----------NETFCLEIMDSLRRCLSQQADVRLMLYEGFYDVLRRNSQLANSVMQTLLSQLK 632          
BLAST of Transposase, Tc1-like protein vs. Ensembl Human
Match: FANCI (FA complementation group I [Source:HGNC Symbol;Acc:HGNC:25568])

HSP 1 Score: 68.5514 bits (166), Expect = 1.323e-10
Identity = 84/407 (20.64%), Postives = 184/407 (45.21%), Query Frame = 2
Query:  770 INVDSRRLISIQTSVLHHYYEIAKNNNEFVKEI---LKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFIL-KESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQFACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            + V S  L  ++ +++ H     K + E  +E+   LK+ +  ++  ++S F   +LL++  ++  + Q+LD++ + +   +KD +L   S F++  V     + ++++  +K   +   +H+++ L+ELGF+L+ S  P+  +      TS        +S M N        Q   + G  ++++ FK    +RQ I++ + N ++ + S  +S F  L+L ++++   P  +     + T     F+ L          L+ A+ PL++ S ++R+ LI ++   + + +  +R   V   L LLK  ++      ++   S +         +     A           N+  C +I+  +     Q  D + ++Y+G   V+ +N   A  V+  LL +L+
Sbjct:   84 VTVPSGELRHVEGTIILHIVFAIKLDYELGRELVKHLKVGQQGDSNNNLSPFSIALLLSVTRIQRFQDQVLDLLKTSVVKSFKDLQLLQGSKFLQNLVPHRSYVSTMILEVVKN-SVHSWDHVTQGLVELGFILMDSYGPKKVLDGKTIETSPS------LSRMPN--------QHACKLGANILLETFKIHEMIRQEILEQVLNRVVTRASSPISHF--LDLLSNIVMYAPLVLQSCSSKVTEA---FDYLSFLPLQTVQRLLKAVQPLLKVSMSMRDCLILVLRKAMFANQLDARKSAVAGFLLLLKNFKVLGSLSSSQCSQSLSVSQVHVDVHSHYNSVA-----------NETFCLEIMDSLRRCLSQQADVRLMLYEGFYDVLRRNSQLANSVMQTLLSQLK 459          
BLAST of Transposase, Tc1-like protein vs. Ensembl Human
Match: FANCI (FA complementation group I [Source:HGNC Symbol;Acc:HGNC:25568])

HSP 1 Score: 68.5514 bits (166), Expect = 1.400e-10
Identity = 84/407 (20.64%), Postives = 184/407 (45.21%), Query Frame = 2
Query:  770 INVDSRRLISIQTSVLHHYYEIAKNNNEFVKEI---LKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFIL-KESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQFACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            + V S  L  ++ +++ H     K + E  +E+   LK+ +  ++  ++S F   +LL++  ++  + Q+LD++ + +   +KD +L   S F++  V     + ++++  +K   +   +H+++ L+ELGF+L+ S  P+  +      TS        +S M N        Q   + G  ++++ FK    +RQ I++ + N ++ + S  +S F  L+L ++++   P  +     + T     F+ L          L+ A+ PL++ S ++R+ LI ++   + + +  +R   V   L LLK  ++      ++   S +         +     A           N+  C +I+  +     Q  D + ++Y+G   V+ +N   A  V+  LL +L+
Sbjct:  257 VTVPSGELRHVEGTIILHIVFAIKLDYELGRELVKHLKVGQQGDSNNNLSPFSIALLLSVTRIQRFQDQVLDLLKTSVVKSFKDLQLLQGSKFLQNLVPHRSYVSTMILEVVKN-SVHSWDHVTQGLVELGFILMDSYGPKKVLDGKTIETSPS------LSRMPN--------QHACKLGANILLETFKIHEMIRQEILEQVLNRVVTRASSPISHF--LDLLSNIVMYAPLVLQSCSSKVTEA---FDYLSFLPLQTVQRLLKAVQPLLKVSMSMRDCLILVLRKAMFANQLDARKSAVAGFLLLLKNFKVLGSLSSSQCSQSLSVSQVHVDVHSHYNSVA-----------NETFCLEIMDSLRRCLSQQADVRLMLYEGFYDVLRRNSQLANSVMQTLLSQLK 632          
BLAST of Transposase, Tc1-like protein vs. Ensembl Human
Match: FANCI (FA complementation group I [Source:HGNC Symbol;Acc:HGNC:25568])

HSP 1 Score: 68.5514 bits (166), Expect = 1.491e-10
Identity = 84/407 (20.64%), Postives = 184/407 (45.21%), Query Frame = 2
Query:  770 INVDSRRLISIQTSVLHHYYEIAKNNNEFVKEI---LKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFIL-KESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQFACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            + V S  L  ++ +++ H     K + E  +E+   LK+ +  ++  ++S F   +LL++  ++  + Q+LD++ + +   +KD +L   S F++  V     + ++++  +K   +   +H+++ L+ELGF+L+ S  P+  +      TS        +S M N        Q   + G  ++++ FK    +RQ I++ + N ++ + S  +S F  L+L ++++   P  +     + T     F+ L          L+ A+ PL++ S ++R+ LI ++   + + +  +R   V   L LLK  ++      ++   S +         +     A           N+  C +I+  +     Q  D + ++Y+G   V+ +N   A  V+  LL +L+
Sbjct:  257 VTVPSGELRHVEGTIILHIVFAIKLDYELGRELVKHLKVGQQGDSNNNLSPFSIALLLSVTRIQRFQDQVLDLLKTSVVKSFKDLQLLQGSKFLQNLVPHRSYVSTMILEVVKN-SVHSWDHVTQGLVELGFILMDSYGPKKVLDGKTIETSPS------LSRMPN--------QHACKLGANILLETFKIHEMIRQEILEQVLNRVVTRASSPISHF--LDLLSNIVMYAPLVLQSCSSKVTEA---FDYLSFLPLQTVQRLLKAVQPLLKVSMSMRDCLILVLRKAMFANQLDARKSAVAGFLLLLKNFKVLGSLSSSQCSQSLSVSQVHVDVHSHYNSVA-----------NETFCLEIMDSLRRCLSQQADVRLMLYEGFYDVLRRNSQLANSVMQTLLSQLK 632          
BLAST of Transposase, Tc1-like protein vs. Ensembl Zebrafish
Match: fanci (FA complementation group I [Source:ZFIN;Acc:ZDB-GENE-030131-2905])

HSP 1 Score: 68.1662 bits (165), Expect = 1.086e-10
Identity = 96/438 (21.92%), Postives = 194/438 (44.29%), Query Frame = 2
Query:  710 AVVNFFN---------QRTISCSQLSQSNINVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPR----SKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQN-FILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
             ++N+F          QR   C  +    I  D  R +   T +LH  + I + ++E  +E  K  K   +   +  F   +LL++A ++  + Q+ + +   IT  +KD ++   S F+++ + +   +  ++++++K       +H+++ L++LGF+L+ S  P+     K+T   S T+                      Q   + G Q++++ FK    +R  I++ + N  + K +  V+ F+  +L + ++   P  + +   + T     F+ L +        L+ A+ PL++ S ++++ LI ++   + S     R   V   L LLK  RI     G+  +ASS     Q SQ    +Q+ AD      +   N+  C +IL  +     Q  D + ++Y+G   V+ +N   A  +   LL +L+
Sbjct:  237 GIINYFKKQDQLQKEEQRNGECEDVEVQTIPQDQLRHVE-GTVILHIVFAI-RLDHELGREFFKNLKVAQS-DPLCPFSIALLLSVARIQRYEEQVFEFLKGAITKNFKDDQIQNSSKFLQDLLPQFSSVSDMILDTVKNSVFG-WDHVTQGLVQLGFILMDSFGPKPGPFGKVTEGTSSTAKTPN------------------QLACRLGGQVLLESFKMHEPIRGEILEQVLNRLVTKTASPVTHFI--DLLSSIVLSAPMILLESSSKVTE---TFDQLSYLPLSTVQGLLKAVQPLLKVSMSMKDALILVLRKAMFSSHLDGRKSAVAGFLLLLKNFRI----LGS--LASS-----QASQAITSSQVQADVHS-RYNTAANEAFCLEILSSLRRCLNQQADVRLMLYEGFHDVLRRNSQLASSITQTLLSQLK 635          
BLAST of Transposase, Tc1-like protein vs. Ensembl Xenopus
Match: FANCI (polymerase (DNA directed), gamma [Source:NCBI gene;Acc:100038061])

HSP 1 Score: 81.2629 bits (199), Expect = 1.536e-14
Identity = 92/406 (22.66%), Postives = 193/406 (47.54%), Query Frame = 2
Query:  767 NINVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQN-FILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            +  +   +L  ++ +++ H     K + E  +E+LK  K  + +  +  F   +LL+++ +   + Q+ D + S I   YKD +    S  +++ V +   + S+L+ ++K   +   +H+++ L+ELGF+L+ S  P++              G  ++  +  N  +   AQ+  Q G +++++ FK    +R  I++ + N  I K ++ V+ F  L+L +D++   P  + +   + T     F+ L          L+ A+ PL++ S ++R++LI ++   + S +  +R   V   L LL+  ++         + S +S  +QCSQ    +QI  D   +  +   N+  C +IL  +     Q  D + ++Y+G   V+ +N   A  V+  LL +L+
Sbjct:  223 DATIPQDQLCHVEGTIILHIVFAIKLDQELGRELLKYLKVTSKI--LCPFSAALLLSVSRIHRFQEQVFDFLKSTILRVYKDHQFHQSSKILQDLVPQPACVSSILLKTVKNS-VYGWDHVTQGLVELGFILMDSFGPKAAF------------GTKVVETISVN--SRTPAQQACQLGSRILLEAFKVHEPIRSEILEQVLNRVITKAANPVTHF--LDLLSDIVVSAPLILQNSSSKVTEA---FDHLSFLPLTTVQGLLKAVQPLLKISMSMRDSLILVLRKAMFSSQIDARKSAVAGFLLLLRNFKV---------LGSLSS--SQCSQAIGASQIQVDVH-MRYNAAANEAFCLEILGSLRRCLSQQADVRLMLYEGFYDVLRRNSQLASSVMQTLLSQLK 594          
BLAST of Transposase, Tc1-like protein vs. Ensembl Xenopus
Match: FANCI (polymerase (DNA directed), gamma [Source:NCBI gene;Acc:100038061])

HSP 1 Score: 80.1073 bits (196), Expect = 4.142e-14
Identity = 97/430 (22.56%), Postives = 199/430 (46.28%), Query Frame = 2
Query:  704 VGAVVNFFNQRTISCSQLSQSNINVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILKLCK---NNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQN-FILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            V  ++  FN      S L   +  +   +L  ++ +++ H     K + E  +E+LK  K     +    +  F   +LL+++ +   + Q+ D + S I   YKD +    S  +++ V +   + S+L+ ++K   +   +H+++ L+ELGF+L+ S  P++              G  ++  +  N  +   AQ+  Q G +++++ FK    +R  I++ + N  I K ++ V+ F  L+L +D++   P  + +   + T     F+ L          L+ A+ PL++ S ++R++LI ++   + S +  +R   V   L LL+  ++         + S +S  +QCSQ    +QI  D   +  +   N+  C +IL  +     Q  D + ++Y+G   V+ +N   A  V+  LL +L+
Sbjct:  185 VEGIITIFNDLDQKQS-LDLEDATIPQDQLCHVEGTIILHIVFAIKLDQELGRELLKYLKAGQQGDTSKILCPFSAALLLSVSRIHRFQEQVFDFLKSTILRVYKDHQFHQSSKILQDLVPQPACVSSILLKTVKNS-VYGWDHVTQGLVELGFILMDSFGPKAAF------------GTKVVETISVN--SRTPAQQACQLGSRILLEAFKVHEPIRSEILEQVLNRVITKAANPVTHF--LDLLSDIVVSAPLILQNSSSKVTEA---FDHLSFLPLTTVQGLLKAVQPLLKISMSMRDSLILVLRKAMFSSQIDARKSAVAGFLLLLRNFKV---------LGSLSS--SQCSQAIGASQIQVDVH-MRYNAAANEAFCLEILGSLRRCLSQQADVRLMLYEGFYDVLRRNSQLASSVMQTLLSQLK 581          
BLAST of Transposase, Tc1-like protein vs. Ensembl Xenopus
Match: FANCI (polymerase (DNA directed), gamma [Source:NCBI gene;Acc:100038061])

HSP 1 Score: 79.7221 bits (195), Expect = 5.385e-14
Identity = 97/434 (22.35%), Postives = 201/434 (46.31%), Query Frame = 2
Query:  704 VGAVVNFFNQRTISCSQLSQS----NINVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILKLCK---NNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQN-FILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            V  ++  FN   +   QL QS    +  +   +L  ++ +++ H     K + E  +E+LK  K     +    +  F   +LL+++ +   + Q+ D + S I   YKD +    S  +++ V +   + S+L+ ++K   +   +H+++ L+ELGF+L+ S  P++              G  ++  +  N  +   AQ+  Q G +++++ FK    +R  I++ + N  I K ++ V+ F  L+L +D++   P  + +   + T     F+ L          L+ A+ PL++ S ++R++LI ++   + S +  +R   V   L LL+  ++         + S +S  +QCSQ    +Q+      +  +   N+  C +IL  +     Q  D + ++Y+G   V+ +N   A  V+  LL +L+
Sbjct:  227 VEGIITIFND--LDQKQLIQSLDLEDATIPQDQLCHVEGTIILHIVFAIKLDQELGRELLKYLKAGQQGDTSKILCPFSAALLLSVSRIHRFQEQVFDFLKSTILRVYKDHQFHQSSKILQDLVPQPACVSSILLKTVKNS-VYGWDHVTQGLVELGFILMDSFGPKAAF------------GTKVVETISVN--SRTPAQQACQLGSRILLEAFKVHEPIRSEILEQVLNRVITKAANPVTHF--LDLLSDIVVSAPLILQNSSSKVTEA---FDHLSFLPLTTVQGLLKAVQPLLKISMSMRDSLILVLRKAMFSSQIDARKSAVAGFLLLLRNFKV---------LGSLSS--SQCSQAIGASQVIIVDVHMRYNAAANEAFCLEILGSLRRCLSQQADVRLMLYEGFYDVLRRNSQLASSVMQTLLSQLK 627          
BLAST of Transposase, Tc1-like protein vs. Ensembl Xenopus
Match: FANCI (polymerase (DNA directed), gamma [Source:NCBI gene;Acc:100038061])

HSP 1 Score: 79.7221 bits (195), Expect = 5.601e-14
Identity = 97/434 (22.35%), Postives = 201/434 (46.31%), Query Frame = 2
Query:  704 VGAVVNFFNQRTISCSQLSQS----NINVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILKLCK---NNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQN-FILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            V  ++  FN   +   QL QS    +  +   +L  ++ +++ H     K + E  +E+LK  K     +    +  F   +LL+++ +   + Q+ D + S I   YKD +    S  +++ V +   + S+L+ ++K   +   +H+++ L+ELGF+L+ S  P++              G  ++  +  N  +   AQ+  Q G +++++ FK    +R  I++ + N  I K ++ V+ F  L+L +D++   P  + +   + T     F+ L          L+ A+ PL++ S ++R++LI ++   + S +  +R   V   L LL+  ++         + S +S  +QCSQ    +Q+      +  +   N+  C +IL  +     Q  D + ++Y+G   V+ +N   A  V+  LL +L+
Sbjct:  193 VEGIITIFND--LDQKQLIQSLDLEDATIPQDQLCHVEGTIILHIVFAIKLDQELGRELLKYLKAGQQGDTSKILCPFSAALLLSVSRIHRFQEQVFDFLKSTILRVYKDHQFHQSSKILQDLVPQPACVSSILLKTVKNS-VYGWDHVTQGLVELGFILMDSFGPKAAF------------GTKVVETISVN--SRTPAQQACQLGSRILLEAFKVHEPIRSEILEQVLNRVITKAANPVTHF--LDLLSDIVVSAPLILQNSSSKVTEA---FDHLSFLPLTTVQGLLKAVQPLLKISMSMRDSLILVLRKAMFSSQIDARKSAVAGFLLLLRNFKV---------LGSLSS--SQCSQAIGASQVIIVDVHMRYNAAANEAFCLEILGSLRRCLSQQADVRLMLYEGFYDVLRRNSQLASSVMQTLLSQLK 593          
BLAST of Transposase, Tc1-like protein vs. Ensembl Xenopus
Match: FANCI (polymerase (DNA directed), gamma [Source:NCBI gene;Acc:100038061])

HSP 1 Score: 79.7221 bits (195), Expect = 5.678e-14
Identity = 92/409 (22.49%), Postives = 192/409 (46.94%), Query Frame = 2
Query:  767 NINVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILKLCK---NNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQN-FILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            +  +   +L  ++ +++ H     K + E  +E+LK  K     +    +  F   +LL+++ +   + Q+ D + S I   YKD +    S  +++ V +   + S+L+ ++K   +   +H+++ L+ELGF+L+ S  P++              G  ++  +  N  +   AQ+  Q G +++++ FK    +R  I++ + N  I K ++ V+ F  L+L +D++   P  + +   + T     F+ L          L+ A+ PL++ S ++R++LI ++   + S +  +R   V   L LL+  ++         + S +S  +QCSQ    +QI  D   +  +   N+  C +IL  +     Q  D + ++Y+G   V+ +N   A  V+  LL +L+
Sbjct:  257 DATIPQDQLCHVEGTIILHIVFAIKLDQELGRELLKYLKAGQQGDTSKILCPFSAALLLSVSRIHRFQEQVFDFLKSTILRVYKDHQFHQSSKILQDLVPQPACVSSILLKTVKNS-VYGWDHVTQGLVELGFILMDSFGPKAAF------------GTKVVETISVN--SRTPAQQACQLGSRILLEAFKVHEPIRSEILEQVLNRVITKAANPVTHF--LDLLSDIVVSAPLILQNSSSKVTEA---FDHLSFLPLTTVQGLLKAVQPLLKISMSMRDSLILVLRKAMFSSQIDARKSAVAGFLLLLRNFKV---------LGSLSS--SQCSQAIGASQIQVDVH-MRYNAAANEAFCLEILGSLRRCLSQQADVRLMLYEGFYDVLRRNSQLASSVMQTLLSQLK 633          
BLAST of Transposase, Tc1-like protein vs. Ensembl Mouse
Match: Fanci (Fanconi anemia, complementation group I [Source:MGI Symbol;Acc:MGI:2384790])

HSP 1 Score: 78.5666 bits (192), Expect = 7.959e-14
Identity = 94/419 (22.43%), Postives = 191/419 (45.58%), Query Frame = 2
Query:  770 INVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILKLCK---NNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKS---GTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFILKESHKVSVFVYLELFADLISLMP---------TEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            I   +  L  ++ +V+ H     K + E  +E+LK  K     +    +  F   +LL+L  ++  + Q+ D++ + +   +KD +L   S F++  V +   + ++++  ++   +   +H+++ L+E GF+L+ S  P+ KI   K+   GTS        +S+M N        Q   + G  ++++ FK    +RQ I++ + N ++  +    +  +L+LF+D+I   P         TE FD++    T  P+              L+ A+ PL++ S ++R++LI ++   + + +  +R   V   L LLK  ++         + S  S  +QC+Q    TQ+  D          N+  C +I+  +  S  Q  D + ++Y G   V+ +N   A  ++  L  +L+
Sbjct:  229 ITAPADELYHVEGTVILHIVFAIKLDCELGRELLKHLKAGQQGDPSKCLCPFSIALLLSLTRIQRFEEQVFDLLKTSVVKSFKDLQLLQGSKFLQTLVPQRTCVSTMILEVVRNS-VHSWDHVTQGLIEFGFILMDSYGPK-KILDGKAVEIGTS--------LSKMTN--------QHACKLGANILLETFKIHEMIRQEILEQVLNRVVTRTSS-PINHFLDLFSDIIMYAPLILQNCSKVTETFDYL----TFLPL---------QTVQGLLKAVQPLLKISMSMRDSLILVLRKAMFASQLDARKSAVAGFLLLLKNFKV---------LGSLPS--SQCTQSIGVTQVRVDVHS-RYSAVANETFCLEIIDSLKRSLGQQADIRLMLYDGFYDVLRRNSQLASSIMQTLFSQLK 603          
BLAST of Transposase, Tc1-like protein vs. Ensembl Mouse
Match: Fanci (Fanconi anemia, complementation group I [Source:MGI Symbol;Acc:MGI:2384790])

HSP 1 Score: 78.5666 bits (192), Expect = 8.147e-14
Identity = 94/419 (22.43%), Postives = 191/419 (45.58%), Query Frame = 2
Query:  770 INVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILKLCK---NNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKS---GTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFILKESHKVSVFVYLELFADLISLMP---------TEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            I   +  L  ++ +V+ H     K + E  +E+LK  K     +    +  F   +LL+L  ++  + Q+ D++ + +   +KD +L   S F++  V +   + ++++  ++   +   +H+++ L+E GF+L+ S  P+ KI   K+   GTS        +S+M N        Q   + G  ++++ FK    +RQ I++ + N ++  +    +  +L+LF+D+I   P         TE FD++    T  P+              L+ A+ PL++ S ++R++LI ++   + + +  +R   V   L LLK  ++         + S  S  +QC+Q    TQ+  D          N+  C +I+  +  S  Q  D + ++Y G   V+ +N   A  ++  L  +L+
Sbjct:  257 ITAPADELYHVEGTVILHIVFAIKLDCELGRELLKHLKAGQQGDPSKCLCPFSIALLLSLTRIQRFEEQVFDLLKTSVVKSFKDLQLLQGSKFLQTLVPQRTCVSTMILEVVRNS-VHSWDHVTQGLIEFGFILMDSYGPK-KILDGKAVEIGTS--------LSKMTN--------QHACKLGANILLETFKIHEMIRQEILEQVLNRVVTRTSS-PINHFLDLFSDIIMYAPLILQNCSKVTETFDYL----TFLPL---------QTVQGLLKAVQPLLKISMSMRDSLILVLRKAMFASQLDARKSAVAGFLLLLKNFKV---------LGSLPS--SQCTQSIGVTQVRVDVHS-RYSAVANETFCLEIIDSLKRSLGQQADIRLMLYDGFYDVLRRNSQLASSIMQTLFSQLK 631          
BLAST of Transposase, Tc1-like protein vs. UniProt/SwissProt
Match: sp|Q8K368|FANCI_MOUSE (Fanconi anemia group I protein homolog OS=Mus musculus OX=10090 GN=Fanci PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 5.699e-13
Identity = 94/419 (22.43%), Postives = 191/419 (45.58%), Query Frame = 2
Query:  770 INVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILKLCK---NNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKS---GTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFILKESHKVSVFVYLELFADLISLMP---------TEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            I   +  L  ++ +V+ H     K + E  +E+LK  K     +    +  F   +LL+L  ++  + Q+ D++ + +   +KD +L   S F++  V +   + ++++  ++   +   +H+++ L+E GF+L+ S  P+ KI   K+   GTS        +S+M N        Q   + G  ++++ FK    +RQ I++ + N ++  +    +  +L+LF+D+I   P         TE FD++    T  P+              L+ A+ PL++ S ++R++LI ++   + + +  +R   V   L LLK  ++         + S  S  +QC+Q    TQ+  D          N+  C +I+  +  S  Q  D + ++Y G   V+ +N   A  ++  L  +L+
Sbjct:  257 ITAPADELYHVEGTVILHIVFAIKLDCELGRELLKHLKAGQQGDPSKCLCPFSIALLLSLTRIQRFEEQVFDLLKTSVVKSFKDLQLLQGSKFLQTLVPQRTCVSTMILEVVRNS-VHSWDHVTQGLIEFGFILMDSYGPK-KILDGKAVEIGTS--------LSKMTN--------QHACKLGANILLETFKIHEMIRQEILEQVLNRVVTRTSS-PINHFLDLFSDIIMYAPLILQNCSKVTETFDYL----TFLPL---------QTVQGLLKAVQPLLKISMSMRDSLILVLRKAMFASQLDARKSAVAGFLLLLKNFKV---------LGSLPS--SQCTQSIGVTQVRVDVHS-RYSAVANETFCLEIIDSLKRSLGQQADIRLMLYDGFYDVLRRNSQLASSIMQTLFSQLK 631          
BLAST of Transposase, Tc1-like protein vs. UniProt/SwissProt
Match: sp|Q9NVI1|FANCI_HUMAN (Fanconi anemia group I protein OS=Homo sapiens OX=9606 GN=FANCI PE=1 SV=4)

HSP 1 Score: 68.5514 bits (166), Expect = 6.314e-10
Identity = 84/407 (20.64%), Postives = 184/407 (45.21%), Query Frame = 2
Query:  770 INVDSRRLISIQTSVLHHYYEIAKNNNEFVKEI---LKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFIL-KESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQFACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            + V S  L  ++ +++ H     K + E  +E+   LK+ +  ++  ++S F   +LL++  ++  + Q+LD++ + +   +KD +L   S F++  V     + ++++  +K   +   +H+++ L+ELGF+L+ S  P+  +      TS        +S M N        Q   + G  ++++ FK    +RQ I++ + N ++ + S  +S F  L+L ++++   P  +     + T     F+ L          L+ A+ PL++ S ++R+ LI ++   + + +  +R   V   L LLK  ++      ++   S +         +     A           N+  C +I+  +     Q  D + ++Y+G   V+ +N   A  V+  LL +L+
Sbjct:  257 VTVPSGELRHVEGTIILHIVFAIKLDYELGRELVKHLKVGQQGDSNNNLSPFSIALLLSVTRIQRFQDQVLDLLKTSVVKSFKDLQLLQGSKFLQNLVPHRSYVSTMILEVVKN-SVHSWDHVTQGLVELGFILMDSYGPKKVLDGKTIETSPS------LSRMPN--------QHACKLGANILLETFKIHEMIRQEILEQVLNRVVTRASSPISHF--LDLLSNIVMYAPLVLQSCSSKVTEA---FDYLSFLPLQTVQRLLKAVQPLLKVSMSMRDCLILVLRKAMFANQLDARKSAVAGFLLLLKNFKVLGSLSSSQCSQSLSVSQVHVDVHSHYNSVA-----------NETFCLEIMDSLRRCLSQQADVRLMLYEGFYDVLRRNSQLANSVMQTLLSQLK 632          
BLAST of Transposase, Tc1-like protein vs. TrEMBL
Match: A0A4S2LDS3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008314 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 3.494e-16
Identity = 106/424 (25.00%), Postives = 194/424 (45.75%), Query Frame = 2
Query:  827 YEIAKNNNEFVKEILKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIK-------SGLPRSKITSLKSGT-SNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYS------------------STIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASS-----NSYLTQC-----------SQFACTQIAADSKPLPVDNFNNDEICSQILQIINE------------SSLQYPD--TKSLIYKGLLQVIEKN 1930
            +E+   + +F  E+L   K+ +    +S F+  +LL +  + +++ Q L ++ S + + + D +L  ESAF+R       D  +L+    + C  +  +H+++ L+ LGF L++       S L  S+ T   S   S+K      + +   + IN+    RVG+  +++++ LFK  P++RQ I+D + N +  ES         +L AD+ +  P ++    D     +PI   +     ++++ LV+A+LPLIR                      +R  L + +     S R   R   V   L LLK+L+++V  F + +  SS      + LTQ            SQ   TQ+A  +  LP D   N+ +C++I+ +++             S L+ P+   KS IY GL +V+ +N
Sbjct:  221 FELCTQSTQFGLELLLAVKSLSQDVILSEFIFALLLTVLPIPYLQTQSLRLLNSTLLAAFADGRLISESAFLRGFCDAPDDPATLIFRISQQCLSASGKHLTQGLVLLGFGLLRASAHNPGSALLTSRRTRAPSTVKSHKPNTSPFVPQ---HHINV----RVGRLAMEVLVHLFKHCPQMRQTIMDILANILWTESSSPIALKLADLLADMGAASPLDVAVLADRL---EPIINSIGLIPVELSIGLVHALLPLIRAGNQLVDAWNASQQPTENPMGAVRTRLFTTLCKAASSPRVHYRRTAVACFLILLKHLKVSVSAFRSASQHSSGNLSQGTPLTQTQATQLNPHLLYSQLQSTQLAQQAVVLPCDVDQNEALCTEIVSVLHRIIFSAFFRSQAGSLLEDPENKVKSDIYWGLCEVVTRN 634          
BLAST of Transposase, Tc1-like protein vs. TrEMBL
Match: A0A4S2LIR6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008314 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 3.734e-16
Identity = 106/424 (25.00%), Postives = 194/424 (45.75%), Query Frame = 2
Query:  827 YEIAKNNNEFVKEILKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIK-------SGLPRSKITSLKSGT-SNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYS------------------STIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASS-----NSYLTQC-----------SQFACTQIAADSKPLPVDNFNNDEICSQILQIINE------------SSLQYPD--TKSLIYKGLLQVIEKN 1930
            +E+   + +F  E+L   K+ +    +S F+  +LL +  + +++ Q L ++ S + + + D +L  ESAF+R       D  +L+    + C  +  +H+++ L+ LGF L++       S L  S+ T   S   S+K      + +   + IN+    RVG+  +++++ LFK  P++RQ I+D + N +  ES         +L AD+ +  P ++    D     +PI   +     ++++ LV+A+LPLIR                      +R  L + +     S R   R   V   L LLK+L+++V  F + +  SS      + LTQ            SQ   TQ+A  +  LP D   N+ +C++I+ +++             S L+ P+   KS IY GL +V+ +N
Sbjct:  221 FELCTQSTQFGLELLLAVKSLSQDVILSEFIFALLLTVLPIPYLQTQSLRLLNSTLLAAFADGRLISESAFLRGFCDAPDDPATLIFRISQQCLSASGKHLTQGLVLLGFGLLRASAHNPGSALLTSRRTRAPSTVKSHKPNTSPFVPQ---HHINV----RVGRLAMEVLVHLFKHCPQMRQTIMDILANILWTESSSPIALKLADLLADMGAASPLDVAVLADRL---EPIINSIGLIPVELSIGLVHALLPLIRAGNQLVDAWNASQQPTENPMGAVRTRLFTTLCKAASSPRVHYRRTAVACFLILLKHLKVSVSAFRSASQHSSGNLSQGTPLTQTQATQLNPHLLYSQLQSTQLAQQAVVLPCDVDQNEALCTEIVSVLHRIIFSAFFRSQAGSLLEDPENKVKSDIYWGLCEVVTRN 634          
BLAST of Transposase, Tc1-like protein vs. TrEMBL
Match: A0A4S2LJM1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008314 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 4.261e-16
Identity = 106/424 (25.00%), Postives = 194/424 (45.75%), Query Frame = 2
Query:  827 YEIAKNNNEFVKEILKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIK-------SGLPRSKITSLKSGT-SNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYS------------------STIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASS-----NSYLTQC-----------SQFACTQIAADSKPLPVDNFNNDEICSQILQIINE------------SSLQYPD--TKSLIYKGLLQVIEKN 1930
            +E+   + +F  E+L   K+ +    +S F+  +LL +  + +++ Q L ++ S + + + D +L  ESAF+R       D  +L+    + C  +  +H+++ L+ LGF L++       S L  S+ T   S   S+K      + +   + IN+    RVG+  +++++ LFK  P++RQ I+D + N +  ES         +L AD+ +  P ++    D     +PI   +     ++++ LV+A+LPLIR                      +R  L + +     S R   R   V   L LLK+L+++V  F + +  SS      + LTQ            SQ   TQ+A  +  LP D   N+ +C++I+ +++             S L+ P+   KS IY GL +V+ +N
Sbjct:  239 FELCTQSTQFGLELLLAVKSLSQDVILSEFIFALLLTVLPIPYLQTQSLRLLNSTLLAAFADGRLISESAFLRGFCDAPDDPATLIFRISQQCLSASGKHLTQGLVLLGFGLLRASAHNPGSALLTSRRTRAPSTVKSHKPNTSPFVPQ---HHINV----RVGRLAMEVLVHLFKHCPQMRQTIMDILANILWTESSSPIALKLADLLADMGAASPLDVAVLADRL---EPIINSIGLIPVELSIGLVHALLPLIRAGNQLVDAWNASQQPTENPMGAVRTRLFTTLCKAASSPRVHYRRTAVACFLILLKHLKVSVSAFRSASQHSSGNLSQGTPLTQTQATQLNPHLLYSQLQSTQLAQQAVVLPCDVDQNEALCTEIVSVLHRIIFSAFFRSQAGSLLEDPENKVKSDIYWGLCEVVTRN 652          
BLAST of Transposase, Tc1-like protein vs. TrEMBL
Match: A0A4S2LK15 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008314 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 4.949e-16
Identity = 106/424 (25.00%), Postives = 194/424 (45.75%), Query Frame = 2
Query:  827 YEIAKNNNEFVKEILKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIK-------SGLPRSKITSLKSGT-SNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYS------------------STIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASS-----NSYLTQC-----------SQFACTQIAADSKPLPVDNFNNDEICSQILQIINE------------SSLQYPD--TKSLIYKGLLQVIEKN 1930
            +E+   + +F  E+L   K+ +    +S F+  +LL +  + +++ Q L ++ S + + + D +L  ESAF+R       D  +L+    + C  +  +H+++ L+ LGF L++       S L  S+ T   S   S+K      + +   + IN+    RVG+  +++++ LFK  P++RQ I+D + N +  ES         +L AD+ +  P ++    D     +PI   +     ++++ LV+A+LPLIR                      +R  L + +     S R   R   V   L LLK+L+++V  F + +  SS      + LTQ            SQ   TQ+A  +  LP D   N+ +C++I+ +++             S L+ P+   KS IY GL +V+ +N
Sbjct:  239 FELCTQSTQFGLELLLAVKSLSQDVILSEFIFALLLTVLPIPYLQTQSLRLLNSTLLAAFADGRLISESAFLRGFCDAPDDPATLIFRISQQCLSASGKHLTQGLVLLGFGLLRASAHNPGSALLTSRRTRAPSTVKSHKPNTSPFVPQ---HHINV----RVGRLAMEVLVHLFKHCPQMRQTIMDILANILWTESSSPIALKLADLLADMGAASPLDVAVLADRL---EPIINSIGLIPVELSIGLVHALLPLIRAGNQLVDAWNASQQPTENPMGAVRTRLFTTLCKAASSPRVHYRRTAVACFLILLKHLKVSVSAFRSASQHSSGNLSQGTPLTQTQATQLNPHLLYSQLQSTQLAQQAVVLPCDVDQNEALCTEIVSVLHRIIFSAFFRSQAGSLLEDPENKVKSDIYWGLCEVVTRN 652          
BLAST of Transposase, Tc1-like protein vs. TrEMBL
Match: A0A4Z2CWN7 (Fanconi anemia group I protein OS=Schistosoma japonicum OX=6182 GN=EWB00_006902 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 6.124e-16
Identity = 110/453 (24.28%), Postives = 197/453 (43.49%), Query Frame = 2
Query:  797 SIQTSVLHHYYEIAKNNNEFVKEILKLCKN-NNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIK----SGLPRSKITSLKSGTSNK-KGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSS------------------TIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFG-----------------TENVASSNSYLTQCSQFACTQIAADSKPLPVDNFNNDEICSQILQIINE------------SSLQYPD--TKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQSVVT 1990
            +I+   +   + + K N  F K I +  K    +L  +  F   IL+ L  ++  +A    ++T+ I + + D+ L  ES+F+R+    + D   +++   ++C   + E   + ++ LGF L++    S   RS   SLK  +S+  +  D L S             R+ ++G+ +++ +FK  P  R  II  I N I  +S +      L+L +DL+++ P E+    D      PI + +      ++  LV+A+LPLIR  S                   +R  LIS +     S R  SR   V   + LLK+L++++  F                  +++ A+  + L   SQ   TQIA  +  LP D   N+ +C++I++I+              S L  P+   KS IY GL +V+ +N      ++   L  L   ++
Sbjct:  231 TIRGHFIMKLFSLVKENGRFGKTIFETIKCLPKSLIGLE-FYYTILMTLLPIQSTQAHATQLLTTSILTAFSDSHLVSESSFLRDLCPLSNDPKEVILKLSEHCNSKQWEFTVQGMILLGFTLLQAACSSSTARSSGRSLKPLSSSPFQTHDTLKS-------------RILRSGLDILLHIFKHCPCSRDEIITIIANLIWSDSTRSVALYALDLLSDLVAVFPLEVAMRADRL---DPIIDSIGLIPLSISTGLVHALLPLIRAGSLLELGCNSESDQDDNLFNQVRKKLISNLSKYAQSPRISSRCSAVACFILLLKHLKVSISSFRSASQHSSSSSLSQPFTYSQSQATQRNPLLLFSQLQSTQIAQQAVLLPCDIVQNEVLCTEIIRILQRIIFSAVFRSQPGSLLADPENMVKSNIYWGLCEVVTRNRGLCEPIISLYLRLLTGCLS 666          
BLAST of Transposase, Tc1-like protein vs. Ensembl Cavefish
Match: fanci (FA complementation group I [Source:NCBI gene;Acc:103039599])

HSP 1 Score: 73.1738 bits (178), Expect = 3.049e-12
Identity = 88/395 (22.28%), Postives = 186/395 (47.09%), Query Frame = 2
Query:  806 TSVLHHYYEIAKNNNEFVKEILKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKI--TSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQN-FILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            T++LH  + I + ++E  KE LK  K +     +  F   +LL++A ++  + Q+ + +   I   +KD +    S  +++ +     +  ++++++K       +H+++SL++LGF+L+ S  P++     ++++ T+  K                  +Q   Q G Q++++ FK    +R  I++ + N  + K +  V+ F+  EL ++++   P  + +   + T     F+ L          L+ A+ PL++ S ++++ LI ++   + S +   R   V   L LLK  R+     G+  +A S     QCSQ    +Q+ AD      ++  N+  C +IL  +     Q  D + ++Y+G   V+ +N   A  ++  LL +L+
Sbjct:  274 TAILHVVFAI-RLDHELGKEFLKSLKVSQG-QPLCPFSIALLLSVARIQHYQEQVFEFLKGAIIKNFKDEQFLHGSKLLQDLLPPCHSISQMILDTVKNSVFG-WDHVTQSLVQLGFILMDSFGPKAGPFGKTIEAPTTAAK----------------TPSQLACQLGGQVLLESFKMHEPIRGEILEQVLNRLVTKTASPVTHFI--ELLSNIVMSAPMILLESSSKVTE---TFDQLSFLPLSTVQGLLKAVQPLLKVSMSLKDALILVLRKAMFSSQLDGRKSAVSGFLLLLKNFRV----LGS--LAPS-----QCSQALTSSQVQADVHSR-YNSAANESFCLEILSSLRRCLGQQADVRLMLYEGFHDVLRRNSQLASSIMHTLLSQLK 632          
BLAST of Transposase, Tc1-like protein vs. Ensembl Sea Lamprey
Match: fanci (FA complementation group I [Source:ZFIN;Acc:ZDB-GENE-030131-2905])

HSP 1 Score: 84.7297 bits (208), Expect = 1.758e-16
Identity = 85/356 (23.88%), Postives = 177/356 (49.72%), Query Frame = 2
Query:  914 FMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFEN-FDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQFACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQ 1978
            F   + L+LA +  ++ Q+ +MM   I   ++D ++   SA I++ V    + +  +++ +I+    S  +HIS+ L++LGF L+ S  P       K+G   K      ++E     ++   AQ+    G +++++ FK    +R+ I++ + N ++ ++  V +  YLEL +D+++  P  + + + +    Q  F+ L      V   L+ A+LPL+R    ++++LI  +   + S + ++R   V   L LLK  ++     G+  +ASS +  +Q   F+ +Q+  +     ++   N+ +C +IL  +    +Q  D + L Y+GL  V+ +N      ++  LL +L+
Sbjct:   21 FNVALTLSLARIHRLEEQVFEMMKVAILKSFRDQQMQQSSALIKDLVSSQVWCVSDVILETIQNSA-SGWDHISQGLVQLGFTLMDSFGP-------KAGPGGK------VAE-TGAGVSRTPAQQACSLGARVLLETFKAHDLVRREILEQLLNRVVTKA-TVPITHYLELLSDMVTSAPLNLLECLPKV---QEAFDYLSVLPSPVTKGLLQAILPLLRVRINLKDSLILALRKGMFSSQLEARKSSVIGYLLLLKNFKV----LGS--LASSQTLSSQ--GFSASQVKVEVHA-RLNPAANEALCLEILGSLRRCLIQQADVRLLFYEGLYDVLRRNSKLGSTILQMLLVQLK 348          
BLAST of Transposase, Tc1-like protein vs. Ensembl Nematostella
Match: EDO26353 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC84])

HSP 1 Score: 50.0618 bits (118), Expect = 2.858e-6
Identity = 53/244 (21.72%), Postives = 107/244 (43.85%), Query Frame = 2
Query:  710 AVVNFFNQRTISCSQLSQSNINVDSRRLIS------IQTSVLHHYYEIAKNNNEFVKEILKLCK--NNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQN-FILKESHKVSVFV 1414
             V  FFN +   C +  +  IN    R IS      ++ +V+ H     K + E  +E++K  K   N+  + ++ +   + L++  +   +  + D + + I   +KD +   +S +I+E+V E  ++   ++ +++       +H++  L++LGF+L+    P++  T   S  S                     AQ+  + G  +++  FK    +R  I+  I N  I K +  VS FV
Sbjct:   23 GVTTFFNHQDDICRK--EDRINSSELRSISKDQLRHMEGTVILHVTFAIKQDQELGRELIKYLKAYQNSPSHILTPYTVALALSVTQIHRFEENVFDFLKASIIKSFKDDERRSQSKWIKENVPETSEVYDHILETVQNSLFG-WDHVTHGLVQLGFILMDCFGPKTFDTQSSSIAS--------------------PAQQACKLGSALLLDTFKAHEMVRTEILQQILNRVITKATTPVSHFV 243          
BLAST of Transposase, Tc1-like protein vs. Ensembl Medaka
Match: fanci (FA complementation group I [Source:NCBI gene;Acc:101156650])

HSP 1 Score: 73.9442 bits (180), Expect = 1.826e-12
Identity = 91/396 (22.98%), Postives = 183/396 (46.21%), Query Frame = 2
Query:  806 TSVLHHYYEIAKNNNEFVKEILKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPR----SKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQN-FILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKL 1975
            T +LH  + I + ++E  +E LK  K + A   +  F   +LL++A ++  + Q+ D++   +   YKD  L   S F+++ +  +  +  ++++++K       +H+++ L++LGF L+ +  P+     K T    GT+                      Q+  + G Q+++  FK    +R  I++ + N  + K +  VS   YL+LF+D++   P      ++ ++     F+ L          L+ A+ PL++ S ++++ LI ++   + S +   R   V   L LLK  ++     G+  +ASS     QCSQ  + +Q+  D      ++  N+  C +IL  +     Q  D + ++Y+G   V+ +N   A  ++  LL  L
Sbjct:  178 TVILHIVFAI-RLDHELGREFLKSFKTSYA--DMCPFSVALLLSVARIQRYEEQVFDLLKGAVIKSYKDEHLQQGSKFLQDLLPRHCSVAHMILDTVKNSVFG-WDHVTQGLVQLGFFLMDTFGPKPGPFGKTTEGPVGTTR------------------TPTQQACKLGGQVLLYGFKIHEPIRGEILEQVLNRLVTKTASPVS--HYLDLFSDIVVSAP---MILLESSSKVIETFDHLSCLPLATVQGLLKAVQPLLKVSISLKDALILVLRKAMFSSQLDGRKSAVAGFLLLLKNFKV----LGS--LASS-----QCSQAVSSSQVQVDVHS-RYNSAANEAFCLEILSSLRRCLGQQADVRLMLYEGFYDVLRRNSQLASSIMQTLLSHL 534          
BLAST of Transposase, Tc1-like protein vs. Ensembl Medaka
Match: fanci (FA complementation group I [Source:NCBI gene;Acc:101156650])

HSP 1 Score: 73.9442 bits (180), Expect = 1.826e-12
Identity = 91/396 (22.98%), Postives = 183/396 (46.21%), Query Frame = 2
Query:  806 TSVLHHYYEIAKNNNEFVKEILKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPR----SKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQN-FILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKL 1975
            T +LH  + I + ++E  +E LK  K + A   +  F   +LL++A ++  + Q+ D++   +   YKD  L   S F+++ +  +  +  ++++++K       +H+++ L++LGF L+ +  P+     K T    GT+                      Q+  + G Q+++  FK    +R  I++ + N  + K +  VS   YL+LF+D++   P      ++ ++     F+ L          L+ A+ PL++ S ++++ LI ++   + S +   R   V   L LLK  ++     G+  +ASS     QCSQ  + +Q+  D      ++  N+  C +IL  +     Q  D + ++Y+G   V+ +N   A  ++  LL  L
Sbjct:  178 TVILHIVFAI-RLDHELGREFLKSFKTSYA--DMCPFSVALLLSVARIQRYEEQVFDLLKGAVIKSYKDEHLQQGSKFLQDLLPRHCSVAHMILDTVKNSVFG-WDHVTQGLVQLGFFLMDTFGPKPGPFGKTTEGPVGTTR------------------TPTQQACKLGGQVLLYGFKIHEPIRGEILEQVLNRLVTKTASPVS--HYLDLFSDIVVSAP---MILLESSSKVIETFDHLSCLPLATVQGLLKAVQPLLKVSISLKDALILVLRKAMFSSQLDGRKSAVAGFLLLLKNFKV----LGS--LASS-----QCSQAVSSSQVQVDVHS-RYNSAANEAFCLEILSSLRRCLGQQADVRLMLYEGFYDVLRRNSQLASSIMQTLLSHL 534          
BLAST of Transposase, Tc1-like protein vs. Ensembl Medaka
Match: fanci (FA complementation group I [Source:NCBI gene;Acc:101156650])

HSP 1 Score: 73.1738 bits (178), Expect = 3.154e-12
Identity = 96/436 (22.02%), Postives = 199/436 (45.64%), Query Frame = 2
Query:  710 AVVNFFNQRTISCSQ----LSQSNINVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILKLCKNNNALYSISGFMC----IILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPR----SKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQN-FILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQ-FACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKL 1975
             ++++F ++ +   +    L   +I  D  R +   T +LH  + I + ++E  +E LK  K    +++    MC     +LL++A ++  + Q+ D++   +   YKD  L   S F+++ +  +  +  ++++++K       +H+++ L++LGF L+ +  P+     K T    GT+                      Q+  + G Q+++  FK    +R  I++ + N  + K +  VS   YL+LF+D++   P      ++ ++     F+ L          L+ A+ PL++ S ++++ LI ++   + S +   R   V   L LLK  ++     G+  +ASS     QCSQ  + +Q+  D      ++  N+  C +IL  +     Q  D + ++Y+G   V+ +N   A  ++  LL  L
Sbjct:  199 GIISYFKEQDVRQEEEDMDLEVQSIPQDQLRHVE-GTVILHIVFAI-RLDHELGREFLKSFKVIQMIFTSYADMCPFSVALLLSVARIQRYEEQVFDLLKGAVIKSYKDEHLQQGSKFLQDLLPRHCSVAHMILDTVKNSVFG-WDHVTQGLVQLGFFLMDTFGPKPGPFGKTTEGPVGTTR------------------TPTQQACKLGGQVLLYGFKIHEPIRGEILEQVLNRLVTKTASPVS--HYLDLFSDIVVSAP---MILLESSSKVIETFDHLSCLPLATVQGLLKAVQPLLKVSISLKDALILVLRKAMFSSQLDGRKSAVAGFLLLLKNFKV----LGS--LASS-----QCSQAVSSSQVQVDVHS-RYNSAANEAFCLEILSSLRRCLGQQADVRLMLYEGFYDVLRRNSQLASSIMQTLLSHL 596          

HSP 2 Score: 52.373 bits (124), Expect = 6.747e-6
Identity = 32/89 (35.96%), Postives = 50/89 (56.18%), Query Frame = 2
Query: 3746 ERLLFEQLFPLCTMLNKLIGCAVTNIPRLQSLIKLCTRIFDQLTTLVKQYISLIKSKMGCFASNFEKLVRISGGTLSFQASQFIVYNQV 4012
            E+ +  QL  L T LN+L+  ++       +L+++ +R +  L TLVK YI +  S+     + FEKLV++SG  L+ Q   FI Y QV
Sbjct: 1091 EKAVTLQLGTLVTALNELVQTSLQPGNCTITLLRVLSRTYSILATLVKYYIQVCTSQHSALPARFEKLVKLSGSHLTPQCYAFITYVQV 1179          
BLAST of Transposase, Tc1-like protein vs. Planmine SMEST
Match: SMESG000053320.1 (SMESG000053320.1)

HSP 1 Score: 1115.91 bits (2885), Expect = 0.000e+0
Identity = 580/582 (99.66%), Postives = 581/582 (99.83%), Query Frame = 2
Query:  686 NNFQFCVGAVVNFFNQRTISCSQLSQSNINVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILKLCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRXXXXXXXXXXXXXGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQFACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQSVVTXXXXXXXXXXXXPFVFSKILSDTNVLENLPLLVSCLAESVRQCRKNMPENDLLSAAVEENACISQAVSKAEKTLDQLSLYLSRHDILKICQLSNEISASNHQMFVEQFIDFYEVLLVHFMCSNNQENNEKIEKLFQHKELALKSLKT 2431
            NNFQFCVGAVVNFFNQRTISCSQLSQSNINVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILK CKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLII+NIQNFILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRNNLISIIMNNILSGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQFACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQSVVTNISDSNNISDNNPFVFSKILSDTNVLENLPLLVSCLAESVRQCRKNMPENDLLSAAVEENACISQAVSKAEKTLDQLSLYLSRHDILKICQLSNEISASNHQMFVEQFIDFYEVLLVHFMCSNNQENNEKIEKLFQHKELALKSLKT
Sbjct:   42 NNFQFCVGAVVNFFNQRTISCSQLSQSNINVDSRRLISIQTSVLHHYYEIAKNNNEFVKEILKFCKNNNALYSISGFMCIILLNLAGLEFIKAQILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCISEREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNNDINMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIENIQNFILKESHKVSVFVYLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLPLIRYSSTIRNNLISIIMNNILSGRSQSRLICVESALTLLKYLRITVEQFGTENVASSNSYLTQCSQFACTQIAADSKPLPVDNFNNDEICSQILQIINESSLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQSVVTNISDSNNISDNNPFVFSKILSDTNVLENLPLLVSCLAESVRQCRKNMPENDLLSAAVEENACISQAVSKAEKTLDQLSLYLSRHDILKICQLSNEISASNHQMFVEQFIDFYEVLLVHFMCSNNQENNEKIEKLFQHKELALKSLKT 623          

HSP 2 Score: 83.5741 bits (205), Expect = 9.310e-16
Identity = 39/40 (97.50%), Postives = 40/40 (100.00%), Query Frame = 1
Query:  568 MNTLTGSEKNLLIKNLLEMITTIDLEFCPGLVNEILHLCE 687
            MNTLTGSEKNLLIKNLLEMITTIDLEFCPGLVNEILHLC+
Sbjct:    1 MNTLTGSEKNLLIKNLLEMITTIDLEFCPGLVNEILHLCD 40          
BLAST of Transposase, Tc1-like protein vs. Planmine SMEST
Match: SMESG000053319.1 (SMESG000053319.1)

HSP 1 Score: 532.332 bits (1370), Expect = 7.336e-173
Identity = 271/275 (98.55%), Postives = 272/275 (98.91%), Query Frame = 2
Query: 3083 MSSFVRLHKYMVSMILIGGVRKLYGDIDSILNATLNIAIFCGIEDARKSGGSDFAYGXXXXXXXXXXXXXAWSYNILKSSKLHFKTKTGEIVKNIELSDTHVCRCLFYICMVTSRAAIPDSVNTLEKFVIDMSVKIGSYSGVAQETPKLTFEFIVHPTDLLVDLINALTLALDDVDCLLFKWKCSWQGFKQRKAINNSQLSNINSTPSDFVEESLSVITDQERLLFEQLFPLCTMLNKLIGCAVTNIPRLQSLIKLCTRIFDQLTTLVKQYISLI 3907
            MSSFVRLHKYMVSMILIGGVRKLYGDIDSILNATLNIAIFCGIEDARKSGGSDFAYGTNHLNVLLLTNLNAWSYNILKSSKLHFKTKTGEIVKNIELSDTHVCRCLFYICMVTSRAAIPDSVNTLEKFVIDMSVKIGSYSGVAQETPKLTFEFIVHPTDLLVDLINALTLALDDVDCLLFKWKCSWQGFKQRKAINNSQLSNINSTPSDFVEESLSVITDQERLLFEQLFPLCTMLNKLIGCA+TNIPRLQSLIKLCTRIFDQLTTLVKQ I  I
Sbjct:    1 MSSFVRLHKYMVSMILIGGVRKLYGDIDSILNATLNIAIFCGIEDARKSGGSDFAYGTNHLNVLLLTNLNAWSYNILKSSKLHFKTKTGEIVKNIELSDTHVCRCLFYICMVTSRAAIPDSVNTLEKFVIDMSVKIGSYSGVAQETPKLTFEFIVHPTDLLVDLINALTLALDDVDCLLFKWKCSWQGFKQRKAINNSQLSNINSTPSDFVEESLSVITDQERLLFEQLFPLCTMLNKLIGCAITNIPRLQSLIKLCTRIFDQLTTLVKQKIESI 275          
BLAST of Transposase, Tc1-like protein vs. Planmine SMEST
Match: SMESG000053319.1 (SMESG000053319.1)

HSP 1 Score: 510.76 bits (1314), Expect = 3.613e-165
Identity = 261/265 (98.49%), Postives = 262/265 (98.87%), Query Frame = 2
Query: 3113 MVSMILIGGVRKLYGDIDSILNATLNIAIFCGIEDARKSGGSDFAYGXXXXXXXXXXXXXAWSYNILKSSKLHFKTKTGEIVKNIELSDTHVCRCLFYICMVTSRAAIPDSVNTLEKFVIDMSVKIGSYSGVAQETPKLTFEFIVHPTDLLVDLINALTLALDDVDCLLFKWKCSWQGFKQRKAINNSQLSNINSTPSDFVEESLSVITDQERLLFEQLFPLCTMLNKLIGCAVTNIPRLQSLIKLCTRIFDQLTTLVKQYISLI 3907
            MVSMILIGGVRKLYGDIDSILNATLNIAIFCGIEDARKSGGSDFAYGTNHLNVLLLTNLNAWSYNILKSSKLHFKTKTGEIVKNIELSDTHVCRCLFYICMVTSRAAIPDSVNTLEKFVIDMSVKIGSYSGVAQETPKLTFEFIVHPTDLLVDLINALTLALDDVDCLLFKWKCSWQGFKQRKAINNSQLSNINSTPSDFVEESLSVITDQERLLFEQLFPLCTMLNKLIGCA+TNIPRLQSLIKLCTRIFDQLTTLVKQ I  I
Sbjct:    1 MVSMILIGGVRKLYGDIDSILNATLNIAIFCGIEDARKSGGSDFAYGTNHLNVLLLTNLNAWSYNILKSSKLHFKTKTGEIVKNIELSDTHVCRCLFYICMVTSRAAIPDSVNTLEKFVIDMSVKIGSYSGVAQETPKLTFEFIVHPTDLLVDLINALTLALDDVDCLLFKWKCSWQGFKQRKAINNSQLSNINSTPSDFVEESLSVITDQERLLFEQLFPLCTMLNKLIGCAITNIPRLQSLIKLCTRIFDQLTTLVKQKIESI 265          
BLAST of Transposase, Tc1-like protein vs. Planmine SMEST
Match: SMESG000053319.1 (SMESG000053319.1)

HSP 1 Score: 504.982 bits (1299), Expect = 5.265e-163
Identity = 258/262 (98.47%), Postives = 259/262 (98.85%), Query Frame = 2
Query: 3122 MILIGGVRKLYGDIDSILNATLNIAIFCGIEDARKSGGSDFAYGXXXXXXXXXXXXXAWSYNILKSSKLHFKTKTGEIVKNIELSDTHVCRCLFYICMVTSRAAIPDSVNTLEKFVIDMSVKIGSYSGVAQETPKLTFEFIVHPTDLLVDLINALTLALDDVDCLLFKWKCSWQGFKQRKAINNSQLSNINSTPSDFVEESLSVITDQERLLFEQLFPLCTMLNKLIGCAVTNIPRLQSLIKLCTRIFDQLTTLVKQYISLI 3907
            MILIGGVRKLYGDIDSILNATLNIAIFCGIEDARKSGGSDFAYGTNHLNVLLLTNLNAWSYNILKSSKLHFKTKTGEIVKNIELSDTHVCRCLFYICMVTSRAAIPDSVNTLEKFVIDMSVKIGSYSGVAQETPKLTFEFIVHPTDLLVDLINALTLALDDVDCLLFKWKCSWQGFKQRKAINNSQLSNINSTPSDFVEESLSVITDQERLLFEQLFPLCTMLNKLIGCA+TNIPRLQSLIKLCTRIFDQLTTLVKQ I  I
Sbjct:    1 MILIGGVRKLYGDIDSILNATLNIAIFCGIEDARKSGGSDFAYGTNHLNVLLLTNLNAWSYNILKSSKLHFKTKTGEIVKNIELSDTHVCRCLFYICMVTSRAAIPDSVNTLEKFVIDMSVKIGSYSGVAQETPKLTFEFIVHPTDLLVDLINALTLALDDVDCLLFKWKCSWQGFKQRKAINNSQLSNINSTPSDFVEESLSVITDQERLLFEQLFPLCTMLNKLIGCAITNIPRLQSLIKLCTRIFDQLTTLVKQKIESI 262          
BLAST of Transposase, Tc1-like protein vs. Planmine SMEST
Match: SMESG000003183.1 (SMESG000003183.1)

HSP 1 Score: 85.5001 bits (210), Expect = 6.294e-19
Identity = 45/73 (61.64%), Postives = 52/73 (71.23%), Query Frame = -3
Query: 5214 VG*VILTQIFNGLHIETSKSL-FFSFFQEYFNTLPC*NDEILSLFDPRRFSYDSQAVSQIAMWKESAETGTKS 5429
            VG +IL ++FN LHIE SKS   F  FQ+YF+T+P  NDE L  FD R FS+DSQAVSQI MWKESAE    S
Sbjct:    7 VGEIILKRVFNYLHIEASKSPEVFRRFQKYFDTVPHGNDETLRPFDARPFSHDSQAVSQITMWKESAEAAKSS 79          
The following BLAST results are available for this feature:
BLAST of Transposase, Tc1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
FANCI1.315e-1020.64FA complementation group I [Source:HGNC Symbol;Acc... [more]
FANCI1.323e-1020.64FA complementation group I [Source:HGNC Symbol;Acc... [more]
FANCI1.400e-1020.64FA complementation group I [Source:HGNC Symbol;Acc... [more]
FANCI1.491e-1020.64FA complementation group I [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fanci1.086e-1021.92FA complementation group I [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FANCI1.536e-1422.66polymerase (DNA directed), gamma [Source:NCBI gene... [more]
FANCI4.142e-1422.56polymerase (DNA directed), gamma [Source:NCBI gene... [more]
FANCI5.385e-1422.35polymerase (DNA directed), gamma [Source:NCBI gene... [more]
FANCI5.601e-1422.35polymerase (DNA directed), gamma [Source:NCBI gene... [more]
FANCI5.678e-1422.49polymerase (DNA directed), gamma [Source:NCBI gene... [more]
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Fanci7.959e-1422.43Fanconi anemia, complementation group I [Source:MG... [more]
Fanci8.147e-1422.43Fanconi anemia, complementation group I [Source:MG... [more]
back to top
BLAST of Transposase, Tc1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8K368|FANCI_MOUSE5.699e-1322.43Fanconi anemia group I protein homolog OS=Mus musc... [more]
sp|Q9NVI1|FANCI_HUMAN6.314e-1020.64Fanconi anemia group I protein OS=Homo sapiens OX=... [more]
back to top
BLAST of Transposase, Tc1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LDS33.494e-1625.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LIR63.734e-1625.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LJM14.261e-1625.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LK154.949e-1625.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2CWN76.124e-1624.28Fanconi anemia group I protein OS=Schistosoma japo... [more]
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fanci3.049e-1222.28FA complementation group I [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fanci1.758e-1623.88FA complementation group I [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO263532.858e-621.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fanci1.826e-1222.98FA complementation group I [Source:NCBI gene;Acc:1... [more]
fanci1.826e-1222.98FA complementation group I [Source:NCBI gene;Acc:1... [more]
fanci3.154e-1222.02FA complementation group I [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Transposase, Tc1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053320.19.310e-1699.66SMESG000053320.1[more]
SMESG000053319.17.336e-17398.55SMESG000053319.1[more]
SMESG000053319.13.613e-16598.49SMESG000053319.1[more]
SMESG000053319.15.265e-16398.47SMESG000053319.1[more]
SMESG000003183.16.294e-1961.64SMESG000003183.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30007264 ID=SMED30007264|Name=Transposase, Tc1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5959bp
GTTTGTTTAAATAATTTAATAAATTGATAAATTTCAGAAATATATATTTG
TTCAACTACTCATTTAATAATTTTAATTAATAAATATAAAAAAATGTTTT
CACAAGAATGTTATGGGAAATCTATTATTAGCCCAGATATAAAAAATCTT
AATGAAGAACAAGTAGTTAATCAGATAAAATCCATTTTTATTTATAAAGA
TAAAATTAATGATATTGTTTTTAGTGAATTAATTAAAGAAATTATGATTA
GAGAAGATTCAAATACAATTTTTATAAAAGTGTTAAAATTTTTTTGGACT
CTAGAATCAAAAAACTTTGATTCATACATTTACATTTTTATCAATTCACT
AGCAAATTTTAACGTTGCAGCCAGTTATTCAATTTTAGATAGTTTGAAAG
AAATTTTAAATGAGGTAACATTAGTCCAGGAATGCGTTTTAAGTTCCATA
CCAGTTTTGGTGGAGAACATTCGACGGAATGATAGTTTGTTTACTGGATA
TATAGACGTAACTAAAATAAATGAAAGGCCTGAAAATATTATTCCACTGG
TGAAAGTTCTAAGAGAAATGAATACTCTTACAGGAAGCGAGAAAAATCTG
TTGATTAAAAATCTTTTGGAAATGATAACTACGATTGATTTAGAGTTTTG
CCCAGGTTTAGTGAATGAGATTTTGCATTTATGTGAATAATTTCCAATTT
TGTGTTGGAGCTGTTGTTAATTTCTTTAACCAAAGAACAATTAGTTGCTC
ACAGTTAAGCCAGTCAAACATTAACGTCGATTCCAGGAGACTCATAAGTA
TTCAAACATCCGTTCTTCACCATTATTACGAAATCGCTAAAAACAATAAT
GAGTTCGTAAAGGAAATTCTGAAATTATGCAAGAATAATAATGCGCTCTA
CTCCATCAGCGGATTCATGTGCATTATTCTGCTGAATTTGGCTGGACTGG
AATTTATCAAAGCACAAATTCTCGATATGATGACCAGTTGTATTACGAGT
TGCTATAAAGACACGAAATTATTCATCGAGTCCGCATTTATTAGGGAGTC
AGTTTTTGAGAATTTCGACATGGATTCCTTGCTGATGAACTCAATAAAAT
ACTGCTGTATCAGCGAAAGGGAACACATATCGAAAAGTCTTTTGGAATTA
GGATTTCTTCTCATAAAATCTGGTCTTCCGCGCTCTAAGATAACCTCATT
GAAATCCGGCACCAGCAATAAGAAAGGAGGAGACATATTGATCAGTGAAA
TGTGTAATAACGACATCAATATGAATACTGCACAGAGAGTCGGGCAAGCT
GGGATTCAGATGGTCATTCAGTTGTTTAAACGTTTACCCAGGTTGCGGCA
GTTGATAATTGACAATATCCAGAATTTTATTTTGAAGGAATCGCATAAAG
TTTCCGTTTTTGTATATCTAGAGTTGTTTGCCGATTTGATATCTTTAATG
CCAACTGAGATATTTGATTTCATTGACGAGGCAACAACTGGGCAGCCTAT
ATTTGAATTACTATGTCATTTTCGTGAAGATGTAGCTGTAGCTCTAGTCA
ACGCCATGCTACCTCTCATCCGCTATTCTTCCACTATAAGAAATAATCTT
ATTTCCATTATCATGAATAACATTCTCTCTGGTCGGTCACAATCGCGACT
TATTTGCGTTGAATCTGCATTAACACTTTTGAAATACCTCCGGATAACTG
TGGAACAGTTTGGTACTGAAAATGTAGCCTCTTCTAACTCTTATCTCACA
CAATGTAGTCAATTCGCTTGCACGCAAATCGCTGCTGACTCGAAACCGTT
ACCGGTTGACAATTTCAATAACGATGAAATCTGCAGCCAAATCTTACAGA
TTATAAATGAATCCTCTCTTCAGTATCCTGATACGAAATCGCTGATTTAT
AAAGGTCTTCTTCAAGTTATCGAGAAAAATTACTACTTTGCCGGTCGTGT
GGTTATGTTTCTGTTGGAAAAACTGCAATCTGTAGTAACGAATATCTCCG
ATAGCAACAACATATCTGACAATAATCCTTTCGTTTTTTCCAAAATCCTT
TCCGATACAAATGTTCTGGAAAACCTCCCACTTTTGGTGTCATGCTTAGC
GGAAAGTGTTCGTCAATGTCGGAAAAATATGCCGGAAAACGATCTATTGT
CTGCAGCTGTCGAAGAAAATGCTTGCATTTCTCAAGCGGTTTCCAAAGCG
GAAAAAACTCTCGACCAATTATCCCTGTATTTATCACGACACGATATATT
GAAAATCTGTCAACTTAGCAATGAAATTTCCGCTTCCAATCACCAGATGT
TCGTTGAACAATTCATCGATTTCTATGAAGTGTTACTTGTCCATTTTATG
TGTTCAAATAATCAGGAAAATAATGAAAAAATCGAAAAGCTTTTCCAACA
CAAAGAATTAGCTTTGAAATCTCTGAAAACCGATAGAAAACCGAAAAAAT
CCAATACCGGTTCTGTCATTTCTTTAACGAGTCTTATCGCTGCAATCCGG
TATCTGTTCGATTCGCTTTTGAATGAAGCTAAAACCACCGATTCAAATCG
GGTTCCGAATCTCAGTCAAAGGCGTTTTCGAACTACTCAAGCGATTGCCA
CTGAAATCTCGATCGAAAATAATAATAGTAACAGTATCCATAGAAATATT
GTCGAAAATGTTGACTCGACTTCAATGGCGGGATTATTAAATGAAAAAGT
ATCGATATATTTATTGAATAAAGCAATAAACACAGTGAAAACGATCGGAT
CACCGGAGTATAGAATCTCTTATAGAAATCGAAAAGACATCTGTATTTTG
CTTAGGGATTTCGTTTCCATCTGTCTCGATTATTACGTGAATTGTTTACG
CAGGGAAAATATCGACACAATACCGGCATATCAACGCCAGATAATGCAAC
ACTCTATCACACTTTATTGCCTCTCTATAAACAAGGCCATTCTCTTTTGT
TCGAAATCTCTGGATATATTTCTTGAGAATTTATTTGAAGTTACAGATCA
CATAAAATCACTACAGGCGTCGATAGGTTTGATCTCGTCGGATGAGGAAT
TTAGTTCAACTGCAGAAAAAAATCAGGTTTCCATGTCTTCTTTTGTAAGA
CTCCACAAATATATGGTTTCCATGATTTTGATCGGTGGCGTTAGAAAATT
GTATGGCGATATTGATTCGATATTAAATGCCACTTTAAACATAGCGATAT
TTTGTGGAATAGAAGACGCGAGAAAATCCGGTGGATCGGATTTTGCATAT
GGAACTAATCACCTAAATGTCTTGCTTTTGACCAATCTTAATGCTTGGAG
TTATAATATTTTGAAATCATCGAAATTGCATTTTAAAACGAAAACCGGTG
AAATTGTGAAAAATATCGAGCTTAGTGATACCCATGTCTGTAGATGTCTG
TTTTACATATGTATGGTTACGAGTCGTGCAGCTATTCCGGATTCTGTCAA
CACTCTAGAGAAATTTGTCATTGATATGAGTGTGAAAATCGGATCTTATT
CAGGGGTAGCTCAAGAAACTCCAAAATTGACTTTTGAATTTATTGTTCAT
CCAACCGATTTACTAGTTGACCTTATCAATGCATTAACATTAGCTTTGGA
CGATGTCGATTGTCTATTATTCAAGTGGAAGTGTTCTTGGCAAGGATTTA
AACAAAGAAAAGCAATTAATAATTCTCAACTTTCCAATATAAATTCAACT
CCCAGTGATTTTGTTGAAGAATCTTTATCTGTTATAACCGATCAAGAGCG
GCTCTTGTTCGAGCAATTATTTCCGTTATGCACTATGCTCAATAAACTTA
TCGGTTGCGCTGTAACAAACATTCCTCGACTCCAGAGTTTGATAAAACTA
TGTACAAGAATTTTTGATCAATTAACAACTCTTGTAAAACAATATATTTC
TTTAATCAAATCAAAAATGGGTTGTTTTGCGAGTAATTTTGAAAAGTTGG
TTCGTATTTCAGGGGGAACTTTATCTTTTCAAGCGTCACAGTTTATAGTT
TACAATCAAGTTTGTTTTTAATTTGATAGCTTTTTAATACTTTTCTCATT
TTATTATTTTTAAATCATGAATTCATTAATAATTTTGATGTGATTGTATT
CGGATATTTGATGCACATGAAAATGAATGGTTTGATGGAAAAATTTGAAT
TTGGCCATTGATAAAAATGGAACCTGCAAAAAGCAATAGCAAAAATCGTA
GAGGCACTTTCATTTCCACACCCATTGTAGTTGTTAGAAAAGGAGTACCG
CAAAATGGTGATTGAAAAAACGAAATGATTACTGAATTTGTCCAACATGC
AACTACTGATGAATTTGAAAGTCGATTGATCTGTCAACCACCTAATAGCC
CCGATATGAATATCTTGGAATTTTGATATTTTTGAGCCATCCAAAGTTCC
TATAATTCAACTAATCCGTCTAATATAAATGACATCCAATTTTTTGGGCA
ATCTTTTAATTTTTATGCCTCGTGATATGTTGAATAAAGGTTTTTTGGTT
TGTGAGCATTTAATCCCGCGACATTTAATCCGACCACAGATAATCCTATT
GACATTTAAAGAAATAAGAAAAAATAAAACAAATGTATTTGACGCAATTT
AATAAAAGGTAACCAGAAGTGTTCAAGTTAAATGTAAAGTAAAATAGATA
ACTATAAATTTATAAAGTTAAATTTATGACATGTAAACCATGGCACGCAG
ATAGACAAGAATTTCGCTCGATGAGTAACGTTCCACAGTATTTTTACACG
CGTCTTCTGCGTCTGGTATTCCTTGAGGACAGATGGTTGCGAAACAGGAA
AACCTTTGCAGGAAAAACTTTTTTGCATCTGAATGTCTTTCTCGATTCCC
TTAAATAAACTCGATGAAAGCACTGAAAAAGAGCCTTAAGTGCAAAAGGT
CAACCTTCCACAGCGGTTGTTGTTCTGGAAACACCTCATGTCGTTTCAAA
GTGATTCCAACTATCGCTAAAGCAGGTAAGCAGCGAACGGTCGTTTGCCG
TAGTAAAGACTGTTTGCTTTTCGACGTTGTACTAAAAGTGATTTGTTCGT
AGGCTATAATTTAATATTATTTAAACCTGATTAAGTATCTGGGGATTAAC
TGTCACGAGATTAAGCACCAGGTTAACGAAAATTAAACGGTATGTTTTCT
GAATCAATGTCCAGCTAGCATAATTTACTGAATTACTTGTTGTCTTCTCG
TTGGTGCTATACAAGATTTAGTACCTGTTTCTGCACTTTCCTTCCACATG
GCAATCTGAGAAACAGCTTGTGAATCATATGAGAACCGTCGTGGGTCGAA
TAAACTGAGTATCTCGTCGTTTCAACATGGAAGTGTGTTGAAATACTCTT
GGAAAAAACTGAAAAAAAGAGATTTCGATGTTTCTATGTGCAAACCGTTA
AAAATTTGAGTTAAAATCACTTATCCAACACGACATGCAGACCAGATCAA
CGCACTGCTAAATTAAGTCAACGAAACACACTATTTGATAGCTGATTGAA
TGCAATGATATTAACAATGAACTTAGGACATAACAGGTTCATACAGGTTC
GTGCATGAAAATTTTATGAAACAACCTAATATAATCATAATAATTTTGAT
GTAATTGTATTTGGATATTTGATTTCACTATTCCCGTTATGTAAACCCTT
CTTATTAATGAGTATGACTTCATTACTTTGGTCCAATAATTATGCATGTA
GTATATATGTATATTGTCTGCTTTTCTTGAATAAACCTCTATATTTTTTA
TGAGTTGAATTAATCATATGACTTTCTAAAATACATCATTTACCATAAAT
ATAATCGTTTCTAGTTTTATTTTCTAGTTATTTTATAAAAGGTCAAAAAT
TACGAAAATCGTTGTTTCATATTGGATAGTTTTCACAAAAGGCTTAAAAT
ACTCTATAATTTATCAAGAATGCGTTAACGCATTTCCGGACATAGTTTTA
ACCATAAAT
back to top

protein sequence of SMED30007264-orf-1

>SMED30007264-orf-1 ID=SMED30007264-orf-1|Name=SMED30007264-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1119bp
MRFCIYVNNFQFCVGAVVNFFNQRTISCSQLSQSNINVDSRRLISIQTSV
LHHYYEIAKNNNEFVKEILKLCKNNNALYSISGFMCIILLNLAGLEFIKA
QILDMMTSCITSCYKDTKLFIESAFIRESVFENFDMDSLLMNSIKYCCIS
EREHISKSLLELGFLLIKSGLPRSKITSLKSGTSNKKGGDILISEMCNND
INMNTAQRVGQAGIQMVIQLFKRLPRLRQLIIDNIQNFILKESHKVSVFV
YLELFADLISLMPTEIFDFIDEATTGQPIFELLCHFREDVAVALVNAMLP
LIRYSSTIRNNLISIIMNNILSGRSQSRLICVESALTLLKYLRITVEQFG
TENVASSNSYLTQCSQFACTQIAADSKPLPVDNFNNDEICSQILQIINES
SLQYPDTKSLIYKGLLQVIEKNYYFAGRVVMFLLEKLQSVVTNISDSNNI
SDNNPFVFSKILSDTNVLENLPLLVSCLAESVRQCRKNMPENDLLSAAVE
ENACISQAVSKAEKTLDQLSLYLSRHDILKICQLSNEISASNHQMFVEQF
IDFYEVLLVHFMCSNNQENNEKIEKLFQHKELALKSLKTDRKPKKSNTGS
VISLTSLIAAIRYLFDSLLNEAKTTDSNRVPNLSQRRFRTTQAIATEISI
ENNNSNSIHRNIVENVDSTSMAGLLNEKVSIYLLNKAINTVKTIGSPEYR
ISYRNRKDICILLRDFVSICLDYYVNCLRRENIDTIPAYQRQIMQHSITL
YCLSINKAILFCSKSLDIFLENLFEVTDHIKSLQASIGLISSDEEFSSTA
EKNQVSMSSFVRLHKYMVSMILIGGVRKLYGDIDSILNATLNIAIFCGIE
DARKSGGSDFAYGTNHLNVLLLTNLNAWSYNILKSSKLHFKTKTGEIVKN
IELSDTHVCRCLFYICMVTSRAAIPDSVNTLEKFVIDMSVKIGSYSGVAQ
ETPKLTFEFIVHPTDLLVDLINALTLALDDVDCLLFKWKCSWQGFKQRKA
INNSQLSNINSTPSDFVEESLSVITDQERLLFEQLFPLCTMLNKLIGCAV
TNIPRLQSLIKLCTRIFDQLTTLVKQYISLIKSKMGCFASNFEKLVRISG
GTLSFQASQFIVYNQVCF*
back to top

protein sequence of SMED30007264-orf-2

>SMED30007264-orf-2 ID=SMED30007264-orf-2|Name=SMED30007264-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=199bp
MFSQECYGKSIISPDIKNLNEEQVVNQIKSIFIYKDKINDIVFSELIKEI
MIREDSNTIFIKVLKFFWTLESKNFDSYIYIFINSLANFNVAASYSILDS
LKEILNEVTLVQECVLSSIPVLVENIRRNDSLFTGYIDVTKINERPENII
PLVKVLREMNTLTGSEKNLLIKNLLEMITTIDLEFCPGLVNEILHLCE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006313transposition, DNA-mediated
GO:0015074DNA integration
GO:0006281DNA repair
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000070intestinal phagocyte
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR029312FANCI_HD2
IPR029315FANCI_S2
IPR029314FANCI_S4
IPR029310FANCI_HD1